Search completed in 0.89 seconds.
106 results for "validity":
Your results are loading. Please wait...
ValidityState.patternMismatch - Web APIs
the read-only patternmismatch property of a validitystate object indicates if the value of an <input>, after having been edited by the user, does not conform to the constraints set by the element's pattern attribute.
... input:invalid { border: red solid 3px; } note, in this case, we get a patternmismatch not a validitystate.toolong or validitystate.tooshort if the values are too long or too short because it is the pattern that is dictating the length of the value.
... had we used minlength and maxlength attributes instead, we may have seen validitystate.toolong or validitystate.tooshort being true.
...And 4 more matches
HTMLObjectElement.setCustomValidity - Web APIs
the setcustomvalidity() method of the htmlobjectelement interface sets a custom validity message for the element.
... syntax htmlobjectelement.setcustomvalidity(message); parameters error the message to use for validity errors.
...additionally you must call the reportvalidity method on the same element or nothing will happen.
...And 2 more matches
HTMLSelectElement.setCustomValidity() - Web APIs
the htmlselectelement.setcustomvalidity() method sets the custom validity message for the selection element to the specified message.
... use the empty string to indicate that the element does not have a custom validity error.
... syntax selectelt.setcustomvalidity(string); parameters string is the domstring containing the error message.
...And 2 more matches
ValidityState - Web APIs
the validitystate interface represents the validity states that an element can be in, with respect to constraint validation.
... customerror read only a boolean indicating whether the element's custom validity message has been set to a non-empty string by calling the element's setcustomvalidity() method.
... specifications specification status comment html living standardthe definition of 'validitystate' in that specification.
...And 2 more matches
validityState.badInput - Web APIs
the read-only badinput property of a validitystate object indicates if the user has provided input that the browser is unable to convert.
... example <input type="number" id="age"> var input = document.getelementbyid("age"); if (input.validity.badinput) { console.log("bad input detected…"); } else { console.log("content of input ok."); } specifications specification status comment html living standardthe definition of 'validitystate.badinput' in that specification.
... living standard live standard html 5.1the definition of 'validitystate.badinput' in that specification.
... html5the definition of 'validitystate.badinput' in that specification.
ValidityState.rangeOverflow - Web APIs
the read-only rangeoverflow property of a validitystate object indicates if the value of an <input>, after having been edited by the user, does not conform to the constraints set by the element's max attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.rangeoverflow' in that specification.
... living standard html 5.1the definition of 'validitystate.rangeoverflow' in that specification.
... recommendation html5the definition of 'validitystate.rangeoverflow' in that specification.
ValidityState.rangeUnderflow - Web APIs
the read-only rangeunderflow property of a validitystate object indicates if the value of an <input>, after having been edited by the user, does not conform to the constraints set by the element's min attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.rangeunderflow' in that specification.
... living standard html 5.1the definition of 'validitystate.rangeunderflow' in that specification.
... recommendation html5the definition of 'validitystate.rangeunderflow' in that specification.
ValidityState.stepMismatch - Web APIs
the read-only stepmismatch property of a validitystate object indicates if the value of an <input>, after having been edited by the user, does not conform to the constraints set by the element's step attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.stepmismatch' in that specification.
... living standard html 5.1the definition of 'validitystate.stepmismatch' in that specification.
... recommendation html5the definition of 'validitystate.stepmismatch' in that specification.
validityState.tooLong - Web APIs
the read-only toolong property of a validitystate object indicates if the value of an <input> or <textarea>, after having been edited by the user, exceeds the maximum code-unit length established by the element's maxlength attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.toolong' in that specification.
... living standard html 5.1the definition of 'validitystate.toolong' in that specification.
... recommendation html5the definition of 'validitystate.toolong' in that specification.
validityState.tooShort - Web APIs
the read-only tooshort property of a validitystate object indicates if the value of an <input>, <button>, <select>, <output>, <fieldset> or <textarea>, after having been edited by the user, is less than the minimum code-unit length established by the element's minlength attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.tooshort' in that specification.
... living standard html 5.1the definition of 'validitystate.tooshort' in that specification.
... recommendation html5the definition of 'validitystate.tooshort' in that specification.
ValidityState.typeMismatch - Web APIs
the read-only typemismatch property of a validitystate object indicates if the value of an <input>, after having been edited by the user, does not conform to the constraints set by the element's type attribute.
... specifications specification status comment html living standardthe definition of 'validitystate.typemismatch' in that specification.
... living standard html 5.1the definition of 'validitystate.typemismatch' in that specification.
... recommendation html5the definition of 'validitystate.typemismatch' in that specification.
HTMLFormElement.reportValidity() - Web APIs
the htmlformelement.reportvalidity() method returns true if the element's child controls satisfy their validation constraints.
... syntax htmlformelement.reportvalidity() return value boolean example document.forms['myform'].addeventlistener('submit', function() { document.forms['myform'].reportvalidity(); }, false); specifications specification status comment html living standardthe definition of 'htmlformelement.reportvalidity()' in that specification.
... living standard html 5.1the definition of 'htmlformelement.reportvalidity()' in that specification.
HTMLObjectElement.checkValidity - Web APIs
the checkvalidity() method of the htmlobjectelement interface returns a boolean that always is true, because object objects are never candidates for constraint validation.
... syntax const valid = htmlobjectelement.checkvalidity(); parameters none.
... specifications specification status comment html living standardthe definition of 'checkvalidity' in that specification.
HTMLObjectElement.validity - Web APIs
the validity read-only property of the htmlobjectelement interface returns a validitystate with the validity states that this element is in.
... syntax var validitystate = htmlobjectelement.validity; value a validitystate object.
... specifications specification status comment html living standardthe definition of 'validity' in that specification.
HTMLSelectElement.checkValidity() - Web APIs
the htmlselectelement.checkvalidity() method checks whether the element has any constraints and whether it satisfies them.
... syntax var result = selectelt.checkvalidity(); specifications specification status comment html living standardthe definition of 'htmlselectelement.checkvalidity()' in that specification.
... html5the definition of 'htmlselectelement.checkvalidity()' in that specification.
Index
based on application), the trust restrictions recorded inside the certificate (extensions) permit the use (e.g., encryption might be allowed, but not signing), and based on environment/application policy it might be required to perform a revocation check (ocsp or crl), that asks the issuer(s) of the certificates whether there have been events that made it necessary to revoke the trust (revoke the validity of the cert).
...if a self-signed certificate is marked as explicitly trusted, nss will skip checking the self-signature for validity.
