Search completed in 0.90 seconds.
CSS selectors - Learn web development
previous overview: building blocks next in css,
selectors are used to target the html elements on our web pages that we want to style.
... there are a wide variety of css
selectors available, allowing for fine-grained precision when selecting elements to style.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn how css
selectors work in detail.
...And 24 more matches
Type, class, and ID selectors - Learn web development
previous overview: building blocks next in this lesson we will take a look at the simplest
selectors that are available, which you will probably use the most in your work.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the different css
selectors we can use to apply css to a document.
... type
selectors a type
selector is sometimes referred to as a tag name
selector or element
selector, because it selects an html tag/element in your document.
...And 17 more matches
Element.querySelectorAll() - Web APIs
the element method query
selectorall() returns a static (not live) nodelist representing a list of elements matching the specified group of
selectors which are descendants of the element on which the method was called.
... note: this method is implemented based on the parentnode mixin's query
selectorall() method.
... syntax elementlist = parentnode.query
selectorall(
selectors); parameters
selectors a domstring containing one or more
selectors to match against.
...And 17 more matches
Document.querySelectorAll() - Web APIs
the document method query
selectorall() returns a static (not live) nodelist representing a list of the document's elements that match the specified group of
selectors.
... note: this method is implemented based on the parentnode mixin's query
selectorall() method.
... syntax elementlist = parentnode.query
selectorall(
selectors); parameters
selectors a domstring containing one or more
selectors to match against.
...And 15 more matches
ParentNode.querySelectorAll() - Web APIs
the parentnode mixin defines the query
selectorall() method as returning a nodelist representing a list of elements matching the specified group of
selectors which are descendants of the object on which the method was called.
... if you need only a single result, consider the query
selector() method instead.
... note: this method is implemented as element.query
selectorall(), document.query
selectorall(), and documentfragment.query
selectorall() syntax elementlist = parentnode.query
selectorall(
selectors); parameters
selectors a domstring containing one or more
selectors to match against.
...And 14 more matches
Attribute selectors - Learn web development
in css you can use attribute
selectors to target elements with certain attributes.
... this lesson will show you how to use these very useful
selectors.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn what attribute
selectors are and how to use them.
...And 12 more matches
Document.querySelector() - Web APIs
the document method query
selector() returns the first element within the document that matches the specified
selector, or group of
selectors.
... syntax element = document.query
selector(
selectors); parameters
selectors a domstring containing one or more
selectors to match.
... this string must be a valid css
selector string; if it isn't, a syntax_err exception is thrown.
...And 11 more matches
ParentNode.querySelector() - Web APIs
the parentnode mixin defines the query
selector() method as returning an element representing the first element matching the specified group of
selectors which are descendants of the object on which the method was called.
... if you need all the elements matching the
selector list, use query
selectorall() instead.
... note: this method is implemented as document.query
selector(), documentfragment.query
selector() and element.query
selector().
...And 11 more matches
Element.querySelector() - Web APIs
the query
selector() method of the element interface returns the first element that is a descendant of the element on which it is invoked that matches the specified group of
selectors.
... syntax element = baseelement.query
selector(
selectors); parameters
selectors a group of
selectors to match the descendant elements of the element baseelement against; this must be valid css syntax, or a syntaxerror exception will occur.
... the first element found which matches this group of
selectors is returned.
...And 10 more matches
CSS selectors - CSS: Cascading Style Sheets
css
selectors define the elements to which a set of css rules apply.
... note: there are no
selectors or combinators to select parent items, siblings of parents, or children of parent siblings.
... basic
selectors universal
selector selects all elements.
...And 9 more matches
Locating DOM elements using selectors - Web APIs
the
selectors api provides methods that make it quick and easy to retrieve element nodes from the dom by matching against a set of
selectors.
... the node
selector interface this specification adds two new methods to any objects implementing the document, documentfragment, or element interfaces: query
selector() returns the first matching element node within the node's subtree.
... query
selectorall() returns a nodelist containing all matching element nodes within the node's subtree, or an empty nodelist if no matches are found.
...And 6 more matches
DocumentFragment.querySelector() - Web APIs
the documentfragment.query
selector() method returns the first element, or null if no matches are found, within the documentfragment (using depth-first pre-order traversal of the document's nodes) that matches the specified group of
selectors.
... if the
selector matches an id and this id is erroneously used several times in the document, it returns the first matching element.
... if the
selectors specified in parameter are invalid a domexception with a syntax_err value is raised.
...And 5 more matches
Selector list - CSS: Cascading Style Sheets
the css
selector list (,) selects all the matching nodes.
... /* selects all matching elements */ span, div { border: red 2px solid; } to reduce the size of style sheets, one can group
selectors in comma-separated lists.
... syntax element, element, element { style properties } examples single line grouping grouping
selectors in a single line using a comma-separated lists.
...And 5 more matches
Test your skills: Selectors - Learn web development
the aim of this task is to help you check your understanding of
selectors in css.
...
selectors one without changing the html, use css to do the following things: make h1 headings blue.
...
selectors two without changing the html, make the following changes to the look of the content in this example: give the element with an id of special a yellow background.
...And 4 more matches
QuerySelector - Archive of obsolete content
along the lines of other frameworks such as jquery or prototype, shortening the "query
selector" name can be convenient: function $ (
selector, el) { if (!el) {el = document;} return el.query
selector(
selector); } function $$ (
selector, el) { if (!el) {el = document;} return el.query
selectorall(
selector); // note: the returned object is a nodelist.
... // if you'd like to convert it to a array for convenience, use this instead: // return array.prototype.slice.call(el.query
selectorall(
selector)); } alert($('#myid').id); (note that while using the firefox web console, the above functions are available automatically.) both xul and even xml can be easily made supportable (an alternative approach to the following would be to add chromewindow.prototype or window.prototype, accessing this.document.query
selector, or following the jquery style of chaining by returning 'this' within each prototype method of $()): htmldocument.prototype.$ = function (
selector) { // only for html return this.query
selector(
selector); }; example: <h1>test!</h1> <script> htmldocument.prototype.$ = function (
selector) { return this.query
selector(
selector);...
... }; alert(document.$('h1')); // [object htmlheadingelement] </script> xuldocument.prototype.$ = function (
selector) { // only for xul return this.query
selector(
selector); }; example: <label value="test!"/> <script type="text/javascript"><![cdata[ xuldocument.prototype.$ = function (
selector) { // only for xul return this.query
selector(
selector); }; alert(document.$('label')); // [object xulelement] ]]></script> document.prototype.$ = function (
selector) { // only for plain xml return this.query
selector(
selector); }; var foo = document.implementation.createdocument('somens', 'foo', null); // create an xml document <foo xmlns="somens"/> var bar = foo.createelementns('somens', 'bar'); // add <bar xmlns="somens"/> foo.documentelement.appendchild(bar); alert(foo.$('bar').nodename); // ...
...And 3 more matches
Class selectors - CSS: Cascading Style Sheets
the css class
selector matches elements based on the contents of their class attribute.
...ss="spacious" */ .spacious { margin: 2em; } /* all <li> elements with class="spacious" */ li.spacious { margin: 2em; } /* all <li> elements with a class list that includes both "spacious" and "elegant" */ /* for example, class="elegant retro spacious" */ li.spacious.elegant { margin: 2em; } syntax .class_name { style properties } note that this is equivalent to the following attribute
selector: [class~=class_name] { style properties } examples css .red { color: #f33; } .yellow-bg { background: #ffa; } .fancy { font-weight: bold; text-shadow: 4px 4px 3px #77f; } html <p class="red">this paragraph has red text.</p> <p class="red yellow-bg">this paragraph has red text and a yellow background.</p> <p class="red fancy">this paragraph has red text and "fancy" styling.</p> <p...
...>this is just a regular paragraph.</p> result specifications specification status comment
selectors level 4the definition of 'class
selectors' in that specification.
...And 3 more matches
ID selectors - CSS: Cascading Style Sheets
the css id
selector matches an element based on the value of the element’s id attribute.
... in order for the element to be selected, its id attribute must match exactly the value given in the
selector.
... /* the element with id="demo" */ #demo { border: red 2px solid; } syntax #id_value { style properties } note that syntactically (but not specificity-wise), this is equivalent to the following attribute
selector: [id=id_value] { style properties } examples css #identified { background-color: skyblue; } html <div id="identified">this div has a special id on it!</div> <div>this is just a regular div.</div> result specifications specification status comment
selectors level 4the definition of 'id
selectors' in that specification.
...And 3 more matches
CSSStyleRule.selectorText - Web APIs
the cssrule.
selectortext property gets the textual representation of the
selector for the rule set.
... syntax string = cssrule.
selectortext example // for cssrule: body { background-color: darkblue; } var stylesheet = document.stylesheets[0]; alert(stylesheet.cssrules[0].
selectortext); // body notes the implementation may have stripped out insignificant whitespace while parsing the
selector.
... if set to a
selector string which cannot be parsed, a syntaxerror is thrown.
...And 2 more matches
Attribute selectors - CSS: Cascading Style Sheets
the css attribute
selector matches elements based on the presence or value of a given attribute.
...g="en-us en-gb en-au en-nz">hello world!</div> <div lang="pt">olá mundo!</div> <div lang="zh-cn">世界您好!</div> <div lang="zh-tw">世界您好!</div> <div data-lang="zh-tw">世界您好!</div> result html ordered lists the html specification requires the type attribute to be matched case-insensitively due to it primarily being used in the <input> element, trying to use attribute
selectors to with the type attribute of an ordered list doesn't work without the case-sensitive modifier.
...*/ ol[type="a"] { list-style-type: lower-alpha; background: red; } ol[type="a" s] { list-style-type: lower-alpha; background: lime; } ol[type="a" s] { list-style-type: upper-alpha; background: lime; } html <ol type="a"> <li>example list</li> </ol> result specifications specification status comment
selectors level 4the definition of 'attribute
selectors' in that specification.
...And 2 more matches
Type selectors - CSS: Cascading Style Sheets
the css type
selector matches elements by node name.
...*/ a { color: red; } syntax element { style properties } examples css span { background-color: skyblue; } html <span>here's a span with some text.</span> <p>here's a p with some text.</p> <span>here's a span with more text.</span> result specifications specification status comment
selectors level 4the definition of 'type (tag name)
selector' in that specification.
... working draft no changes
selectors level 3the definition of 'type
selectors' in that specification.
...And 2 more matches
Universal selectors - CSS: Cascading Style Sheets
the css universal
selector (*) matches elements of any type.
... /* selects all elements */ * { color: green; } beginning with css3, the asterisk may be used in combination with namespaces: ns|* - matches all elements in namespace ns *|* - matches all elements |* - matches all elements without any declared namespace syntax * { style properties } the asterisk is optional with simple
selectors.
...</p> result specifications specification status comment
selectors level 4the definition of 'universal
selector' in that specification.
...And 2 more matches
DocumentFragment.querySelectorAll() - Web APIs
the documentfragment.query
selectorall() method returns a nodelist of elements within the documentfragment (using depth-first pre-order traversal of the document's nodes) that matches the specified group of
selectors.
... if the
selectors specified in parameter are invalid a domexception with a syntax_err value is raised.
... syntax elementlist = documentfragment.query
selectorall(
selectors); parameters
selectors is a domstring containing one or more css
selectors separated by commas.
... examples this example returns a list of all div elements within the documentfragment with a class of either "note" or "alert": var matches = documentfrag.query
selectorall("div.note, div.alert"); specifications specification status comment
selectors api level 1the definition of 'documentfragment.query
selectorall' in that specification.
Privacy and the :visited selector - CSS: Cascading Style Sheets
before about 2010, the css :visited
selector allowed websites to uncover a user's browsing history and figure out what sites the user had visited.