...there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candidate issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...And 15 more matches
<input>: The Input (Form Input) element - HTML: Hypertext Markup Language
Web › HTML › Element › input
checkvalidity() immediately runs the validity check on the element, triggering the document to fire the invalid event at the element if the value isn't valid.
... reportvalidity() returns true if the element's value passes validity checks; otherwise, returns false.
... setcustomvalidity() sets a custom message to display if the input element's value isn't valid.
...And 14 more matches
Client-side form validation - Learn web development
validity: returns a validitystate object that contains several properties describing the validity state of the element.
... you can find full details of all the available properties in the validitystate reference page; below is listed a few of the more common ones: patternmismatch: returns true if the value does not match the specified pattern, and false if it does match.
... checkvalidity(): returns true if the element's value has no validity problems; false otherwise.
...And 11 more matches
NSS Tools certutil
-v check the validity of a certificate and its attributes.
... -b validity-time specify a time at which a certificate is required to be valid.
... use when checking certificate validity with the -v option.
...And 11 more matches
NSS tools : certutil
-v check the validity of a certificate and its attributes.
... -b validity-time specify a time at which a certificate is required to be valid.
... use when checking certificate validity with the -v option.
...And 9 more matches
certutil
-v check the validity of a certificate and its attributes.
... -b validity-time specify a time at which a certificate is required to be valid.
... use when checking certificate validity with the -v option.
...And 9 more matches
Index - Web APIs
Web › API › Index
1677 htmlformelement.reportvalidity() html, htmlformelement, method, reference the htmlformelement.reportvalidity() method returns true if the element's child controls satisfy their validation constraints.
... 1749 htmlinputelement: invalid event constraint validation, event, forms, reference, events, invalid the invalid event fires when a submittable element has been checked for validity and doesn't satisfy its constraints.
... 1841 htmlobjectelement.checkvalidity api, html dom, htmlobjectelement, method, needsexample, reference, checkvalidity() the checkvalidity() method of the htmlobjectelement interface returns a boolean that always is true, because object objects are never candidates for constraint validation.
...And 9 more matches
Constraint validation - Developer guides
the constraint validation is done in the following ways: by a call to the checkvalidity() or reportvalidity() method of a form-associated dom interface, (htmlinputelement, htmlselectelement, htmlbuttonelement, htmloutputelement or htmltextareaelement), which evaluates the constraints only on this element, allowing a script to get this information.
... the checkvalidity() method returns a boolean indicating whether the element's value passes its constraints.
... (this is typically done by the user-agent when determining which of the css pseudo-classes, :valid or :invalid, applies.) in contrast, the reportvalidity() method reports any constraint failures to the user.
...And 9 more matches
Constraint validation API - Web APIs
constraint validation interfaces validitystate the validitystate interface represents the validity states that a form control element can have, with respect to its defined constraints.
...nsions to other interfaces the constraint validation api extends the interfaces for the form-associated elements listed below with a number of new properties and methods (elements that can have a form attribute that indicates their form owner): htmlbuttonelement htmlfieldsetelement htmlinputelement htmlobjectelement htmloutputelement htmlselectelement htmltextareaelement properties validity a read-only property that returns a validitystate object, whose properties represent validation errors for the value of that element.
...this will be displayed in the ui if the element is the only form control with a validity problem; if a custom error message is set using setcustomvalidity(), this will be shown.
...And 8 more matches
HTMLInputElement - Web APIs
validity read only validitystate object: returns the element's current validity state.
...this value can be set by the setcustomvalidity method.
... setcustomvalidity() sets a custom validity message for the element.
...And 5 more matches
HTMLSelectElement - Web APIs
htmlselectelement.validityread only a validitystate reflecting the validity state that this control is in.
... htmlselectelement.checkvalidity() checks whether the element has any constraints and whether it satisfies them.
... htmlselectelement.reportvalidity() this method reports the problems with the constraints on the element, if any, to the user.
...And 5 more matches
Introduction to SSL - Archive of obsolete content
although the fourth question is not technically part of the ssl protocol, it is the client's responsibility to support this requirement, which provides some assurance of the server's identity and thus helps protect against a form of security attack known as "man in the middle." an ssl-enabled client goes through these steps to authenticate a server's identity: is today's date within the validity period?
... the client checks the server certificate's validity period.
...if the current date and time are within the certificate's validity period, the client goes on to step.
...And 4 more matches
HTMLFieldSetElement - Web APIs
htmlfieldsetelement.validity a validitystate representing the validity states that this element is in.
... htmlfieldsetelement.checkvalidity() always returns true because <fieldset> objects are never candidates for constraint validation.
... htmlfieldsetelement.reportvalidity() always returns true because <fieldset> objects are never candidates for constraint validation.
...And 4 more matches
HTMLTextAreaElement - Web APIs
validity read only validitystate object: returns the validity states that this element is in.
... checkvalidity() returns false if the element is a candidate for constraint validation, and it does not satisfy its constraints.
... reportvalidity() this method reports the problems with the constraints on the element, if any, to the user.
...And 4 more matches
Introduction to Public-Key Cryptography - Archive of obsolete content
the server uses techniques of public-key cryptography to validate the signature and confirm the validity of the certificate.
...this data and the digital signature constitute "evidence" of the private key's validity.
... here are the data and signature sections of a certificate in human-readable format: certificate: data: version: v3 (0x2) serial number: 3 (0x3) signature algorithm: pkcs #1 md5 with rsa encryption issuer: ou=ace certificate authority, o=ace industry, c=us validity: not before: fri oct 17 18:36:25 1997 not after: sun oct 17 18:36:25 1999 subject: cn=jane doe, ou=finance, o=ace industry, c=us subject public key info: algorithm: pkcs #1 rsa encryption public key: modulus: 00:ca:fa:79:98:8f:19:f8:d7:de:e4:49:80:48:e6:2a:2a:86: ed:27:40:4d:86:b3:05:c0:01:bb:50:15:c9:de:dc:85:19:22: 43:7d:45:6d:71:4e:17:3d:f0:36:4b:5b:7f:a8:51:a3:a1:00:...
...And 3 more matches
HTMLButtonElement - Web APIs
htmlbuttonelement.validity read only is a validitystate representing the validity states that this button is in.
... methods inherits methods from its parent, htmlelement name return type description checkvalidity() boolean not supported for reset or button elements.
... reportvalidity() boolean not supported for reset or button elements.
...And 3 more matches
HTMLObjectElement - Web APIs
htmlobjectelement.validity read only returns a validitystate with the validity states that this element is in.
... htmlobjectelement.checkvalidity() retuns a boolean that always is true, because object objects are never candidates for constraint validation.
... htmlobjectelement.setcustomvalidity() sets a custom validity message for the element.
...And 3 more matches
Enc Dec MAC Using Key Wrap CertReq PKCS10 CSR
); } return result; } /* * makev1cert */ static certcertificate * makev1cert(certcertdbhandle *handle, certcertificaterequest *req, char * issuernickname, prbool selfsign, unsigned int serialnumber, int warpmonths, int validitymonths) { prexplodedtime printabletime; prtime now; prtime after; certvalidity *validity = null; certcertificate *issuercert = null; certcertificate *cert = null; if ( !selfsign ) { issuercert = cert_findcertbynicknameoremailaddr(handle, issuernickname); if (!issuercert) { pr_fprintf(pr_stderr, "could ...
...d %s\n", issuernickname); goto cleanup; } } now = pr_now(); pr_explodetime (now, pr_gmtparameters, &printabletime); if ( warpmonths ) { printabletime.tm_month += warpmonths; now = pr_implodetime (&printabletime); pr_explodetime (now, pr_gmtparameters, &printabletime); } printabletime.tm_month += validitymonths; after = pr_implodetime (&printabletime); /* note that the time is now in micro-second unit */ validity = cert_createvalidity (now, after); if (validity) { cert = cert_createcertificate(serialnumber, (selfsign ?
... &req->subject : &issuercert->subject), validity, req); cert_destroyvalidity(validity); } cleanup: if ( issuercert ) { cert_destroycertificate (issuercert); } return cert; } /* * add a certificate to the nss database */ secstatus addcert(pk11slotinfo *slot, certcertdbhandle *handle, const char *name, char *trusts, char *infilename, prbool ascii, prbool emailcert, void *pwdata) { secitem certder; secstatus rv; certcerttrust *trust = null; certcertificate *cert = null; certder.data = null; /* read in the entire file specified with the -i argument */ rv = readderfromfile(&certder, infilename, ascii); if (rv != secsuccess) { pr_fprintf(pr_stderr, "una...
...And 2 more matches
sample2
f the arena, it will be freed * when the arena is freed */ result = null; goto cleanup; } cert->dercert = *result; cleanup: if (caprivatekey) { seckey_destroyprivatekey(caprivatekey); } return result; } /* * makev1cert */ static certcertificate * makev1cert(certcertdbhandle *handle, certcertificaterequest *req, char * issuernickname, prbool selfsign, unsigned int serialnumber, int warpmonths, int validitymonths) { prexplodedtime printabletime; prtime now; prtime after; certvalidity *validity = null; certcertificate *issuercert = null; certcertificate *cert = null; if ( !selfsign ) { issuercert = cert_findcertbynicknameoremailaddr(handle, issuernickname); if (!issuercert) { pr_fprintf(pr_stderr, "could not find certificate named %s\n", issuernickname); goto cleanup; } } now = pr_now(); pr_explodeti...
...me (now, pr_gmtparameters, &printabletime); if ( warpmonths ) { printabletime.tm_month += warpmonths; now = pr_implodetime (&printabletime); pr_explodetime (now, pr_gmtparameters, &printabletime); } printabletime.tm_month += validitymonths; after = pr_implodetime (&printabletime); /* note that the time is now in micro-second unit */ validity = cert_createvalidity (now, after); if (validity) { cert = cert_createcertificate(serialnumber, (selfsign ?
... &req->subject : &issuercert->subject), validity, req); cert_destroyvalidity(validity); } cleanup: if ( issuercert ) { cert_destroycertificate (issuercert); } return cert; } /* * add a certificate to the nss database */ secstatus addcert(pk11slotinfo *slot, certcertdbhandle *handle, const char *name, char *trusts, char *infilename, prbool ascii, prbool emailcert, void *pwdata) { secitem certder; secstatus rv; certcerttrust *trust = null; certcertificate *cert = null; certder.data = null; /* read in the entire file specified with the -i argument */ rv = readderfromfile(&certder, infilename, ascii); if (rv != secsuccess) { pr_fprintf(pr_stderr, "unable to read input file %s : %s\n", infilename, port_errortostring(rv)); goto cleanup; } /* read in an ascii cert and return a certcertificate */ cert = c...
...And 2 more matches
sslcrt.html
validating certificates manipulating certificates getting certificate information comparing secitem objects validating certificates cert_verifycertnow cert_verifycertname cert_checkcertvalidtimes nss_cmpcertchainwcanames cert_verifycertnow checks that the current date is within the certificate's validity period and that the ca signature on the certificate is valid.
... cert_checkcertvalidtimes checks whether a specified time is within a certificate's validity period.
... syntax #include <cert.h> #include <certt.h> seccerttimevalidity cert_checkcertvalidtimes( certcertificate *cert, int64 t); parameters this function has the following parameters: cert a pointer to the certificate whose validity period you want to check against.
...And 2 more matches
HTMLOutputElement - Web APIs
htmloutputelement.validityread only a validitystate representing the validity states that this element is in.
... htmloutputelement.checkvalidity() checks the validity of the element and returns a boolean holding the check result.
... htmloutputelement.reportvalidity() this method reports the problems with the constraints on the element, if any, to the user.
...And 2 more matches
Alerts - Accessibility
bel> <input name="website" id="website"/> </fieldset> <label for="message">please enter your message (required):</label> <br /> <textarea name="message" id="message" rows="5" cols="80" aria-required="true"></textarea> <br /> <input type="submit" name="submit" value="send message"/> <input type="reset" name="reset" value="reset form"/> </form> checking for validity and notifying the user form validations consists of several steps: checking if the e-mail address or entered name are valid.
...tbyid("alert"); if (oldalert){ document.body.removechild(oldalert); } } function addalert(amsg) { removeoldalert(); var newalert = document.createelement("div"); newalert.setattribute("role", "alert"); newalert.setattribute("id", "alert"); var msg = document.createtextnode(amsg); newalert.appendchild(msg); document.body.appendchild(newalert); } function checkvalidity(aid, asearchterm, amsg) { var elem = document.getelementbyid(aid); var invalid = (elem.value.indexof(asearchterm) < 0); if (invalid) { elem.setattribute("aria-invalid", "true"); addalert(amsg); } else { elem.setattribute("aria-invalid", "false"); removeoldalert(); } } </script> the checkvalidity function the primary method in javascript used for form valid...
...ation is the checkvalidity function.
...And 2 more matches
<input type="number"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › number
<input id="ticketnum" type="number" name="ticketnum" list="defaultnumbers"> <span class="validity"></span> <datalist id="defaultnumbers"> <option value="10045678"> <option value="103421"> <option value="11111111"> <option value="12345678"> <option value="12999922"> </datalist> use of the list attribute with number inputs is not supported in all browsers.