... little white lies to preserve users' privacy, firefox and other browsers will lie to web applications under certain circumstances: the window.getcomputedstyle method, and similar functions such as element.query
selector, will always return values indicating that a user has never visited any of the links on a page.
... if you use a sibling
selector such as :visited + span, the adjacent element (span in this example) will be styled as if the link were unvisited.
... colors that are otherwise transparent will fail to appear if styled in a :visited
selector.
xChannelSelector - SVG: Scalable Vector Graphics
the xchannel
selector attribute indicates which color channel from in2 to use to displace the pixels in in along the x-axis.
...is using this attribute: <fedisplacementmap> html, body, svg { height: 100%; } <svg viewbox="0 0 440 160" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" xchannel
selector="r"/> </filter> <filter id="displacementfilter2"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" xchannel
selector="b"/> </filter> <text x="10" y="60" font-size="50" filter="url(#displacementfilter)">some displaced text</tex...
... specifications specification status comment filter effects module level 1the definition of 'xchannel
selector' in that specification.
... working draft no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'xchannel
selector' in that specification.
yChannelSelector - SVG: Scalable Vector Graphics
the ychannel
selector attribute indicates which color channel from in2 to use to displace the pixels in in along the y-axis.
...is using this attribute: <fedisplacementmap> html, body, svg { height: 100%; } <svg viewbox="0 0 440 160" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" ychannel
selector="r"/> </filter> <filter id="displacementfilter2"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" ychannel
selector="b"/> </filter> <text x="10" y="60" font-size="50" filter="url(#displacementfilter)">some displaced text</tex...
... specifications specification status comment filter effects module level 1the definition of 'ychannel
selector' in that specification.
... working draft no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'ychannel
selector' in that specification.
Selector (CSS) - MDN Web Docs Glossary: Definitions of Web-related terms
a css
selector is the part of a css rule that describes what elements in a document the rule will match.
... consider this css: p { color: green; } div.warning { width: 100%; border: 2px solid yellow; color: white; background-color: darkred; padding: 0.8em 0.8em 0.6em; } #customized { font: 16px lucida grande, arial, helvetica, sans-serif; } the
selectors here are "p" (which applies the color green to the text inside any <p> element), "div.warning" (which makes any <div> element with the class "warning" look like a warning box), and "#customized", which sets the base font of the element with the id "customized" to 16-pixel tall lucida grande or one of a few fallback fonts.
Using the :target pseudo-class in selectors - CSS: Cascading Style Sheets
for example, the url http://developer.mozilla.org/en/docs/using_the_:target_
selector#example contains the fragment identifier #example.
...thus, to add a border to the #example fragment, we would write: #example:target { border: 1px solid black; } targeting all elements if the intent is to create a "blanket" style that will apply to all targeted elements, then the universal
selector comes in handy: :target { color: red; } example in the following example, there are five links that point to elements in the same document.
Comparison of CSS Selectors and XPath - XPath
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes this article seeks to document the difference between css
selectors and xpath for web developers to be able to better choose the right tool for the right job.
... xpath feature css equivalent ancestor, parent or preceding-sibling axis :has()
selector attribute axis attribute
selectors child axis child combinator descendant axis descendant combinator following-sibling axis general sibling combinator or adjacent sibling combinator self axis :scope or :host
selector ...
Cascade and inheritance - Learn web development
the h1 ends up being colored blue — these rules have an identical
selector and therefore carry the same specificity, so the last one in the source order wins.
... specificity specificity is how the browser decides which rule applies if multiple rules have different
selectors, but could still apply to the same element.
... it is basically a measure of how specific a
selector's selection will be: an element
selector is less specific — it will select all elements of that type that appear on a page — so will get a lower score.
...And 27 more matches
Index - Archive of obsolete content
205 query
selector dom no summary!
... 2134 :-moz-full-screen-ancestor css, css:mozilla extensions, deprecated, non-standard, pseudo-class, reference,
selector the :-moz-full-screen-ancestor css pseudo-class is a mozilla extension that represents all ancestors of the full-screen element, except containing frames in parent documents, which are the full-screen element in their own documents.
... 2135 :-moz-system-metric() :-moz-system-metric, css, css:mozilla extensions, non-standard, obsolete, pseudo-class,
selector this page was auto-generated because a user created a sub-page to this page.
...And 23 more matches
:is() (:matches(), :any()) - CSS: Cascading Style Sheets
the :is() css pseudo-class function takes a
selector list as its argument, and selects any element that can be selected by one of the
selectors in that list.
... this is useful for writing large
selectors in a more compact form.
...:any() works in exactly the same way as :matches()/:is(), except that it requires vendor prefixes and doesn't support complex
selectors.
...And 21 more matches
Specificity - CSS: Cascading Style Sheets
specificity is based on the matching rules which are composed of different sorts of css
selectors.
... specificity is a weight that is applied to a given css declaration, determined by the number of each
selector type in the matching
selector.
...
selector types the following list of
selector types increases by specificity: type
selectors (e.g., h1) and pseudo-elements (e.g., ::before).
...And 21 more matches
context-menu - Archive of obsolete content
selectorcontext(
selector) this context occurs when the menu is invoked on a node that either matches
selector, a css
selector, or has an ancestor that matches.
...
selector may include multiple
selectors separated by commas, e.g., "a[href], img".
...for example: var context = require("sdk/context-menu").
selectorcontext("img"); mymenuitem.context.add(context); mymenuitem.context.remove(context); when a menu item is bound to more than one context, it appears in the menu when all of those contexts occur.
...And 16 more matches
How CSS is structured - Learn web development
selectors a
selector targets html to apply styles to content.
... we have already discovered a variety of
selectors in the getting started with css tutorial.
... if css is not applying to content as-expected, your
selector may not match the way you think it should match.
...And 15 more matches
Index - Learn web development
this module looks at the cascade and inheritance, all the
selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
... 107 css
selectors attribute, beginner, css, class, learn, pseudo,
selectors, id in css,
selectors are used to target the html elements on our web pages that we want to style.
... there are a wide variety of css
selectors available, allowing for fine-grained precision when selecting elements to style.
...And 13 more matches
Index - Web APIs
388 css.escape() api, css, cssom, method, reference, static, escape() the css.escape() static method returns a cssomstring containing the escaped string passed as parameter, mostly for use as part of a css
selector.
... 450 csspseudoelement.type api, csspseudoelement, experimental, property, reference, type the type read-only property of the csspseudoelement interface returns the type of the pseudo-element as a string, represented in the form of a css
selector.
... 466 cssstylerule.
selectortext api, cssom, cssstylerule, reference the cssrule.
selectortext property gets the textual representation of the
selector for the rule set.
...And 13 more matches
:not() - CSS: Cascading Style Sheets
the :not() css pseudo-class represents elements that do not match a list of
selectors.
... syntax the :not() pseudo-class requires a comma-separated list of one or more
selectors as its argument.
... the list must not contain another negation
selector or a pseudo-element.
...And 13 more matches
Combinators - Learn web development
previous overview: building blocks next the final
selectors we will look at are called combinators, because they combine other
selectors in a way that gives them a useful relationship to each other and the location of content in the document.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the different combinator
selectors that can be used in css.
... descendant combinator the descendant combinator — typically represented by a single space ( ) character — combines two
selectors such that elements matched by the second
selector are selected if they have an ancestor (parent, parent's parent, parent's parent's parent, etc) element matching the first
selector.
...And 12 more matches
Pseudo-classes and pseudo-elements - Learn web development
previous overview: building blocks next the next set of
selectors we will look at are referred to as pseudo-classes and pseudo-elements.
...once again the relevant mdn page for each
selector is helpful in explaining browser support.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the pseudo-class and pseudo-element
selectors.
...And 12 more matches
Box-shadow generator - CSS: Cascading Style Sheets
="wrap-left"> <div class="colorpicker category"> <div class="title"> </div> <div id="colorpicker" class="group"> <div id="gradient" class="gradient"> <div id="gradient_picker"> </div> </div> <div id="hue" data-topic="hue" class="hue"> <div id="hue_
selector"> </div> </div> <div class="info"> <div class="input" data-topic="hue" data-title='h:' data-action="hsv"></div> <div class="input" data-topic="saturation" data-title='s:' data-action="hsv"></div> <div class="input" data-topic="value" data-title='v:' data-action="hsv"></div> ...
... </div> <div class="alpha"> <div id="alpha" data-topic="alpha"> <div id="alpha_
selector"> </div> </div> </div> <div class="info"> <div class="input" data-topic="r" data-title='r:' data-action="rgb"></div> <div class="input" data-topic="g" data-title='g:' data-action="rgb"></div> <div class="input" data-topic="b" data-title='b:' data-action="rgb"></div> </div> <div class="preview block"> <div id="output_color"> </div> </div> <div class="block info"> <div class="...
...; } #colorpicker #alpha { width: 100%; height: 100%; background: url("https://mdn.mozillademos.org/files/5703/alpha_mask.png"); background: -moz-linear-gradient(left, rgba(255, 0, 0, 0) 0%, rgba(255, 0, 0, 1) 100%); } #colorpicker #gradient_picker { width: 0.5em; height: 0.5em; border-radius: 0.4em; border: 2px solid #ccc; position: relative; top: 20%; left: 20%; } #colorpicker #hue_
selector, #colorpicker #alpha_
selector { width: 3px; height: 100%; border: 1px solid #777; background-color: #fff; position: relative; top: -1px; left: 0%; } /* input hsv and rgb */ #colorpicker .info { width: 200px; margin: 5px; float: left; } #colorpicker .info * { float: left; } #colorpicker .info input { margin: 0; text-align: center; width: 30px; -moz-user-select: text; -webkit-use...
...And 11 more matches
CSS basics - Learn web development
(the term ruleset is often referred to as just rule.) note the names of the individual parts:
selector this is the html element name at the start of the ruleset.
...to style a different element, change the
selector.
...(for example, there are many color values in addition to red.) note the other important parts of the syntax: apart from the
selector, each ruleset must be wrapped in curly braces.
...And 10 more matches
:where() - CSS: Cascading Style Sheets
the :where() css pseudo-class function takes a
selector list as its argument, and selects any element that can be selected by one of the
selectors in that list.
... the difference between :where() and :is() is that :where() always has 0 specificity, whereas :is() takes on the specificity of the most specific
selector in its arguments.
...till distinct, we could use :is() or :where(), in the following manner: html { font-family: sans-serif; font-size: 150%; } :is(section.is-styling, aside.is-styling, footer.is-styling) a { color: red; } :where(section.where-styling, aside.where-styling, footer.where-styling) a { color: orange; } however, what if we later want to override the color of links in the footers using a simple
selector?
...And 10 more matches
@supports - CSS: Cascading Style Sheets
selector() tests if the browser supports the tested
selector syntax.
... the following example returns true if the browser supports the child combinator: @supports
selector(a > b) {} the not operator the not operator can precede any expression to create a new expression, resulting in the negation of the original one.
... formal syntax @supports <supports-condition> { <group-rule-body> }where <supports-condition> = not <supports-in-parens> | <supports-in-parens> [ and <supports-in-parens> ]* | <supports-in-parens> [ or <supports-in-parens> ]*where <supports-in-parens> = ( <supports-condition> ) | <supports-feature> | <general-enclosed>where <supports-feature> = <supports-decl> | <supports-
selector-fn><general-enclosed> = [ <function-token> <any-value> ) ] | ( <ident> <any-value> )where <supports-decl> = ( <declaration> )<supports-
selector-fn> =
selector( <complex-
selector> )where <complex-
selector> = <compound-
selector> [ <combinator>?
...And 10 more matches
Creating annotations - Archive of obsolete content
selector page-mod
selector content scripts the content script for the
selector page-mod uses jquery to examine and manipulate the dom.