... the following example exhibits all of the above features, as well as using some css to display valid and invalid icons, depending on the input's value: <form> <div> <label for="balloons">number of balloons to order (multiples of 10):</label> <input id="balloons" type="number" name="balloons" step="10" min="0" max="100" required> <span class="validity"></span> </div> <div> <input type="submit"> </div> </form> try submitting the form with different invalid values entered — e.g., no value; a value below 0 or above 100; a value that is not a multiple of 10; or a non-numerical value — and see how the error messages the browser gives you differ with different ones.
... the css applied to this example is as follows: div { margin-bottom: 10px; } input:invalid+span:after { content: '✖'; padding-left: 5px; } input:valid+span:after { content: '✓'; padding-left: 5px; } here we use the :invalid and :valid pseudo classes to display an appropriate invalid or valid icon as generated content on the adjacent <span> element, as a visual indicator of validity.
...And 2 more matches
<input type="time"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › time
in the following example we are setting a minimum time of 12:00 and a maximum time of 18:00: <form> <label for="appt-time">choose an appointment time (opening hours 12:00 to 18:00): </label> <input id="appt-time" type="time" name="appt-time" min="12:00" max="18:00"> <span class="validity"></span> </form> here's the css used in the above example.
...be prepared for this situation to arise: const input = document.createelement('input'); input.type = 'time'; input.min = '23:00'; input.max = '01:00'; input.value = '23:59'; if (input.validity.valid && input.type === 'time') { // <input type=time> reversed range supported } else { // <input type=time> reversed range unsupported } making times required in addition, you can use the required attribute to make filling in the time mandatory.
... let's look at an example; here we've set minimum and maximum times, and also made the field required: <form> <div> <label for="appt-time">choose an appointment time (opening hours 12:00 to 18:00): </label> <input id="appt-time" type="time" name="appt-time" min="12:00" max="18:00" required> <span class="validity"></span> </div> <div> <input type="submit" value="submit form"> </div> </form> if you try to submit the form with an incomplete time (or with a time outside the set bounds), the browser displays an error.
...And 2 more matches
An overview of NSS Internals
based on application), the trust restrictions recorded inside the certificate (extensions) permit the use (e.g., encryption might be allowed, but not signing), and based on environment/application policy it might be required to perform a revocation check (ocsp or crl), that asks the issuer(s) of the certificates whether there have been events that made it necessary to revoke the trust (revoke the validity of the cert).
...if a self-signed certificate is marked as explicitly trusted, nss will skip checking the self-signature for validity.
...there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candidate issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...of simply verifying that the requester of a certificate is in control of an administrative email address at the desired web site's domain, it's required that the ca performs a verification of real world identity documents (such as a company registration document with the country's authority), and it's also required that a browser software performs a revocation check with the ca, prior to granting validity to the certificate.
HTMLKeygenElement - Web APIs
validity read only is a validitystate representing the validity states that this element is in.
... methods name & arguments return description checkvalidity() boolean always returns true because keygen objects are never candidates for constraint validation.
... setcustomvalidity(in domstring error) void sets a custom validity message for the element.
... if this message is not the empty string, then the element is suffering from a custom validity error, and does not validate.
HTML attribute: pattern - HTML: Hypertext Markup Language
if a non-null value doesn't conform to the constraints set by the pattern value, the validitystate object's read-only patternmismatch property will be true.
...if the pattern attribute isn't present, and the value doesn't match the expected syntax for that value type, the validitystate object's read-only typemismatch property will be true.
... input:invalid { border: red solid 3px; } had we used minlength and maxlength attributes instead, we may have seen validitystate.toolong or validitystate.tooshort being true.
... <form> <div> <label for="uname">choose a username: </label> <input type="text" id="uname" name="name" required size="45" pattern="[a-z]{4,8}" title="4 to 8 lowercase letters"> <span class="validity"></span> <p>usernames must be lowercase and 4-8 characters in length.</p> </div> <div> <button>submit</button> </div> </form> div { margin-bottom: 10px; position: relative; } p { font-size: 80%; color: #999; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { posi...
<input type="tel"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › tel
for example, let's use this html: <form> <div> <label for="telno">enter a telephone number (required): </label> <input id="telno" name="telno" type="tel" required> <span class="validity"></span> </div> <div> <button>submit</button> </div> </form> and let's include the following css to highlight valid entries with a checkmark and invalid entries with a cross: div { margin-bottom: 10px; position: relative; } input[type="number"] { width: 100px; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-...
... in this example we'll use the same css as before, but our html is changed to look like this: <form> <div> <label for="telno">enter a telephone number (in the form xxx-xxx-xxxx): </label> <input id="telno" name="telno" type="tel" required pattern="[0-9]{3}-[0-9]{3}-[0-9]{4}"> <span class="validity"></span> </div> <div> <button>submit</button> </div> </form> div { margin-bottom: 10px; position: relative; } input[type="number"] { width: 100px; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; color: #8b0000; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5...
... <select id="country" name="country"> <option>uk</option> <option selected>us</option> <option>germany</option> </select> </div> <div> <p>enter your telephone number: </p> <span class="areadiv"> <input id="areano" name="areano" type="tel" required placeholder="area code" pattern="[0-9]{3}" aria-label="area code"> <span class="validity"></span> </span> <span class="number1div"> <input id="number1" name="number1" type="tel" required placeholder="first part" pattern="[0-9]{3}" aria-label="first part of number"> <span class="validity"></span> </span> <span class="number2div"> <input id="number2" name="number2" type="tel" required placeholder="second part" pat...
...tern="[0-9]{4}" aria-label="second part of number"> <span class="validity"></span> </span> </div> <div> <button>submit</button> </div> </form> the javascript is relatively simple — it contains an onchange event handler that, when the <select> value is changed, updates the <input> element's pattern, placeholder, and aria-label to suit the format of telephone numbers in that country/territory.
Certificate functions
r cert_certlistfromcert mxr 3.2 and later cert_certtimesvalid mxr 3.2 and later cert_changecerttrust mxr 3.2 and later cert_checkcertvalidtimes mxr 3.2 and later cert_checknamespace mxr 3.12 and later cert_checkcertusage mxr 3.3 and later cert_comparename mxr 3.2 and later cert_comparevaliditytimes mxr 3.11 and later cert_completecrldecodeentries mxr 3.6 and later cert_convertanddecodecertificate mxr 3.9.3 and later cert_copyname mxr 3.4 and later cert_copyrdn mxr 3.5 and later cert_createava mxr 3.2.1 and later cert_createcertificate mxr 3.5 and later cert_createcertificaterequest ...