... the
selector page mod can be switched on and off using a message from the main add-on code.
...initially off: var matchedelement = null; var originalbgcolor = null; var active = false; function resetmatchedelement() { if (matchedelement) { (matchedelement).css('background-color', originalbgcolor); (matchedelement).unbind('click.annotator'); } } self.on('message', function onmessage(activation) { active = activation; if (!active) { resetmatchedelement(); } }); this
selector listens for occurrences of the jquery mouseenter event.
...And 9 more matches
Getting started with CSS - Learn web development
we do this by targeting an element
selector — this is a
selector that directly matches an html element name.
... to target all paragraphs in the document you would use the
selector p.
... to turn all paragraphs green you would use: p { color: green; } you can target multiple
selectors at once, by separating the
selectors with a comma.
...And 9 more matches
How to build custom form controls - Learn web development
*/ box-shadow: 0 0 3px 1px #227755; } now, let's handle the list of options: /* the .select
selector here helps to make we only select element inside our control.
... .widget select, .no-widget .select { /* this css
selector basically says: - either we have set the body class to "widget" and thus we hide the actual <select> element - or we have not changed the body class, therefore the body class is still "no-widget", so the elements whose class is "select" must be hidden */ position : absolute; left : -5000em; height : 0; overflow : hidden; } this css visually hides one of the element...
...the features we plan to use are the following: classlist addeventlistener() foreach query
selector() and query
selectorall() beyond the availability of those specific features, there is still one issue remaining before starting.
...And 9 more matches
:nth-child() - CSS: Cascading Style Sheets
formal syntax :nth-child( <nth> [ of <complex-
selector-list> ]?
... )where <nth> = <an-plus-b> | even | odd<complex-
selector-list> = <complex-
selector>#where <complex-
selector> = <compound-
selector> [ <combinator>?
... <compound-
selector> ]*where <compound-
selector> = [ <type-
selector>?
...And 9 more matches
Using CSS transitions - CSS: Cascading Style Sheets
d-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration: 0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 10...
...ground-color font-size left top -webkit-transform transform color; -webkit-transition-duration: 1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 10...
...ground-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 10...
...And 9 more matches
jspage - Archive of obsolete content
case"hash":b=new hash(c);break;case"array":b=[];for(var d=0,a=c.length;d<a;d++){b[d]=$unlink(c[d]);}break;default:return c;}return b;}var browser=$merge({engine:{name:"unknown",version:0},platform:{name:(window.orientation!=undefined)?"ipod":(navigator.platform.match(/mac|win|linux/i)||["other"])[0].tolowercase()},features:{xpath:!!(document.evaluate),air:!!(window.runtime),query:!!(document.query
selector)},plugins:{},engines:{presto:function(){return(!window.opera)?false:((arguments.callee.caller)?960:((document.getelementsbyclassname)?950:925)); },trident:function(){return(!window.activexobject)?false:((window.xmlhttprequest)?((document.query
selectorall)?6:5):4);},webkit:function(){return(navigator.taintenabled)?false:((browser.features.xpath)?((browser.features.query)?525:420):419); },gecko:fun...
...rollleft:function(){return this.getscroll().x;},getscrollheight:function(){return this.getscrollsize().y; },getscrollwidth:function(){return this.getscrollsize().x;},gettop:function(){return this.getposition().y;},getleft:function(){return this.getposition().x; }});native.implement([document,element],{getelements:function(h,g){h=h.split(",");var c,e={};for(var d=0,b=h.length;d<b;d++){var a=h[d],f=
selectors.utils.search(this,a,e); if(d!=0&&f.item){f=$a(f);}c=(d==0)?f:(c.item)?$a(c).concat(f):c.concat(f);}return new elements(c,{ddup:(h.length>1),cash:!g});}});element.implement({match:function(b){if(!b||(b==this)){return true; }var d=
selectors.utils.parsetagandid(b);var a=d[0],e=d[1];if(!
selectors.filters.byid(this,e)||!
selectors.filters.bytag(this,a)){return false;}var c=
selectors.utils.parseselecto...
...r(b); return(c)?
selectors.utils.filter(this,c,{}):true;}});var
selectors={cache:{nth:{},parsed:{}}};
selectors.regexps={id:(/#([\w-]+)/),tag:(/^(\w+|\*)/),quick:(/^(\w+|\*)$/),splitter:(/\s*([+>~\s])\s*([a-za-z#.*:\[])/g),combined:(/\.([\w-]+)|\[(\w+)(?:([!*^$~|]?=)(["']?)([^\4]*?)\4)?\]|:([\w-]+)(?:\(["']?(.*?)?["']?\)|$)/g)};
selectors.utils={chk:function(b,c){if(!c){return true;}var a=$uid(b);if(!c[a]){return c[a]=true;}return false;},parsenthargument:function(h){if(
selectors.cache.nth[h]){return
selectors.cache.nth[h]; }var e=h.match(/^([+-]?\d*)?([a-z]+)?([+-]?\d*)?$/);if(!e){return false;}var g=parseint(e[1],10);var d=(g||g===0)?g:1;var f=e[2]||false;var c=parseint(e[3],10)||0; if(d!=0){c--;while(c<1){c+=d;}while(c>=d){c-=d;}}else{d=c;f="index";}switch(f){case"n":e={a:d,b:c,special:"n"};break...
...And 8 more matches
Looping code - Learn web development
le> html { width: 100%; height: inherit; background: #ddd; } canvas { display: block; } body { margin: 0; } button { position: absolute; top: 5px; left: 5px; } </style> </head> <body> <button>update</button> <canvas></canvas> <script> const btn = document.query
selector('button'); const canvas = document.query
selector('canvas'); const ctx = canvas.getcontext('2d'); let width = document.documentelement.clientwidth; let height = document.documentelement.clientheight; canvas.width = width; canvas.height = height; function random(number) { return math.floor(math.random()*number); } function draw() { ctx.clearrect(0...
... const cats = ['bill', 'jeff', 'pete', 'biggles', 'jasmin']; let info = 'my cats are called '; const para = document.query
selector('p'); for (let i = 0; i < cats.length; i++) { info += cats[i] + ', '; } para.textcontent = info; this gives us the following output: hidden code 2 <!doctype html> <html> <head> <meta charset="utf-8"> <title>basic for loop example</title> <style> </style> </head> <body> <p></p> <script> const cats = ['bill', 'jeff', 'pete', 'biggles', 'jasmin']; let ...
...info = 'my cats are called '; const para = document.query
selector('p'); for (let i = 0; i < cats.length; i++) { info += cats[i] + ', '; } para.textcontent = info; </script> </body> </html> note: you can find this example code on github too (also see it running live).
...And 8 more matches
Using Objective-C from js-ctypes
$ clang -framework appkit test.m && ./a.out class, message, and
selector our task at hand is to convert objective-c syntax to c syntax.
... register the alloc
selector for the message.
... send a message to the class, with the
selector.
...And 8 more matches
:has() - CSS: Cascading Style Sheets
the :has() css pseudo-class represents an element if any of the
selectors passed as parameters (relative to the :scope of the given element) match at least one element.
... /* selects any <a>, as long as it has an <img> element directly inside it */ /* note that this is not supported in any browser yet */ let test = document.query
selector('a:has(> img)'); syntax :has( <relative-
selector-list> )where <relative-
selector-list> = <relative-
selector>#where <relative-
selector> = <combinator>?
... <complex-
selector>where <combinator> = '>' | '+' | '~' | [ '|' ]<complex-
selector> = <compound-
selector> [ <combinator>?
...And 8 more matches
:host() - CSS: Cascading Style Sheets
the :host() css pseudo-class function selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the
selector given as the function's parameter matches the shadow host.
... the most obvious use of this is to put a class name only on certain custom element instances, and then include the relevant class
selector as the function argument.
... you can't use this with a descendant
selector expression to select only instances of the custom element that are inside a particular ancestor.
...And 8 more matches
:nth-last-child() - CSS: Cascading Style Sheets
formal syntax :nth-last-child( <nth> [ of <complex-
selector-list> ]?
... )where <nth> = <an-plus-b> | even | odd<complex-
selector-list> = <complex-
selector>#where <complex-
selector> = <compound-
selector> [ <combinator>?
... <compound-
selector> ]*where <compound-
selector> = [ <type-
selector>?
...And 8 more matches
CSS reference - CSS: Cascading Style Sheets
you can also browse key css concepts and a list of
selectors organized by type.
... basic rule syntax style rule syntax style-rule ::=
selectors-list { properties-list } ...
... where :
selectors-list ::=
selector[:pseudo-class] [::pseudo-element] [,
selectors-list] properties-list ::= [property : value] [; properties-list] see the index of
selectors, pseudo-classes, and pseudo-elements below.
...And 8 more matches
CSS FAQ - Learn web development
classes allow you to style multiple elements, therefore they can lead to shorter stylesheets, rather than having to write out the same styling information in multiple rules that use id
selectors.
... class
selectors have lower specificity than id
selectors, so are easier to override if needed.
... note: see
selectors for more information.
...And 7 more matches
Appendix F: Monitoring DOM changes - Archive of obsolete content
because it is based on css, it can be keyed to match new elements of any arbitrary css
selector.
...it is worth noting, however, that while the animation-based implementation will fire any time an element which previously did not match the given
selector is changed so that it does (when a class is added, for instance), the fallback will only match nodes when they are inserted into the dom tree.
... /** * watches for nodes matching the given css
selector to become * available.
...And 6 more matches
Style System Overview - Archive of obsolete content
a rule is a
selector and a declaration block.
... p { color: green; font-size: 12em; }
selector { property: value; property: value; } css style rules what do style rules mean?
...
selector matches elements in the document.
...And 6 more matches
JavaScript basics - Learn web development
add this code to the main.js file: const myheading = document.query
selector('h1'); myheading.textcontent = 'hello world!'; make sure the html and javascript files are saved.
...you did this by using a function called query
selector() to grab a reference to your heading, and then store it in a variable called myheading.
... this is similar to what we did using css
selectors.
...And 6 more matches
Manipulating documents - Learn web development
descendant
selector, child
selector).
...inside your script element, add the following line: const link = document.query
selector('a'); now we have the element reference stored in a variable, we can start to manipulate it using properties and methods available to it (these are defined on interfaces like htmlanchorelement in the case of <a> element, its more general parent interface htmlelement, and node — which represents all nodes in a dom).
...document.query
selector() is the recommended modern approach, which is convenient because it allows you to select elements using css
selectors.
...And 6 more matches
The Firefox codebase: CSS Guidelines
only use generic
selectors such as :last-child, when it is what you mean semantically.
... do this: border-color: red; not this: border: red; put multiple
selectors on different lines do this: h1, h2, h3 { font-family: sans-serif; text-align: center; } not this: h1, h2, h3 { font-family: sans-serif; text-align: center; } naming standards for class names lower-case-with-dashes is the most common.
... other tips assume ="true" in attribute
selectors.
...And 6 more matches
Web Console Helpers - Firefox Developer Tools
$(
selector, element) looks up a css
selector string
selector , returning the first node descended from element that matches.
...equivalent to document.query
selector() or calls the $ function in the page, if it exists.
... see the query
selector code snippet.
...And 5 more matches
The JavaScript input interpreter - Firefox Developer Tools
there are three ways to select an iframe using cd(): you can pass the iframe dom element: var frame = document.getelementbyid("frame1"); cd(frame); you can pass a css
selector that matches the iframe: cd("#frame1"); you can pass the iframe's global window object: var frame = document.getelementbyid("frame1"); cd(frame.contentwindow); to switch the context back to the top-level window, call cd() with no arguments: cd(); for example, suppose we have a document that embeds an iframe: <!doctype html> <html> <head> <meta charset="utf-8"> </head> <body> ...
... $(
selector, element) looks up a css
selector string
selector , returning the first node descended from element that matches.
...equivalent to document.query
selector() or calls the $ function in the page, if it exists.
...And 5 more matches
SubtleCrypto.exportKey() - Web APIs
*/ async function exportcryptokey(key) { const exported = await window.crypto.subtle.exportkey( "raw", key ); const exportedkeybuffer = new uint8array(exported); const exportkeyoutput = document.query
selector(".exported-key"); exportkeyoutput.textcontent = `[${exportedkeybuffer}]`; } /* generate an encrypt/decrypt secret key, then set up an event listener on the "export" button.
... */ window.crypto.subtle.generatekey( { name: "aes-gcm", length: 256, }, true, ["encrypt", "decrypt"] ).then((key) => { const exportbutton = document.query
selector(".raw"); exportbutton.addeventlistener("click", () => { exportcryptokey(key); }); }); pkcs #8 export this example exports an rsa private signing key as a pkcs #8 object.
...*/ async function exportcryptokey(key) { const exported = await window.crypto.subtle.exportkey( "pkcs8", key ); const exportedasstring = ab2str(exported); const exportedasbase64 = window.btoa(exportedasstring); const pemexported = `-----begin private key-----\n${exportedasbase64}\n-----end private key-----`; const exportkeyoutput = document.query
selector(".exported-key"); exportkeyoutput.textcontent = pemexported; } /* generate a sign/verify key pair, then set up an event listener on the "export" button.
...And 5 more matches
SubtleCrypto.verify() - Web APIs
*/ function getmessageencoding() { const messagebox = document.query
selector(".rsassa-pkcs1 #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } /* fetch the encoded message-to-sign and verify it against the stored signature.
...*/ async function verifymessage(publickey) { const signaturevalue = document.query
selector(".rsassa-pkcs1 .signature-value"); signaturevalue.classlist.remove("valid", "invalid"); let encoded = getmessageencoding(); let result = await window.crypto.subtle.verify( "rsassa-pkcs1-v1_5", publickey, signature, encoded ); signaturevalue.classlist.add(result ?
...*/ function getmessageencoding() { const messagebox = document.query
selector(".rsa-pss #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } /* fetch the encoded message-to-sign and verify it against the stored signature.
...And 5 more matches
:host-context() - CSS: Cascading Style Sheets
the :host-context() css pseudo-class function selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the
selector given as the function's parameter matches the shadow host's ancestor(s) in the place it sits inside the dom hierarchy.
... one typical use of this is with a descendant
selector expression — for example h1 — to select only instances of the custom element that are inside an <h1>.
... /* selects a shadow root host, only if it is a descendant of the
selector argument given */ :host-context(h1) { font-weight: bold; } :host-context(main article) { font-weight: bold; } /* changes paragraph text color from black to white when a .dark-theme class is applied to the document body */ p { color: #000; } :host-context(body.dark-theme) p { color: #fff; } syntax :host-context( <compound-
selector-list> )where <compound-
selector-list> = <compound-
selector>#where <compound-
selector> = [ <type-
selector>?
...And 5 more matches
Child combinator - CSS: Cascading Style Sheets
the child combinator (>) is placed between two css
selectors.
... it matches only those elements matched by the second
selector that are the direct children of elements matched by the first.
... /* list items that are children of the "my-things" list */ ul.my-things > li { margin: 2em; } elements matched by the second
selector must be the immediate children of the elements matched by the first
selector.
...And 5 more matches
<colgroup> - HTML: Hypertext Markup Language
note: do not try to set the text-align property on a
selector giving a <colgroup> element.
... if the table doesn't use a colspan attribute, use one td:nth-child(an+b) css
selector per column, where a is the total number of the columns in the table and b is the ordinal position of this column in the table.
... only after this
selector the text-align property can be used.
...And 5 more matches
Content states and the style system - Archive of obsolete content
this is done by walking the list of all css2.1 simple
selectors in all style sheets applied to the page that have a state-dependent pseudo-class as part of the
selector.
...for each
selector in this list we check whether it might have stopped matching the node or started matching it.
... the way we determine whether the
selector might have stopped or started matching the node is by just checking whether it matches with the caveat that all the state-dependent pseudo-classes corresponding to the states that changed must be treated as matching (whether they actually do and whether they're negated or not).
...And 4 more matches
Debugging CSS - Learn web development
perhaps you believe that a certain
selector should match an element, but nothing happens, or a box is a different size than you expected.
...you can also click the + button to add an additional rule with the same
selector, and add your new rules there.
...what is generally happening here is that a more specific
selector is overriding your changes, and here devtools will really help you out.
...And 4 more matches
Introduction to events - Learn web development
in the following example, we have a single <button>, which when pressed, makes the background change to a random color: <button>change color</button> button { margin: 10px }; the javascript looks like so: const btn = document.query
selector('button'); function random(number) { return math.floor(math.random() * (number+1)); } btn.onclick = function() { const rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; document.body.style.backgroundcolor = rndcol; } in this code, we store a reference to the button inside a constant called btn, using the document.query
selector() function.
...returning to the above example: const btn = document.query
selector('button'); btn.onclick = function() { const rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; document.body.style.backgroundcolor = rndcol; } the onclick property is the event handler property being used in this situation.
...the following works just the same: const btn = document.query
selector('button'); function bgchange() { const rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; document.body.style.backgroundcolor = rndcol; } btn.onclick = bgchange; there are many different event handler properties available.
...And 4 more matches
Making decisions in your code — conditionals - Learn web development
ould be part of a simple weather forecast application: <label for="weather">select the weather type today: </label> <select id="weather"> <option value="">--make a choice--</option> <option value="sunny">sunny</option> <option value="rainy">rainy</option> <option value="snowing">snowing</option> <option value="overcast">overcast</option> </select> <p></p> const select = document.query
selector('select'); const para = document.query
selector('p'); select.addeventlistener('change', setweather); function setweather() { const choice = select.value; if (choice === 'sunny') { para.textcontent = 'it is nice and sunny outside today.
...orecast application to use a switch statement instead: <label for="weather">select the weather type today: </label> <select id="weather"> <option value="">--make a choice--</option> <option value="sunny">sunny</option> <option value="rainy">rainy</option> <option value="snowing">snowing</option> <option value="overcast">overcast</option> </select> <p></p> const select = document.query
selector('select'); const para = document.query
selector('p'); select.addeventlistener('change', setweather); function setweather() { const choice = select.value; switch (choice) { case 'sunny': para.textcontent = 'it is nice and sunny outside today.
... <label for="theme">select theme: </label> <select id="theme"> <option value="white">white</option> <option value="black">black</option> </select> <h1>this is my website</h1> const select = document.query
selector('select'); const html = document.query
selector('html'); document.body.style.padding = '10px'; function update(bgcolor, textcolor) { html.style.backgroundcolor = bgcolor; html.style.color = textcolor; } select.onchange = function() { ( select.value === 'black' ) ?
...And 4 more matches
A first splash into JavaScript - Learn web development
input type="text" id="guessfield" class="guessfield"> <input type="submit" value="submit guess" class="guesssubmit"> </div> <div class="resultparas"> <p class="guesses"></p> <p class="lastresult"></p> <p class="loworhi"></p> </div> <script> // your javascript goes here let randomnumber = math.floor(math.random() * 100) + 1; const guesses = document.query
selector('.guesses'); const lastresult = document.query
selector('.lastresult'); const loworhi = document.query
selector('.loworhi'); const guesssubmit = document.query
selector('.guesssubmit'); const guessfield = document.query
selector('.guessfield'); let guesscount = 1; let resetbutton; function checkguess() { let userguess = number(guessfield.value); if (guesscount...
...ss); function setgameover() { guessfield.disabled = true; guesssubmit.disabled = true; resetbutton = document.createelement('button'); resetbutton.textcontent = 'start new game'; document.body.append(resetbutton); resetbutton.addeventlistener('click', resetgame); } function resetgame() { guesscount = 1; const resetparas = document.query
selectorall('.resultparas p'); for(let i = 0 ; i < resetparas.length ; i++) { resetparas[i].textcontent = ''; } resetbutton.parentnode.removechild(resetbutton); guessfield.disabled = false; guesssubmit.disabled = false; guessfield.value = ''; guessfield.focus(); lastresult.style.backgroundcolor = 'white'; randomnumber = math.floor(math.random(...
...first of all, add the following lines inside your <script> element: let randomnumber = math.floor(math.random() * 100) + 1; const guesses = document.query
selector('.guesses'); const lastresult = document.query
selector('.lastresult'); const loworhi = document.query
selector('.loworhi'); const guesssubmit = document.query
selector('.guesssubmit'); const guessfield = document.query
selector('.guessfield'); let guesscount = 1; let resetbutton; this section of the code sets up the variables and constants we need to store the data our program will use.
...And 4 more matches
CSSStyleSheet.insertRule() - Web APIs
what the inserted rule must contain depends on its type: for rule-sets, both a
selector and a style declaration.
...tant rules ], ['.myclass', ['background-color', 'yellow'] ] ]); */ function addstylesheetrules (rules) { var styleel = document.createelement('style'); // append <style> element to <head> document.head.appendchild(styleel); // grab style element's sheet var stylesheet = styleel.sheet; for (var i = 0; i < rules.length; i++) { var j = 1, rule = rules[i],
selector = rule[0], propstr = ''; // if the second argument of a rule is an array of arrays, correct our variables.
...' !important' : '') + ';\n'; } // insert css rule stylesheet.insertrule(
selector + '{' + propstr + '}', stylesheet.cssrules.length); } } polyfill the below polyfill will correct the input of the arguments of insertrule() to standardize them in internet explorer 5–8.
...And 4 more matches
Element - Web APIs
element.closest() returns the element which is the closest ancestor of the current element (or the current element itself) which matches the
selectors given in parameter.
... element.matches() returns a boolean indicating whether or not the element would be selected by the specified
selector string.
... element.pseudo() returns a csspseudoelement representing the child pseudo-element matched by the specified pseudo-element
selector.
...And 4 more matches
Intersection Observer API - Web APIs
creating an intersection observer create the intersection observer by calling its constructor and passing it a callback function to be run whenever a threshold is crossed in one direction or the other: let options = { root: document.query
selector('#scrollarea'), rootmargin: '0px', threshold: 1.0 } let observer = new intersectionobserver(callback, options); a threshold of 1.0 means that when 100% of the target is visible within the element specified by the root option, the callback is invoked.
... targeting an element to be observed once you have created the observer, you need to give it a target element to watch: let target = document.query
selector('#listitem'); observer.observe(target); // the callback we setup for the observer will be executed now for the first time // it waits until we assign a target to our observer (even if the target is currently not visible) whenever the target meets a threshold specified for the intersectionobserver, the callback is invoked.
... background-color: rgba(255, 255, 255, 0.7); border: 1px solid rgba(0, 0, 0, 0.7); width: 3em; height: 18px; padding: 2px; text-align: center; } .topleft { left: 2px; top: 2px; } .topright { right: 2px; top: 2px; } .bottomleft { bottom: 2px; left: 2px; } .bottomright { bottom: 2px; right: 2px; } let observers = []; startup = () => { let wrapper = document.query
selector(".wrapper"); // options for the observers let observeroptions = { root: null, rootmargin: "0px", threshold: [] }; // an array of threshold sets for each of the boxes.
...And 4 more matches
Advanced techniques: Creating and sequencing audio - Web APIs
>attack</label> <input name="attack" id="attack" type="range" min="0" max="1" value="0.2" step="0.1" /> <label for="release">release</label> <input name="release" id="release" type="range" min="0" max="1" value="0.5" step="0.1" /> now we can create some variables over in javascript and have them change when the input values are updated: let attacktime = 0.2; const attackcontrol = document.query
selector('#attack'); attackcontrol.addeventlistener('input', function() { attacktime = number(this.value); }, false); let releasetime = 0.5; const releasecontrol = document.query
selector('#release'); releasecontrol.addeventlistener('input', function() { releasetime = number(this.value); }, false); the final playsweep() function now we can expand our playsweep() function.