... mxr 3.2 and later cert_createname mxr 3.2.1 and later cert_createocspcertid mxr 3.6 and later cert_createocsprequest mxr 3.6 and later cert_createrdn mxr 3.2.1 and later cert_createsubjectcertlist mxr 3.4 and later cert_createvalidity mxr 3.5 and later cert_crlcacherefreshissuer mxr 3.7 and later cert_decodealtnameextension mxr 3.10 and later cert_decodeauthinfoaccessextension mxr 3.10 and later cert_decodeauthkeyid mxr 3.10 and later cert_decodeavavalue mxr 3.4 and later cert_decodebasicconstraintvalue mxr 3.2 and later cert_decodecertfrompackage mxr 3.4 and later cert_decodecertificatepoli...
...ert_destroycertlist mxr 3.2 and later cert_destroyname mxr 3.2 and later cert_destroyocspcertid mxr 3.6 and later cert_destroyocsprequest mxr 3.6 and later cert_destroyocspresponse mxr 3.7 and later cert_destroyoidsequence mxr 3.9 and later cert_destroyusernotice mxr 3.10 and later cert_destroyvalidity mxr 3.5 and later cert_dupcertificate mxr 3.2 and later cert_dupcertlist mxr 3.2 and later cert_enableocspchecking mxr 3.2 and later cert_encodealtnameextension mxr 3.7 and later cert_encodeandaddbitstrextension mxr 3.5 and later cert_encodeauthkeyid mxr 3.5 and later cert_encodebasicconstrain...
NSS functions
r cert_certlistfromcert mxr 3.2 and later cert_certtimesvalid mxr 3.2 and later cert_changecerttrust mxr 3.2 and later cert_checkcertvalidtimes mxr 3.2 and later cert_checknamespace mxr 3.12 and later cert_checkcertusage mxr 3.3 and later cert_comparename mxr 3.2 and later cert_comparevaliditytimes mxr 3.11 and later cert_completecrldecodeentries mxr 3.6 and later cert_convertanddecodecertificate mxr 3.9.3 and later cert_copyname mxr 3.4 and later cert_copyrdn mxr 3.5 and later cert_createava mxr 3.2.1 and later cert_createcertificate mxr 3.5 and later cert_createcertificaterequest ...
... mxr 3.2 and later cert_createname mxr 3.2.1 and later cert_createocspcertid mxr 3.6 and later cert_createocsprequest mxr 3.6 and later cert_createrdn mxr 3.2.1 and later cert_createsubjectcertlist mxr 3.4 and later cert_createvalidity mxr 3.5 and later cert_crlcacherefreshissuer mxr 3.7 and later cert_decodealtnameextension mxr 3.10 and later cert_decodeauthinfoaccessextension mxr 3.10 and later cert_decodeauthkeyid mxr 3.10 and later cert_decodeavavalue mxr 3.4 and later cert_decodebasicconstraintvalue mxr 3.2 and later cert_decodecertfrompackage mxr 3.4 and later cert_decodecertificatepoli...
...ert_destroycertlist mxr 3.2 and later cert_destroyname mxr 3.2 and later cert_destroyocspcertid mxr 3.6 and later cert_destroyocsprequest mxr 3.6 and later cert_destroyocspresponse mxr 3.7 and later cert_destroyoidsequence mxr 3.9 and later cert_destroyusernotice mxr 3.10 and later cert_destroyvalidity mxr 3.5 and later cert_dupcertificate mxr 3.2 and later cert_dupcertlist mxr 3.2 and later cert_enableocspchecking mxr 3.2 and later cert_encodealtnameextension mxr 3.7 and later cert_encodeandaddbitstrextension mxr 3.5 and later cert_encodeauthkeyid mxr 3.5 and later cert_encodebasicconstrain...
HTMLFormElement - Web APIs
checkvalidity() returns true if the element's child controls are subject to constraint validation and satisfy those contraints; returns false if some controls do not satisfy their constraints.
... reportvalidity() returns true if the element's child controls satisfy their validation constraints.
...the following method has been added: checkvalidity().
<input type="date"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › date
let's look at an example of minimum and maximum dates, and also made a field required: <form> <label> choose your preferred party date (required, april 1st to 20th): <input type="date" name="party" min="2017-04-01" max="2017-04-20" required> <span class="validity"></span> </label> <p> <button>submit</button> </p> </form> if you try to submit the form with an incomplete date (or with a date outside the set bounds), the browser displays an error.
...for example, try viewing the following in a unsupporting browser: <form> <label for="bday">enter your birthday: <input type="date" name="bday" required pattern="\d{4}-\d{2}-\d{2}"> <span class="validity"></span> </label> <p> <button>submit</button> </p> </form> if you submit it, you'll see that the browser displays an error and highlights the input as invalid if your entry doesn't match the pattern ####-##-## (where # is a digit from 0 to 9).
... html the html looks like so: <form> <div class="nativedatepicker"> <label for="bday">enter your birthday:</label> <input type="date" id="bday" name="bday"> <span class="validity"></span> </div> <p class="fallbacklabel">enter your birthday:</p> <div class="fallbackdatepicker"> <span> <label for="day">day:</label> <select id="day" name="day"> </select> </span> <span> <label for="month">month:</label> <select id="month" name="month"> <option selected>january</option> <option>february</...
<input type="datetime-local"> - HTML: Hypertext Markup Language
let's look at an example; here we've set minimum and maximum date/time values, and also made the field required: <form> <div> <label for="party">choose your preferred party date and time (required, june 1st 8.30am to june 30th 4.30pm):</label> <input id="party" type="datetime-local" name="partydate" min="2017-06-01t08:30" max="2017-06-30t16:30" required> <span class="validity"></span> </div> <div> <input type="submit" value="book party!"> </div> </form> if you try to submit the form with an incomplete date (or with a date outside the set bounds), the browser displays an error.
...ng the following demo in a non-supporting browser: <form> <div> <label for="party">choose your preferred party date and time (required, june 1st 8.30am to june 30th 4.30pm):</label> <input id="party" type="datetime-local" name="partydate" min="2017-06-01t08:30" max="2017-06-30t16:30" pattern="[0-9]{4}-[0-9]{2}-[0-9]{2}t[0-9]{2}:[0-9]{2}" required> <span class="validity"></span> </div> <div> <input type="submit" value="book party!"> </div> <input type="hidden" id="timezone" name="timezone" value="-08:00"> </form> if you try submitting it, you'll see that the browser now displays an error message (and highlights the input as invalid) if your entry doesn't match the pattern nnnn-nn-nntnn:nn, where n is a number from 0 to 9.