... let pulsehz = 880; const hzcontrol = document.query
selector('#hz'); hzcontrol.addeventlistener('input', function() { pulsehz = number(this.value); }, false); let lfohz = 30; const lfocontrol = document.query
selector('#lfo'); lfocontrol.addeventlistener('input', function() { lfohz = number(this.value); }, false); the final playpulse() function here's the entire playpulse() function: let pulsetime = 1; function playpulse() { let osc = audioc...
...the user to adjust them via range inputs and event handlers just like in previous sections: <label for="duration">duration</label> <input name="duration" id="duration" type="range" min="0" max="2" value="1" step="0.1" /> <label for="band">band</label> <input name="band" id="band" type="range" min="400" max="1200" value="1000" step="5" /> let noiseduration = 1; const durcontrol = document.query
selector('#duration'); durcontrol.addeventlistener('input', function() { noiseduration = number(this.value); }, false); let bandhz = 1000; const bandcontrol = document.query
selector('#band'); bandcontrol.addeventlistener('input', function() { bandhz = number(this.value); }, false); the final playnoise() function here's the entire playnoise() function: function playnoise() { const buffersiz...
...And 4 more matches
Descendant combinator - CSS: Cascading Style Sheets
the descendant combinator — typically represented by a single space ( ) character — combines two
selectors such that elements matched by the second
selector are selected if they have an ancestor (parent, parent's parent, parent's parent's parent, etc) element matching the first
selector.
...
selectors that utilize a descendant combinator are called descendant
selectors.
... /* list items that are descendants of the "my-things" list */ ul.my-things li { margin: 2em; } the descendant combinator is technically one or more css white space characters — the space character and/or one of four control characters: carriage return, form feed, new line, and tab characters — between two
selectors in the absence of another combinator.
...And 4 more matches
<col> - HTML: Hypertext Markup Language
note: to achieve the same effect as the left, center, right or justify values: do not try to set the text-align property on a
selector giving a <col> element.
... if the table doesn't use a colspan attribute, use the td:nth-child(an+b) css
selector.
... if the table does use a colspan attribute, the effect can be achieved by combining adequate css attribute
selectors like [colspan=n], though this is not trivial.
...And 4 more matches
<input>: The Input (Form Input) element - HTML: Hypertext Markup Language
if you have an input whose name is set to guest and another whose name is hat-size, the following code can be used: let form = document.query
selector("form"); let guestname = form.elements.guest; let hatsize = form.elements["hat-size"]; when this code has run, guestname will be the htmlinputelement for the guest field, and hatsize the object for the hat-size field.
...there are css
selectors that can specification target form controls based on their ui features, also known as ui pseudo-classes.
... the input element can also be targeted by type with attribute
selectors.
...And 4 more matches
Menu - Archive of obsolete content
individual menus are drawn from the set using on(): on(
selector) returns a new contextmenuset whose context menus are those that arise from nodes that match the given css
selector(s).
... the
selector must be a true css
selector, not a jquery or other type of pseudo-
selector.
... note:
selectors don't automatically include the children of nodes they match.
...And 3 more matches
Organizing your CSS - Learn web development
avoid overly-specific
selectors if you create very specific
selectors you will often find that you need to duplicate chunks of your css to apply the same rules to another element.
... for example, you might have something like the below
selector, which applies the rule to a <p> with a class of box inside an <article> with a class of main.
... article.main p.box { border: 1px solid #ccc; } if you then wanted to apply the same rules to something outside of main, or to something other than a <p>, you would have to add another
selector to these rules or create a whole new ruleset.
...And 3 more matches
Useful string methods - Learn web development
playable code <h2>live output</h2> <div class="output" style="min-height: 125px;"> <ul> </ul> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 290px; width: 95%"> const list = document.query
selector('.output ul'); list.innerhtml = ''; let greetings = ['happy birthday!', 'merry christmas my love', 'a happy christmas to all the family', 'you\'re all i want for christmas', 'get well soon']; for (let i = 0; i < greetings.length; i++) { let input = greetings[i]; // your conditional test needs to go inside the parentheses /...
...utionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.query
selector(\'.output ul\');' + '\nlist.innerhtml = \'\';' + '\nlet greetings = [\'happy birthday!\',' + '\n \'merry christmas my love\',' + '\n \'a happy christmas to all the family\',' + '\n \'you\\\'re all i want for christmas\',' + '\n \'get well soon\'];' + '\n' + '\nfor (let i = 0; i < greetings.length; i++) {' + '\n let input = greetings...
... playable code 2 <h2>live output</h2> <div class="output" style="min-height: 125px;"> <ul> </ul> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 250px; width: 95%"> const list = document.query
selector('.output ul'); list.innerhtml = ''; let cities = ['london', 'manchester', 'birmingham', 'liverpool']; for (let i = 0; i < cities.length; i++) { let input = cities[i]; // write your code just below here let result = input; let listitem = document.createelement('li'); listitem.textcontent = result; list.appendchild(listitem); } </textarea> <div class="playable-buttons"> <input id="...
...And 3 more matches
What is JavaScript? - Learn web development
cing: 1px; text-transform: uppercase; text-align: center; border: 2px solid rgba(0,0,200,0.6); background: rgba(0,0,200,0.3); color: rgba(0,0,200,0.6); box-shadow: 1px 1px 2px rgba(0,0,200,0.4); border-radius: 10px; padding: 3px 10px; display: inline-block; cursor: pointer; } and finally, we can add some javascript to implement dynamic behaviour: const para = document.query
selector('p'); para.addeventlistener('click', updatename); function updatename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } try clicking on this last version of the text label to see what happens (note also that you can find this demo on github — see the source code, or run it live)!
...for example, let's return to the block of javascript we saw in our first example: const para = document.query
selector('p'); para.addeventlistener('click', updatename); function updatename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } here we are selecting a text paragraph (line 1), then attaching an event listener to it (line 3) so that when the paragraph is clicked, the updatename() code block (lines 5–8) is run.
...r <script> element to make the page do something more interesting — add the following code just below the "// javascript goes here" line: document.addeventlistener("domcontentloaded", function() { function createparagraph() { let para = document.createelement('p'); para.textcontent = 'you clicked the button!'; document.body.appendchild(para); } const buttons = document.query
selectorall('button'); for(let i = 0; i < buttons.length ; i++) { buttons[i].addeventlistener('click', createparagraph); } }); save your file and refresh the browser — now you should see that when you click the button, a new paragraph is generated and placed below.
...And 3 more matches
Handling common HTML and CSS problems - Learn web development
if you have a widget, make sure it has a distinct class, and then start the
selectors that select elements inside the widget with this class, so conflicts are less likely.
...
selector support of course, no css features will apply at all if you don't use the right
selectors to select the element you want to style!
... if you just write a
selector incorrectly so the styling isn't as expected in any browser, you'll just need to troubleshoot and work out what is wrong with your
selector.
...And 3 more matches
inIDOMUtils
y, size_is(acount)] out wstring aprops); nsisupportsarray getcssstylerules(in nsidomelement aelement, [optional] in domstring apseudo); nsidomnode getparentfornode(in nsidomnode anode, in boolean ashowinganonymouscontent); unsigned long getruleline(in nsidomcssstylerule arule); unsigned long getrulecolumn(in nsidomcssstylerule arule); unsigned long get
selectorcount(in nsidomcssstylerule arule); astring get
selectortext(in nsidomcssstylerule arule, in unsigned long a
selectorindex); unsigned long long getspecificity(in nsidomcssstylerule arule, in unsigned long a
selectorindex); nsidomfontfacelist getusedfontfaces(in nsidomrange arange); bool haspseudoclasslock(in nsidomelement aelement, in domstring apseudoclass); ...
... boolean isignorablewhitespace(in nsidomcharacterdata adatanode); bool isinheritedproperty(in astring apropertyname); void parsestylesheet(in nsidomcssstylesheet asheet, in domstring ainput); void removepseudoclasslock(in nsidomelement aelement, in domstring apseudoclass); astring rgbtocolorname(in octet ar, in octet ag, in octet ab); bool
selectormatcheselement(in nsidomelement aelement, in nsidomcssstylerule arule, in unsigned long a
selectorindex, [optional] in domstring apseudo); void setcontentstate(in nsidomelement aelement, in unsigned long long astate); constants constant value description exclude_shorthands (1<<0) include_aliases (1<<1) content state flags the content s...
...
selectormatcheselement() checks if a given
selector from a style rule matches an element.
...And 3 more matches
Examine and edit HTML - Firefox Developer Tools
there are three types of searches that are performed automatically depending on what you enter, a full text search, a css
selector search, and an xpath search.
...that allows you to find css
selectors and xpath expressions occurring within the text.
... css
selector search you can search elements by entering a css
selector.
...And 3 more matches
Element.closest() - Web APIs
the closest() method traverses the element and its parents (heading toward the document root) until it finds a node that matches the provided
selector string.
... syntax var closestelement = targetelement.closest(
selectors); parameters
selectors is a domstring containing a
selector list.
... exceptions syntaxerror is thrown if the
selectors is not a valid
selector list string.
...And 3 more matches
Element.matches() - Web APIs
the matches() method checks to see if the element would be selected by the provided
selectorstring -- in other words -- checks if the element "is" the
selector.
... syntax var result = element.matches(
selectorstring); parameters
selectorstring is a string representing the
selector to test.
... exceptions syntax_err the specified
selector string is invalid.
...And 3 more matches
ARIA: grid role - Accessibility
apse: collapse; font-variant-numeric: tabular-nums; } tbody th, tbody td { padding: 5px; } tbody td { border: 1px solid #000; text-align: right; color: #767676; } tbody td[role="gridcell"] { color: #000; } tbody td[role="gridcell"]:hover, tbody td[role="gridcell"]:focus { background-color: #f6f6f6; outline: 3px solid blue; } } javascript var selectables = document.query
selectorall('table td[role="gridcell"]'); selectables[0].setattribute('tabindex', 0); var trs = document.query
selectorall('table tbody tr'), row = 0, col = 0, maxrow = trs.length - 1, maxcol = 0; array.prototype.foreach.call(trs, function(gridrow, i){ array.prototype.foreach.call(gridrow.query
selectorall('td'), function(el, i){ el.dataset.row = row; el.dataset.col = col; c...
...ol = col + 1; }); if (col>maxcol) { maxcol = col - 1; } col = 0; row = row + 1; }); function moveto(newrow, newcol) { var tgt = document.query
selector('[data-row="' + newrow + '"][data-col="' + newcol + '"]'); if (tgt && (tgt.getattribute('role')==='gridcell') ) { array.prototype.foreach.call(document.query
selectorall('[role=gridcell]'), function(el, i){ el.setattribute('tabindex', '-1'); }); tgt.setattribute('tabindex', '0'); tgt.focus(); return true; } else { return false; } } document.query
selector('table').addeventlistener("keydown", function(event) { switch (event.key) { case "arrowright": moveto(parseint(event.target.dataset.row, 10), parseint(event.target.dataset.col, 10) + 1); break; case "arrowleft": moveto(parsei...
....row, 10), 0); } break; case "end": if (event.ctrlkey) { var i = maxrow; var result; do { var j = maxcol; do { result = moveto(i, j); j--; } while (result == false); i--; } while (result == false); } else { moveto(parseint(event.target.dataset.row, 10), document.query
selector('[data-row="' + event.target.dataset.row + '"]:last-of-type').dataset.col); } break; case "pageup": var i = 0; var result; do { result = moveto(i, event.target.dataset.col); i++; } while (result == false); break; case "pagedown": var i = maxrow; var result; do { result = moveto(i, event.target.dataset.col)...
...And 3 more matches
Border-radius generator - CSS: Cascading Style Sheets
ed) subscribers[topic] = []; subscribers[topic].push(callback); } var unsubscribe = function unsubscribe(topic, callback) { subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); } var notify = function notify() { for (var i in subscribers[this.topic]) { subscribers[this.topic][i](this.value); } } var init = function init() { var elem = document.query
selectorall('.ui-input-slider'); var size = elem.length; for (var i = 0; i < size; i++) new inputslider(elem[i]); } return { init : init, setmax : setmax, setmin : setmin, setunit : setunit, getnode : getnode, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe } })(); /** * ui-buttonmanager */ var buttonmanager = (function checkboxmanager() { var subscr...
...] = []; subscribers[topic].push(callback); } var unsubscribe = function unsubscribe(topic, callback) { subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); } var notify = function notify() { for (var i = 0; i < subscribers[this.topic].length; i++) subscribers[this.topic][i](this.checkbox.checked); } var init = function init() { var elem = document.query
selectorall('.ui-checkbox'); var size = elem.length; for (var i = 0; i < size; i++) new checkbox(elem[i]); } return { init : init, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe } })(); window.addeventlistener("load", function() { borderradius.init(); }); var borderradius = (function borderradius() { function getelembyid(id) { return document.getelementby...
...nction unsubscribe(callback) { var index = subscribers.indexof(callback); subscribers.splice(index, 1); } var notify = function notify(deltax, deltay) { for (var i in subscribers) subscribers[i](deltax, deltay); } return { init : init, subscribe : subscribe, unsubscribe : unsubscribe } })(); var subject; var units = ['px', '%']; var output = null; var unit
selector = function unit
selector(topic) { this.container = document.createelement("div"); this.select = document.createelement("select"); for (var i in units) { var option = document.createelement("option"); option.value = i; option.textcontent = units[i]; this.select.appendchild(option); } this.container.classname = 'dropdown ' + 'unit-' + topic; this.container.appendchild(this.
...And 3 more matches
Pseudo-classes - CSS: Cascading Style Sheets
a css pseudo-class is a keyword added to a
selector that specifies a special state of the selected element(s).
... syntax
selector:pseudo-class { property: value; } like regular classes, you can chain together as many pseudo-classes as you want in a
selector.
... html living standard living standard defines when particular
selectors match html elements.
...And 3 more matches
Syntax - CSS: Cascading Style Sheets
each (valid) declaration block is preceded by one or more comma-separated
selectors, which are conditions selecting some elements of the page.
... a
selector group and an associated declarations block, together, are called a ruleset, or often simply a rule.
... as an element of the page may be matched by several
selectors, and therefore by several rules potentially containing a given property several times, with different values, the css standard defines which one has precedence over the other and must be applied: this is called the cascade algorithm.
...And 3 more matches
<input type="button"> - HTML: Hypertext Markup Language
a simple button we'll begin by creating a simple button with a click event handler that starts our machine (well, it toggles the value of the button and the text content of the following paragraph): <form> <input type="button" value="start machine"> </form> <p>the machine is stopped.</p> const button = document.query
selector('input'); const paragraph = document.query
selector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } the script gets a refere...
... <form> <input type="button" value="start machine" accesskey="s"> </form> <p>the machine is stopped.</p> const button = document.query
selector('input'); const paragraph = document.query
selector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } note: the problem wi...
... hidden code 1 <input type="button" value="enabled"> const button = document.query
selector('input'); button.addeventlistener('click', disablebutton); function disablebutton() { button.disabled = true; button.value = 'disabled'; window.settimeout(function() { button.disabled = false; button.value = 'enabled'; }, 2000); } if the disabled attribute isn't specified, the button inherits its disabled state from its parent element.
...And 3 more matches
CSS3 - Archive of obsolete content
some modules, like
selectors 4 or css borders and backgrounds level 4 already have an editor's draft, though they haven't yet reached the first published working draft status.
...
selectors level 3 recommendation since september 29th, 2011 adds: substring matching attribute
selectors, e[attribute^="value"], e[attribute$="value"], e[attribute*="value"] .
... the next iteration of the
selectors specification is already in progress, though it still hasn't reached the first public working draft stage.
...And 2 more matches
Anonymous Content - Archive of obsolete content
xpath
selectors specified using the includes attribute determine which insertion point a given child should be placed under.
... the insertion point used for a given piece of content is the first encountered with a
selector whose node set matches the element when doing a depth-first walk of the content template.
... anonymous content and css
selectors and scopes bindings can interleave anonymous elements between the bound element and its explicit children.
...And 2 more matches
Skinning XUL Files by Hand - Archive of obsolete content
note that for any one class of element, there may be several pseudo-classes andattribute
selector styles defined.
...in the first definition, the
selector "toolbar.nav-bar" is used to define style information for all xul toolbars of the class "nav-bar." unlike an id -- which is also often used as a
selector but must be unique -- a class attribute can be used on multiple xul elements you want to pick up the specified style information.
...</toolbar> will be styled with the css rules that appear in the block after the toolbar.nav-bar
selector in the css example above.
...And 2 more matches
Issues Arising From Arbitrary-Element hover - Archive of obsolete content
bare pseudo-classes the second piece of the problem comes when we consider the effects of a "bare" pseudo-class in a
selector.
...the most reliable fix is to add the anchor element to the
selectors, like this: a:hover {color: red;} a.nav:hover {color: red;} in an attempt to avoid causing problems for legacy documents, browsers based on mozilla 1.0 and later (netscape 7+) include code that causes bare pseudo-classes to be restricted only to links if the document is rendered in "quirks" mode.
... in browsers based on the engine found in mozilla 1.3b and later, this quirk is extended to cover
selectors that combine a bare class
selector with the :hover pseudo-class (see bug 169078 for details).
...And 2 more matches
Index - MDN Web Docs Glossary: Definitions of Web-related terms
56 css object model (cssom) css, cssom, dom, glossary, web performance the css object model (cssom) is a map of all css
selectors and relevant properties for each
selector in the form of a tree, with a root node, sibling, descendant, child, and other relationship.
... 343 pseudo-class css, codingscripting, glossary,
selector in css, a pseudo-class
selector targets elements depending on their state rather than on information from the document tree.
... for example, the
selector a:visited applies styles only to links that the user has already followed.
...And 2 more matches
Fundamental CSS comprehension - Learn web development
grab the css resources text file — this contains a set of raw
selectors and rulesets that you'll need to study and combine to answer part of this assessment.
... taking care of the
selectors and rulesets provided in the css resource file: next up, we'd like you to look at the four
selectors, and calculate the specificity for each one.
... now it's time to put the right
selector on the right rule set!
...And 2 more matches
How CSS works - Learn web development
the browser parses the fetched css, and sorts the different rules by their
selector types into different "buckets", e.g.
...based on the
selectors it finds, it works out which rules should be applied to which nodes in the dom, and attaches style to them as required (this intermediate step is called a render tree).
...since the only rule available in the css has a span
selector, the browser will be able to sort the css very quickly!
...And 2 more matches
HTML text fundamentals - Learn web development
ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...And 2 more matches
Migrating from Firebug - Firefox Developer Tools
the devtools additionally provide an option to copy the
selector of a rule and copy disabled property declarations as commented out.
... search for elements via css
selectors or xpaths firebug allows to search for elements within the html panel via css
selectors or xpaths.
... also the devtools' inspector panel allows to search for css
selectors.
...And 2 more matches
Examine and edit CSS - Firefox Developer Tools
in the following example, a spelling error, "background-colour" instead of "background-color" has made the rule invalid: rule display it displays each rule as in a stylesheet, with a list of
selectors followed by a list of property:value; declarations.
... highlight matched elements: next to the
selector is a target icon: click this to highlight all nodes in the page that match this
selector.
... edit rules if you click on a declaration or a
selector in the rules view you can edit it and see the results immediately.
...And 2 more matches
Work with animations - Firefox Developer Tools
the animation's fill the playback rate of the animation information about the animated element to the left of each bar is a
selector for the element that the animation applies to.
... if you hover over this
selector, the element is highlighted in the page.
... click the
selector to select the element in the inspector.
...And 2 more matches
Using the CSS Typed Object Model - Web APIs
// get the element const myelement = document.query
selector('a'); // get the <dl> we'll be populating const styleslist = document.query
selector('#regurgitation'); // retrieve all computed styles with computedstylemap() const defaultcomputedstyles = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of defaultcomputedstyles) { // properties const cssproperty = ...
...d an inhertable property: p { font-weight: bold; } a { --color: red; color: var(--color); } instead of getting all the properties, we create an array of properties of interest and use the stylepropertymapreadonly.get() method to get each of their values: <p> <a href="https://example.com">link</a> </p> <dl id="regurgitation"></dl> // get the element const myelement = document.query
selector('a'); // get the <dl> we'll be populating const styleslist = document.query
selector('#regurgitation'); // retrieve all computed styles with computedstylemap() const allcomputedstyles = myelement.computedstylemap(); // array of properties we're interested in const ofinterest = ['font-weight', 'border-left-color', 'color', '--color']; // iterate through our properties of interest for ( let i = ...
... // get the element we're inspecting const myelement = document.query
selector('p'); // get the table we'll be populating const stylestable = document.query
selector('#regurgitation'); // retrieve all computed styles with computedstylemap() const allcomputedstyles = myelement.computedstylemap(); // array of properties we're interested in const ofinterest = ['padding-top', 'margin-bottom', 'font-size', 'font-stretch', 'animation-duration', 'animation-iteration-count',...
...And 2 more matches
DocumentFragment - Web APIs
documentfragment.query
selector() returns the first element node within the documentfragment, in document order, that matches the specified
selectors.
... documentfragment.query
selectorall() returns a nodelist of all the element nodes within the documentfragment that match the specified
selectors.
... example html <ul id="list"></ul> javascript var list = document.query
selector('#list') var fruits = ['apple', 'orange', 'banana', 'melon'] var fragment = new documentfragment() fruits.foreach(function (fruit) { var li = document.createelement('li') li.innerhtml = fruit fragment.appendchild(li) }) list.appendchild(fragment) result specifications specification status comment domthe definition of 'documentfragment' in that specificat...
...And 2 more matches
RTCPeerConnection.getStats() - Web APIs
syntax promise = rtcpeerconnection.getstats(
selector) parameters
selector optional a mediastreamtrack for which to gather statistics.
...the contents of the report depend on the
selector as well as other details of the connection.
... exceptions this method does not throw exceptions; instead, it rejects the returned promise with one of the following errors: invalidaccesserror there is no rtcrtpsender or rtcrtpreceiver whose track matches the specified
selector, or
selector matches more than one sender or receiver.
...And 2 more matches
::slotted() - CSS: Cascading Style Sheets
note also that this
selector won't select a text node placed into a slot; it only targets actual elements.
... /* selects any element placed inside a slot */ ::slotted(*) { font-weight: bold; } /* selects any <span> placed inside a slot */ ::slotted(span) { font-weight: bold; } syntax ::slotted( <compound-
selector-list> )where <compound-
selector-list> = <compound-
selector>#where <compound-
selector> = [ <type-
selector>?
... <subclass-
selector>* [ <pseudo-element-
selector> <pseudo-class-
selector>* ]* ]!where <type-
selector> = <wq-name> | <ns-prefix>?
...And 2 more matches
:scope - CSS: Cascading Style Sheets
the :scope css pseudo-class represents elements that are a reference point for
selectors to match against.