... the html looks like so: <form> <div class="nativedatetimepicker"> <label for="party">choose a date and time for your party:</label> <input type="datetime-local" id="party" name="bday"> <span class="validity"></span> </div> <p class="fallbacklabel">choose a date and time for your party:</p> <div class="fallbackdatetimepicker"> <div> <span> <label for="day">day:</label> <select id="day" name="day"> </select> </span> <span> <label for="month">month:</label> <select id="month" name="month"> <option selected>january</option> ...
<input type="month"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › month
let's look at an example; here we've set minimum and maximum dates, and also made the field required: <form> <div> <label for="month">what month would you like to visit us (summer months only, please)?</label> <input id="month" type="month" name="month" min="2017-06" max="2017-09" required> <span class="validity"></span> </div> <div> <input type="submit" value="submit form"> </div> </form> if you try to submit the form without both the month and year specified (or with a date outside the set bounds), the browser displays an error.
...(summer months only, yyyy-mm)</label> <input id="month" type="month" name="month" min="2017-06" max="2017-09" required pattern="[0-9]{4}-[0-9]{2}"> <span class="validity"></span> </div> <div> <input type="submit" value="submit form"> </div> </form> if you try submitting it, you'll see that the browser now displays an error message (and highlights the input as invalid) if your entry doesn't match the pattern nnnn-nn, where n is a number from 0 to 9.
... html the form that requests the month and year looks like this: <form> <div class="nativedatepicker"> <label for="month-visit">what month would you like to visit us?</label> <input type="month" id="month-visit" name="month-visit"> <span class="validity"></span> </div> <p class="fallbacklabel">what month would you like to visit us?</p> <div class="fallbackdatepicker"> <div> <span> <label for="month">month:</label> <select id="month" name="month"> <option selected>january</option> <option>february</option> <option>march</option> <option>april</option> <option>may</o...
<input type="search"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › search
making input required you can use the required attribute as an easy way of making entering a value required before form submission is allowed: <form> <div> <input type="search" id="mysearch" name="q" placeholder="search the site..." required> <button>search</button> <span class="validity"></span> </div> </form> input { margin-right: 10px; } input:invalid ~ span:after { content: '✖'; padding-left: 5px; position: absolute; } input:valid ~ span:after { content: '✓'; padding-left: 5px; position: absolute; } this renders like so: in addition, if you try to submit the form with no search term entered into it, the browser will show a message.
... <form> <div> <label for="mysearch">search for user</label> <input type="search" id="mysearch" name="q" placeholder="user ids are 4–8 characters in length" required size="30" minlength="4" maxlength="8"> <button>search</button> <span class="validity"></span> </div> </form> input { margin-right: 10px; } input:invalid ~ span:after { content: '✖'; padding-left: 5px; position: absolute; } input:valid ~ span:after { content: '✓'; padding-left: 5px; position: absolute; } this renders like so: if you try to submit the form with less than 4 characters, you'll be given an appropriate error message (which diffe...
...the following example covers it: <form> <div> <label for="mysearch">search for product by id:</label> <input type="search" id="mysearch" name="q" placeholder="two letters followed by four numbers" required size="30" pattern="[a-z]{2}[0-9]{4}"> <button>search</button> <span class="validity"></span> </div> </form> input { margin-right: 10px; } input:invalid ~ span:after { content: '✖'; padding-left: 5px; position: absolute; } input:valid ~ span:after { content: '✓'; padding-left: 5px; position: absolute; } this renders like so: examples you can see a good example of a search form used in context at our website-aria-roles example (see it live...
<input type="text"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › text
making input required you can use the required attribute as an easy way of making entering a value required before form submission is allowed: <form> <div> <label for="uname">choose a username: </label> <input type="text" id="uname" name="name" required> <span class="validity"></span> </div> <div> <button>submit</button> </div> </form> div { margin-bottom: 10px; position: relative; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5px; } this renders like so: if you try to submit the form with no search t...
... <form> <div> <label for="uname">choose a username: </label> <input type="text" id="uname" name="name" required size="10" placeholder="username" minlength="4" maxlength="8"> <span class="validity"></span> </div> <div> <button>submit</button> </div> </form> div { margin-bottom: 10px; position: relative; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5px; } this renders like so: if you try to submit the form with less than 4...
... <form> <div> <label for="uname">choose a username: </label> <input type="text" id="uname" name="name" required size="45" pattern="[a-z]{4,8}"> <span class="validity"></span> <p>usernames must be lowercase and 4-8 characters in length.</p> </div> <div> <button>submit</button> </div> </form> div { margin-bottom: 10px; position: relative; } p { font-size: 80%; color: #999; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { posi...
<input type="week"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › week
in the following example we are setting a minimum value of week 01, 2017 and a maximum value of week 52, 2017: <form> <label for="week">what week would you like to start?</label> <input id="week" type="week" name="week" min="2017-w01" max="2017-w52"> <span class="validity"></span> </form> here's the css used in the above example.
... let's look at an example; here we've set minimum and maximum weeks, and also made the field required: <form> <div> <label for="week">what week would you like to start?</label> <input id="week" type="week" name="week" min="2017-w01" max="2017-w52" required> <span class="validity"></span> </div> <div> <input type="submit" value="submit form"> </div> </form> if you try to submit the form with no value, the browser displays an error.
... the html looks like so: <form> <div class="nativeweekpicker"> <label for="week">what week would you like to start?</label> <input id="week" type="week" name="week" min="2017-w01" max="2018-w52" required> <span class="validity"></span> </div> <p class="fallbacklabel">what week would you like to start?</p> <div class="fallbackweekpicker"> <div> <span> <label for="week">week:</label> <select id="fallbackweek" name="week"> </select> </span> <span> <label for="year">year:</label> <select id="year" name="year"> <option value="2017" selected>2017</...
NSS 3.18 release notes
new functions in certdb.h sec_checkcrltimes - check the validity of a crl at the given time.
... sec_getcrltimes - extract the validity times from a crl.
NSS tools : crlutil
n-critical code where: reasoncode: identifies the name of an extension non-critical: should be set to 0 since this is non-critical extension code: the following codes are available: unspecified (0), keycompromise (1), cacompromise (2), affiliationchanged (3), superseded (4), cessationofoperation (5), certificatehold (6), removefromcrl (8), privilegewithdrawn (9), aacompromise (10) * add invalidity date extension: the invalidity date is a non-critical crl entry extension that provides the date on which it is known or suspected that the private key was compromised or that the certificate otherwise became invalid.
... invaliditydate non-critical date where: crlnumber: identifies the name of an extension non-critical: should be set to 0 since this is non-critical extension date: invalidity date of a cert.