...when used from a dom api such as query
selector(), query
selectorall(), matches(), or element.closest(), :scope matches the element on which the method was called.
... javascript var context = document.getelementbyid('context'); var selected = context.query
selectorall(':scope > div'); document.getelementbyid('results').innerhtml = array.prototype.map.call(selected, function (element) { return '#' + element.getattribute('id'); }).join(', '); html <div id="context"> <div id="element-1"> <div id="element-1.1"></div> <div id="element-1.2"></div> </div> <div id="element-2"> <div id="element-2.1"></div> </div> </div>...
...And 2 more matches
:visited - CSS: Cascading Style Sheets
for privacy reasons, the styles that can be modified using this
selector are very limited.
... note: for more information on these limitations and the reasons behind them, see privacy and the :visited
selector.
...thus, if you want to modify the other properties, you'll need to give them a base value outside the :visited
selector.
...And 2 more matches
Media - Progressive web apps (PWAs)
there are five special
selectors:
selector selects e:hover any e element that has the pointer over it e:focus any e element that has keyboard focus e:active the e element that is involved in the current user action e:link any e element that is a hyperlink to a url that the user has not visited recently e:visited any e element that is a hyperlink to a url t...
...hat the user has visited recently note: the information that can be obtained from the :visited
selector is restricted in gecko 2.0.
... see privacy and the : visited
selector for more details.
...And 2 more matches
Writing Skinnable XUL and CSS - Archive of obsolete content
the descendant
selector is forbidden.
... never use the descendant
selector without first getting usage of the rule approved.
... i'm usually seeing this rule misused by people who really wanted to use the child
selector instead.
... never use an attribute
selector rule for the class attribute.
Styling tables - Learn web development
this is why we've selected the four different headings with the thead th:nth-child(n) (:nth-child)
selector ("select the nth child that is a <th> element in a sequence, inside a <thead> element") and given them set percentage widths.
...add the following css to the bottom of your style.css file: /* zebra striping */ tbody tr:nth-child(odd) { background-color: #ff33cc; } tbody tr:nth-child(even) { background-color: #e495e4; } tbody tr { background-image: url(noise.png); } table { background-color: #ff33cc; } earlier on you saw the :nth-child
selector being used to select specific child elements.
... lastly, we've given the entire table a solid background color so that browsers that don't support the :nth-child
selector still have a background for their body rows.
... previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
CSS building blocks - Learn web development
this module looks at the cascade and inheritance, all the
selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
... css
selectors there are a wide variety of css
selectors available, allowing for fine-grained precision when selecting elements to style.
...the sub-articles are as follows: type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model everything in css has a box around it, and understanding these boxes is key to being able to create layouts with css, or to align items with other items.
... fundamental css comprehension this assessment tests your understanding of basic syntax,
selectors, specificity, box model, and more.
Styling links - Learn web development
the third rule uses the a
selector to get rid of the default text underline and focus outline (which varies across browsers anyway), and adds a tiny amount of padding to each link — all of this will become clear later on.
... next, we use the a:link and a:visited
selectors to set a couple of color variations on unvisited and visited links, so they are distinct.
...{ } a:active { }</textarea> <h2>output</h2> <div class="output" style="width: 90%;height: 10em;padding: 10px;border: 1px solid #0095dd;"></div> <div class="controls"> <input id="reset" type="button" value="reset" style="margin: 10px 10px 0 0;"> <input id="solution" type="button" value="show solution" style="margin: 10px 0 0 10px;"> </div> </div> var htmlinput = document.query
selector(".html-input"); var cssinput = document.query
selector(".css-input"); var reset = document.getelementbyid("reset"); var htmlcode = htmlinput.value; var csscode = cssinput.value; var output = document.query
selector(".output"); var solution = document.getelementbyid("solution"); var styleelem = document.createelement('style'); var headelem = document.query
selector('head'); headelem.appendchild(styl...
...the text "http" should therefore only appear in external links (like the second and third ones), and we can select this with an attribute
selector: a[href*="http"] selects <a> elements, but only if they have an href attribute with a value that contains "http" somewhere inside it.
Example 4 - Learn web development
kground: #000; color: #ffffff; } javascript content // ------- // // helpers // // ------- // nodelist.prototype.foreach = function (callback) { array.prototype.foreach.call(this, callback); } // -------------------- // // function definitions // // -------------------- // function deactivateselect(select) { if (!select.classlist.contains('active')) return; var optlist = select.query
selector('.optlist'); optlist.classlist.add('hidden'); select.classlist.remove('active'); } function activeselect(select, selectlist) { if (select.classlist.contains('active')) return; selectlist.foreach(deactivateselect); select.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.query
selector('.optlist'); optlist.classlist.toggle('hidden'); } funct...
...ion highlightoption(select, option) { var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function updatevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.query
selector('.value'); var optionlist = select.query
selectorall('.option'); nativewidget.selectedindex = index; value.innerhtml = optionlist[index].innerhtml; highlightoption(select, optionlist[index]); }; function getindex(select) { var nativewidget = select.previouselementsibling; return nativewidget.selectedindex; }; // ------------- // // event binding // // ------------- // window.addeventlistener("load", function () { var form = document.query...
...
selector('form'); form.classlist.remove("no-widget"); form.classlist.add("widget"); }); window.addeventlistener('load', function () { var selectlist = document.query
selectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (option) { option.addeventlistener('mouseover', function () { highlightoption(select, option); }); }); select.addeventlistener('click', function (event) { toggleoptlist(select); }); select.addeventlistener('focus', function (event) { activeselect(select, selectlist); }); select.addeventlistener('blur', function (event) { deactivateselect(select); }); }); }); window.addeventlistener('load', function () { ...
... var selectlist = document.query
selectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.query
selectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; updatevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('click', function (event) { updatevalue(select, index); }); }); select.addeventlistener('keyup', function (event) { var length = optionlist.length, index = getindex(select); if (event.keycode === 27) { deactivateselect(select); } if (event.keycode === 40 && index < length - 1) { index++; } if (event.keycode === 38 && index > 0) { index--; } upda...
Using data attributes - Learn web development
const article = document.query
selector('#electric-cars'); article.dataset.columns // "3" article.dataset.indexnumber // "12314" article.dataset.parent // "cars" each property is a string and can be read and written.
...for example to show the parent data on the article you can use generated content in css with the attr() function: article::before { content: attr(data-parent); } you can also use the attribute
selectors in css to change styles according to the data: article[data-columns='3'] { width: 400px; } article[data-columns='4'] { width: 600px; } you can see all this working together in this jsbin example.
...using the css
selectors and javascript access here this allows you to build some nifty effects without having to write your own display routines.
...number values must be quoted in the
selector for the styling to take effect.
Advanced text formatting - Learn web development
solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.query
selector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value ==...
... solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.query
selector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value ==...
... solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.query
selector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value ==...
...you should try having a play with these (try grabbing a copy of our other-semantics.html sample file): <pre><code>var para = document.query
selector('p'); para.onclick = function() { alert('owww, stop poking me!'); }</code></pre> <p>you shouldn't use presentational elements like <code><font></code> and <code><center></code>.</p> <p>in the above javascript example, <var>para</var> represents a paragraph element.</p> <p>select all the text with <kbd>ctrl</kbd>/<kbd>cmd</kbd> + <kbd>a</kbd>.</p> <pre>$ <kbd>ping mozilla.org</...
Build your own function - Learn web development
finally, add the following code inside the curly braces: const html = document.query
selector('html'); const panel = document.createelement('div'); panel.setattribute('class', 'msgbox'); html.appendchild(panel); const msg = document.createelement('p'); msg.textcontent = 'this is a message box'; panel.appendchild(msg); const closebtn = document.createelement('button'); closebtn.textcontent = 'x'; panel.appendchild(closebtn); closebtn.onclick = function() { panel.parentnode.removechil...
... the first line uses a dom api function called document.query
selector() to select the <html> element and store a reference to it in a constant called html, so we can do things to it later on: const html = document.query
selector('html'); the next section uses another dom api function called document.createelement() to create a <div> element and store a reference to it in a constant called panel.
...this is to make it easier to style the element — if you look at the css on the page, you'll see that we are using a .msgbox class
selector to style the message box and its contents.
...add the following line to your code, above the function definition: const btn = document.query
selector('button'); finally, add the following line below the previous one: btn.onclick = displaymessage; in a similar way to our closebtn.onclick...
Arrays - Learn web development
playable code <h2>live output</h2> <div class="output" style="min-height: 150px;"> <ul> </ul> <p></p> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 410px;width: 95%"> const list = document.query
selector('.output ul'); const totalbox = document.query
selector('.output p'); let total = 0; list.innerhtml = ''; totalbox.textcontent = ''; // number 1 'underpants:6.99' 'socks:5.99' 't-shirt:14.99' 'trousers:31.99' 'shoes:23.99'; for (let i = 0; i <= 0; i++) { // number 2 // number 3 // number 4 // number 5 let it...
...utionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.query
selector(\'.output ul\');\nconst totalbox = document.query
selector(\'.output p\');\nlet total = 0;\nlist.innerhtml = \'\';\ntotalbox.textcontent = \'\';\n\nlet products = [\'underpants:6.99\',\n \'socks:5.99\',\n \'t-shirt:14.99\',\n \'trousers:31.99\',\n \'shoes:23.99\'];\n\nfor(let i = 0; i < products.length; i++) {\n let subarray = products[i].split(\':\');\n let name = subarray[0];\n let price ...
... playable code 2 <h2>live output</h2> <div class="output" style="min-height: 150px;"> <input type="text"><button>search</button> <ul> </ul> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 370px; width: 95%"> const list = document.query
selector('.output ul'); const searchinput = document.query
selector('.output input'); const searchbtn = document.query
selector('.output button'); list.innerhtml = ''; let myhistory = []; searchbtn.onclick = function() { // we will only allow a term to be entered if the search input isn't empty if (searchinput.value !== '') { // number 1 // empty the list so that we don't display duplicate e...
...utionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.query
selector(\'.output ul\');\nconst searchinput = document.query
selector(\'.output input\');\nconst searchbtn = document.query
selector(\'.output button\');\n\nlist.innerhtml = \'\';\n\nlet myhistory= [];\n\nsearchbtn.onclick = function() {\n if(searchinput.value !== \'\') {\n myhistory.unshift(searchinput.value);\n\n list.innerhtml = \'\';\n\n for(let i = 0; i < myhistory.length; i++) {\n itemtext = myhistor...
Mozilla Quirks Mode Behavior
the :hover and :active pseudo-classes will only be applied to links, and only if there is no other pseudo-class in the
selector.
... to match other elements, the
selector must include a tag name, id, class or attribute.
... prior to gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3), there was no class check, so the :hover pseudoclass was not applied to class
selectors; for example, .someclass:hover did not work.
... prior to gecko 36, the quirk was also applied if another pseudo-class was used in the same
selector, if a pseudo-element was used in the
selector, or if it was part of a pseudo-class argument (bug 783213).
AbstractRange - Web APIs
in order to set a range endpoint within the text of an element, be sure to find the text node inside the element: let startelem = document.query
selector("p"); let endelem = startelem.query
selector("span"); let range = document.createrange(); range.setstart(startelem, 0); range.setend(endelem, endelem.childnodes[0].length/2); let contents = range.clonecontents(); document.body.appendchild(contents); this example creates a new range, rng, and sets its starting point to the third child node of the first element whose class is elementclass.
... if you want to create a range that incorporates the contents of the <p> element whose contents are "a <em>very</em> interesting thing happened on the way to the forum...", you can do so like this: let prange = document.createrange(); prange.selectnodecontents(document.query
selector("#entry1 p")); since we wish to select the entire contents of the <p> element, including its descendants, this works perfectly.