NSS Tools crlutil
0 since this is non-critical extension code: the following codes are available: unspecified (0), keycompromise (1), cacompromise (2), affiliationchanged (3), superseded (4), cessationofoperation (5), certificatehold (6), removefromcrl (8), privilegewithdrawn (9), aacompromise (10) add invalidity date extension: the invalidity date is a non-critical crl entry extension that provides the date on which it is known or suspected that the private key was compromised or that the certificate otherwise became invalid.
... invaliditydate non-critical date where: crlnumber: identifies the name of an extension non-critical: should be set to 0 since this is non-critical extension date: invalidity date of a cert.
NSS tools : crlutil
Mozilla › Projects › NSS › tools › crlutil
where: reasoncode: identifies the name of an extension non-critical: should be set to 0 since this is non-critical extension code: the following codes are available: unspecified (0), keycompromise (1), cacompromise (2), affiliationchanged (3), superseded (4), cessationofoperation (5), certificatehold (6), removefromcrl (8), privilegewithdrawn (9), aacompromise (10) * add invalidity date extension: the invalidity date is a non-critical crl entry extension that provides the date on which it is known or suspected that the private key was compromised or that the certificate otherwise became invalid.
... invaliditydate non-critical date where: crlnumber: identifies the name of an extension non-critical: should be set to 0 since this is non-critical extension date: invalidity date of a cert.
A Web PKI x509 certificate primer
in general, x509 certificates bind a signature to a validity period, a public key, a subject, an issuer, and a set of extensions.
... the attributes of the certificates in the verification path have valid parameters for that verification (for example the validity period of all the certificates are valid for the time the verification is being done) revocation checks are considered ok for that particular validation.
IAccessibleText
once the handler has returned, the validity of the data depends on how the server manages the life cycle of its objects.
...once the handler has returned, the validity of the data depends on how the server manages the life cycle of its objects.
nsIFaviconService
no validity checking is done.
...no validity checking is done.
Filelink Providers
for each input event, the checkvalidity method of the form is automatically called.
... the button to set up the account will only become enabled once the checkvalidity method for the form returns true.
HTMLInputElement: invalid event - Web APIs
the invalid event fires when a submittable element has been checked for validity and doesn't satisfy its constraints.
...the validity of submittable elements is checked before submitting their owner <form>, or after the checkvalidity() method of the element or its owner <form> is called.
Using the aria-invalid attribute - Accessibility
<input name="name" id="name" aria-required="true" aria-invalid="false" onblur="checkvalidity('name', ' ', 'invalid name entered (requires both first and last name)');"/> <br /> <input name="email" id="email" aria-required="true" aria-invalid="false" onblur="checkvalidity('email', '@', 'invalid e-mail address');"/> note that it is not necessary to validate the fields immediately on blur; the application could wait until the form is submitted (though this is not necessarily re...
... the snippet below shows a very simple validation function, which only checks for the presence of a particular character (in the real world, validation will likely be more sophisticated): function checkvalidity(aid, asearchterm, amsg){ var elem = document.getelementbyid(aid); var invalid = (elem.value.indexof(asearchterm) < 0); if (invalid) { elem.setattribute("aria-invalid", "true"); updatealert(amsg); } else { elem.setattribute("aria-invalid", "false"); updatealert(); } } the snippet below shows the alert functions, which add (or remove) the error message: function updatealert(msg) { var oldalert = document.getelementbyid("alert"); if (oldalert) { document.body.removechild(oldalert); } if (msg) { ...
<input type="checkbox"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › checkbox
however, most of the validitystates will always be false.
... if the checkbox has the required attribute, but is not checked, then validitystate.valuemissing will be true.
url - Archive of obsolete content
isvaliduri(uri) checks the validity of a uri.
Signing an XPI - Archive of obsolete content
without the certificate-issuers ca root certificate mozilla firefox will not confirm the validity of your certificate to users who want to install your extension.
cert_override.txt - Archive of obsolete content
ssl) hash algorithm oid sha1-256: oid.2.16.840.1.101.3.4.2.1 (most used) sha-384: oid.2.16.840.1.101.3.4.2.2 sha-512: oid.2.16.840.1.101.3.4.2.3 certificate fingerprint using previous hash algorithm one or more characters for override type: m : allow mismatches in the hostname u : allow untrusted certs (whether it's self signed cert or a missing or invalid issuer cert) t : allow errors in the validity time, for example, for expired or not yet valid certs certificate's serial number and the issuer name as a base64 encoded string ...
The HTML5 input types - Learn web development
note: if the data entered is not an email address, the :invalid pseudo-class will match, and the validitystate.typemismatch property will return true.
Test your skills: Advanced styling - Learn web development
what we'd like you to do is make use of some advanced pseudo-classes to provide some useful indicators of validity.
Handling common HTML and CSS problems - Learn web development
however, it is not very convenient to have to copy and paste your code over to a web page to check its validity several times.
Handling common JavaScript problems - Learn web development
code editor plugins it is not very convenient to have to copy and paste your code over to a web page to check its validity several times.
Localizing XLIFF files for iOS
open the file in firefox to have it run a validity check and correct any errors it might yell about.
Mozilla Web Developer FAQ
despite common allegations to the contrary, the document is not checked for validity.
PR_CreateThread
nspr does not assess the type or the validity of the value passed in this parameter.
PR EnumerateAddrInfo
this parameter is not checked for validity.
PR_EnumerateHostEnt
this parameter is not checked for validity.
PR_FindSymbol
the runtime does nothing to ensure the continued validity of the symbol.
Threads
nspr does not check for the validity of the thread.
NSS 3.12.4 release notes
ld options for vc6 bug 507228: coreconf.dep doesn't need to contain the nss version number bug 507422: crash [[@ port_freearena - lg_mksecretkeyrep] when port_newarena fails bug 507482: nss 3.12.3 (and later) doesn't build on aix 5.1 bug 507937: pwdecrypt program problems bug 508259: pk11mode crashed on linux2.4 bug 508467: libpkix ocsp checker should use date argument to obtain the time for cert validity verification bug 510367: fix the utf8 characters in the nickname string for ac raíz certicamara s.a.
NSS 3.48 release notes
n of versions lower than 1.3 after helloretryrequest bug 1596450 - added a simplified and unified mac implementation for hmac and cmac behind pkcs#11 bug 1522203 - remove an old pentium pro performance workaround bug 1592557 - fix prng known-answer-test scripts bug 1586176 - encryptupdate should use maxout not block size (cve-2019-11745) bug 1593141 - add `notbefore` or similar "beginning-of-validity-period" parameter to mozilla::pkix::trustdomain::checkrevocation bug 1591363 - fix a pbkdf2 memory leak in nsc_generatekey if key length > max_key_len (256) bug 1592869 - use arm neon for ctr_xor bug 1566131 - ensure sha-1 fallback disabled in tls 1.2 bug 1577803 - mark pkcs#11 token as friendly if it implements ckp_public_certificates_token bug 1566126 - power ghash vector acceleration bug...
nss tech note3
when nss is asked to verify the validity of a certificate chain, it verifies the validity of that cert chain for a particular purpose, known as a seccertusage, as of a specific date and time.
Overview of NSS
the online certificate status protocol (ocsp) governs real-time confirmation of certificate validity.
NSPR functions
pr_geterror pr_seterror calendar time nss certificate verification functions take a prtime parameter that specifies the time instant at which the validity of the certificate should verified.
Building the WebLock UI
in this part of the tutorial, however, we only provide the means of adding an url provided as a string (which is not checked for validity) and passing it through to the addsite api we defined in the earlier part of the tutorial.
Mozilla internal string guide
(you can make a 16-bit string guaranteed-valid utf-16 by passing it to ensureutf16validity().) the most common encodings are: ascii - 7-bit encoding for basic english-only strings.
IAccessibleTable
once the handler has returned, the validity of the data depends on how the server manages the life cycle of its objects.
IAccessibleTable2
once the handler has returned, the validity of the data depends on how the server manages the life cycle of its objects.
nsIDBFolderInfo
g flags long folderdate unsigned long foldername string foldersize unsigned long highwater nsmsgkey imaphierarchyseparator wchar imaptotalpendingmessages long imapuidvalidity long imapunreadpendingmessages long knownartsset string locale astring mailboxname astring nummessages long numunreadmessages long sortorder nsmsgviewsortordervalue ...
View Source - Firefox Developer Tools
error reporter ≠ validator view source only reports parsing errors, not html validity errors.
GlobalEventHandlers.oninvalid - Web APIs
the validity of submittable elements is checked before submitting their owner form, or after the checkvalidity() method of the element or its owner form is called.
The HTML DOM API - Web APIs
formdataevent htmlformcontrolscollection htmloptionscollection radionodelist validitystate canvas and image interfaces these interfaces represent objects used by the canvas api as well as the <img> element and <picture> elements.
Payment Request API - Web APIs
consistent error handling: the browser can check the validity of card numbers, and can tell the user if a card has expired (or is about to expire).
Window.getComputedStyle() - Web APIs
note: valid pseudo-element selector refers to syntactic validity, e.g.
How to check the security state of an XMLHTTPRequest over SSL - Web APIs
ueryinterface(ci.nsisslstatusprovider) .sslstatus.queryinterface(ci.nsisslstatus).servercert; dump("\tcommon name (cn) = " + cert.commonname + "\n"); dump("\tissuer = " + cert.issuerorganization + "\n"); dump("\torganisation = " + cert.organization + "\n"); dump("\tsha1 fingerprint = " + cert.sha1fingerprint + "\n"); var validity = cert.validity.queryinterface(ci.nsix509certvalidity); dump("\tvalid from " + validity.notbeforegmt + "\n"); dump("\tvalid until " + validity.notaftergmt + "\n"); } } catch(err) { alert(err); } } function test(url) { var req = cc["@mozilla.org/xmlextras/xmlhttprequest;1"].createinstance(); req.open('get', url, true); req.addeventlistener("error", function(e) { ...
Web APIs
Web › API
peinfo u uievent ulongrange url urlsearchparams urlutilsreadonly usb usbalternateinterface usbconfiguration usbdevice usbendpoint usbintransferresult usbinterface usbisochronousintransferpacket usbisochronousintransferresult usbisochronousouttransferpacket usbisochronousouttransferresult usbouttransferresult usvstring userdatahandler userproximityevent v vttcue vttregion validitystate videoconfiguration videoplaybackquality videotrack videotracklist visualviewport w webgl_color_buffer_float webgl_compressed_texture_astc webgl_compressed_texture_atc webgl_compressed_texture_etc webgl_compressed_texture_etc1 webgl_compressed_texture_pvrtc webgl_compressed_texture_s3tc webgl_compressed_texture_s3tc_srgb webgl_debug_renderer_info webgl_debug_shaders webgl_depth_texture...
ARIA - Accessibility
however, the accessibility gains it provides far outweigh any technical invalidity.
:-moz-ui-invalid - CSS: Cascading Style Sheets
the result is that if the control was valid when the user started interacting with it, the validity styling is changed only when the user shifts focus to another control.
:-moz-ui-valid - CSS: Cascading Style Sheets
the result is that if the control was valid when the user started interacting with it, the validity styling is changed only when the user shifts focus to another control.
Syntax - CSS: Cascading Style Sheets
Web › CSS › Syntax
it is important to note that even if a ruleset characterized by a group of selectors is a kind of shorthand replacing rulesets with a single selector each, this doesn't apply to the validity of the ruleset itself.
Using CSS custom properties (variables) - CSS: Cascading Style Sheets
validity and values the classical css concept of validity, tied to each property, is not very useful in regard to custom properties.
HTML attribute: max - HTML: Hypertext Markup Language
Web › HTML › Attributes › max
if the value exceeds the max value allowed, the validitystate.rangeoverflow will be true, and the the control will be matched by the :out-of-range and :invalid pseudo-classes.
HTML attribute: maxlength - HTML: Hypertext Markup Language
constraint validation while the browser will generally prevent user from entering more text than the maxlength attribute allows, should the length be longer than the maxlength allows, the read-only toolong property of a validitystate object will be true.
HTML attribute: minlength - HTML: Hypertext Markup Language
the input will fail constraint validation if the length of the text value of the field is less than minlength utf-16 code units long, with validitystate.tooshort returning true.
<input type="url"> - HTML: Hypertext Markup Language
Web › HTML › Element › input › url
tion: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5px; } <form> <div> <label for="myurl">enter the problem website address:</label> <input id="myurl" name="myurl" type="url" required pattern=".*\.myco\..*" title="the url must be in a myco domain"> <span class="validity"></span> </div> <div> <label for="mycomment">what is the problem?</label> <input id="mycomment" name="mycomment" type="text" required> <span class="validity"></span> </div> <div> <button>submit</button> </div> </form> first of all, the required attribute is specified, making it mandatory that a valid email address be provided.
HTML documentation index - HTML: Hypertext Markup Language
Web › HTML › Index
if a non-null value doesn't conform to the constraints set by the pattern value, the validitystate object's read-only patternmismatch property will be true.
Regular expressions - JavaScript
when the user presses the "check" button, the script checks the validity of the number.
String.fromCharCode() - JavaScript
no validity checks are performed.