... if we wish to instead copy the text "an interesting thing..." from the <section>'s heading (an <h2> element) through the end of the letters "ve" in the <em> within the paragraph below it, the following code would work: let r = document.createrange(); let startnode = document.query
selector("section h2").childnodes[0]; r.setstart(startnode, 11); let endnode = document.query
selector("#entry1 p em").childnodes[0]; r.setend(endnode, 2); let fragment = r.clonecontents(); here an interesting problem arises—we are capturing content from multiple nodes located at different levels of the dom hierarchy, and then only part of one of them.
...the code to do that looks like the following: let paranode = document.query
selector("p"); let paratextnode = paranode.childnodes[1]; let range = document.createrange(); range.setstart(paratextnode, 6); range.setend(paratextnode, paratextnode.length-1); let fragment = range.clonecontents(); document.body.appendchild(fragment); first we get references to the paragraph node itelf as well as to the second child node within the paragraph.
CSSStyleSheet.addRule() - Web APIs
syntax var result = cssstylesheet.addrule(
selector, styleblock, index); parameters
selector a domstring specifying the
selector portion of the css rule.
... styleblock a domstring indicating the style block to apply to elements matching the
selector.
... usage notes this method is implemented by browsers by constructing a string using the template literal `${
selector}{${styleblock}}`, then passing it into the standard insertrule() method.
... therefore, given existing code such as the following: cssstylesheet.addrule(
selector, styles, 0); you can rewrite this to use the more standard insertrule() like this: cssstylesheet.insertrule(`${
selector} {${styles}}`, 0); specifications specification status comment css object model (cssom)the definition of 'cssstylesheet.addrule()' in that specification.
Timing element visibility with the Intersection Observer API - Web APIs
setting up to set things up, we run the startup() function below when the page loads: window.addeventlistener("load", startup, false); function startup() { contentbox = document.query
selector("main"); document.addeventlistener("visibilitychange", handlevisibilitychange, false); let observeroptions = { root: null, rootmargin: "0px", threshold: [0.0, 0.75] }; adobserver = new intersectionobserver(intersectioncallback, observeroptions); buildcontents(); refreshintervalid = window.setinterval(handlerefreshinterval, 1000); } first, a referen...
...this is handled by passing the ad's element into the drawadtimer() function: function drawadtimer(adbox) { let timerbox = adbox.query
selector(".timer"); let totalseconds = adbox.dataset.totalviewtime / 1000; let sec = math.floor(totalseconds % 60); let min = math.floor(totalseconds / 60); timerbox.innertext = min + ":" + sec.tostring().padstart(2, "0"); } this code finds the ad's timer using its id, "timer", and computes the number of seconds elapsed by dividing the ad's totalviewtime by 1000.
... body: "love really does make the world go round..." }, { bgcolor: "#fee", title: "flexbox florist", body: "when life's layout gets complicated, send flowers." } ]; let adbox, title, body, timerelem; let ad = ads[math.floor(math.random()*ads.length)]; if (replacebox) { adobserver.unobserve(replacebox); adbox = replacebox; title = replacebox.query
selector(".title"); body = replacebox.query
selector(".body"); timerelem = replacebox.query
selector(".timer"); } else { adbox = document.createelement("div"); adbox.classname = "ad"; title = document.createelement("h2"); body = document.createelement("p"); timerelem = document.createelement("div"); adbox.appendchild(title); adbox.appendchild(body); adbox.appendchil...
... function replacead(adbox) { let visibletime; updateadtimer(adbox); visibletime = adbox.dataset.totalviewtime console.log(" replacing ad: " + adbox.query
selector("h2").innertext + " - visible for " + visibletime) loadrandomad(adbox); } replacead() begins by calling updateadtimer() on the existing ad, to ensure that its timer is up-to-date.
NodeList - Web APIs
nodelist objects are collections of nodes, usually returned by properties such as node.childnodes and methods such as document.query
selectorall().
...the ubiquitous document.query
selectorall() method returns a static nodelist.
... for...of loops will loop over nodelist objects correctly: const list = document.query
selectorall('input[type=checkbox]'); for (let checkbox of list) { checkbox.checked = true; } recent browsers also support iterator methods (foreach()) as well as entries(), values(), and keys().
... there is also an internet explorer-compatible way to use array.prototype.foreach for iteration: const list = document.query
selectorall('input[type=checkbox]'); array.prototype.foreach.call(list, function (checkbox) { checkbox.checked = true; }); specifications specification status comment domthe definition of 'nodelist' in that specification.
ParentNode - Web APIs
see locating dom elements using
selectors to learn how to use css
selectors to find nodes or elements of interest.
... parentnode.query
selector() returns the first element with the current element as root that matches the specified group of
selectors.
... parentnode.query
selectorall() returns a nodelist representing a list of elements with the current element as root that matches the specified group of
selectors.
...added the parentnode.children property, and the parentnode.query
selector(), parentnode.query
selectorall(), parentnode.append(), and parentnode.prepend() methods.
SubtleCrypto.encrypt() - Web APIs
function getmessageencoding() { const messagebox = document.query
selector(".rsa-oaep #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(publickey) { let encoded = getmessageencoding(); return window.crypto.subtle.encrypt( { name: "rsa-oaep" }, publickey, encoded ); } aes-ctr this code fetches the contents of a text box, encodes it for encryption, and encrypt...
... function getmessageencoding() { const messagebox = document.query
selector(".aes-ctr #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // counter will be needed for decryption counter = window.crypto.getrandomvalues(new uint8array(16)); return window.crypto.subtle.encrypt( { name: "aes-ctr", counter, length: 64 }, key, encoded ); } let iv = new uint8array(16); let key = new uint8array(16); let data = new uint8array(12345); //crypto functions are wrapped in promises so we have to use await and make sure the function that //contains this code is an async function //en...
... function getmessageencoding() { const messagebox = document.query
selector(".aes-cbc #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // iv will be needed for decryption iv = window.crypto.getrandomvalues(new uint8array(16)); return window.crypto.subtle.encrypt( { name: "aes-cbc", iv }, key, encoded ); } a...
... function getmessageencoding() { const messagebox = document.query
selector(".aes-gcm #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // iv will be needed for decryption iv = window.crypto.getrandomvalues(new uint8array(12)); return window.crypto.subtle.encrypt( { name: "aes-gcm", iv: iv }, key, encoded ); } specifications specification status comment web cryptography apithe definition of 'subtlecrypto.encrypt()' in that specification.
SubtleCrypto.sign() - Web APIs
*/ function getmessageencoding() { const messagebox = document.query
selector(".rsassa-pkcs1 #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( "rsassa-pkcs1-v1_5", privatekey, encoded ); rsa-pss this code fetches the contents of a text box, encodes it for signing, and signs it with a private key.
...*/ function getmessageencoding() { const messagebox = document.query
selector(".rsa-pss #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( { name: "rsa-pss", saltlength: 32, }, privatekey, encoded ); ecdsa this code fetches the contents of a text box, encodes it for signing, and signs it with a private key.
...*/ function getmessageencoding() { const messagebox = document.query
selector(".ecdsa #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( { name: "ecdsa", hash: {name: "sha-384"}, }, privatekey, encoded ); hmac this code fetches the contents of a text box, encodes it for signing, and signs it with a secret key.
...*/ function getmessageencoding() { const messagebox = document.query
selector(".hmac #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( "hmac", key, encoded ); specifications specification status comment web cryptography apithe definition of 'subtlecrypto.sign()' in that specification.
Hello vertex attributes - Web APIs
="fragment-shader"> #version 100 precision mediump float; void main() { gl_fragcolor = vec4(0.18, 0.54, 0.34, 1.0); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.query
selector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.query
selector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl.a...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.query
selector("p").innerhtml = "shader program did not link successfully.
... " + "error log: " + linkerrlog; return; } initializeattributes(); gl.useprogram(program); gl.drawarrays(gl.points, 0, 1); document.query
selector("canvas").addeventlistener("click", function (evt) { var clickxrelativtocanvas = evt.pagex - evt.target.offsetleft; var clickxinwebglcoords = 2.0 * (clickxrelativtocanvas- gl.drawingbufferwidth/2) / gl.drawingbufferwidth; gl.bufferdata(gl.array_buffer, new float32array([clickxinwebglcoords]), gl.static_draw); gl.drawarrays(gl.points, 0, 1); }, false); } var buffer; function initializeattributes() { gl.enablevertexattribarray(0); buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, new float32array([0.0]), gl.s...
...tatic_draw); gl.vertexattribpointer(0, 1, gl.float, false, 0, 0); } window.addeventlistener("beforeunload", cleanup, true); function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.drawingbufferwidth, gl.drawingbufferheight); gl.clearcolor(0.0, 0.0, 0.0,...
Using the Web Audio API - Web APIs
lucky for us there's a method that allows us to do just that — audiocontext.createmediaelementsource: // get the audio element const audioelement = document.query
selector('audio'); // pass it into the audio context const track = audiocontext.createmediaelementsource(audioelement); note: the <audio> element above is represented in the dom by an object of type htmlmediaelement, which comes with its own set of functionality.
... // select our play button const playbutton = document.query
selector('button'); playbutton.addeventlistener('click', function() { // check if context is in suspended state (autoplay policy) if (audiocontext.state === 'suspended') { audiocontext.resume(); } // play or pause track depending on state if (this.dataset.playing === 'false') { audioelement.play(); this.dataset.playing = 'true'; } else if (this.dataset.pl...
... so let's grab this input's value and update the gain value when the input node has its value changed by the user: const volumecontrol = document.query
selector('#volume'); volumecontrol.addeventlistener('input', function() { gainnode.gain.value = this.value; }, false); note: the values of node objects (e.g.
...again let's use a range type input to vary this parameter: <input type="range" id="panner" min="-1" max="1" value="0" step="0.01"> we use the values from that input to adjust our panner values in the same way as we did before: const pannercontrol = document.query
selector('#panner'); pannercontrol.addeventlistener('input', function() { panner.pan.value = this.value; }, false); let's adjust our audio graph again, to connect all the nodes together: track.connect(gainnode).connect(panner).connect(audiocontext.destination); the only thing left to do is give the app a try: check out the final demo here on codepen.
Window.getComputedStyle() - Web APIs
throws typeerror if the passed object is not an element or the pseudoelt is not a valid pseudo-element
selector or is ::part() or ::slotted().
... note: valid pseudo-element
selector refers to syntactic validity, e.g.
... html <p>hello</p> css p { width: 400px; margin: 0 auto; padding: 20px; font: 2rem/2 sans-serif; text-align: center; background: purple; color: white; } javascript let para = document.query
selector('p'); let compstyles = window.getcomputedstyle(para); para.textcontent = 'my computed font-size is ' + compstyles.getpropertyvalue('font-size') + ',\nand my computed line-height is ' + compstyles.getpropertyvalue('line-height') + '.'; result description the returned object is the same cssstyledeclaration type as the object returned from the element's style property.
... <style> h3::after { content: ' rocks!'; } </style> <h3>generated content</h3> <script> var h3 = document.query
selector('h3'); var result = getcomputedstyle(h3, ':after').content; console.log('the generated content is: ', result); // returns ' rocks!' </script> notes the returned cssstyledeclaration object contains active values for css property longhand names.
:first-of-type - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
...note that the universal
selector (*) is implied when no simple
selector is written.
...d `span` is first</span>!</div> <div>this <em>nested `em` is first</em>, but this <em>nested `em` is last</em>!</div> <div>this <span>nested `span` gets styled</span>!</div> <b>this `b` qualifies!</b> <div>this is the final `div`.</div> </article> css article :first-of-type { background-color: pink; } result specifications specification status comment
selectors level 4the definition of ':first-of-type' in that specification.
...
selectors level 3the definition of ':first-of-type' in that specification.
:last-of-type - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
...note that the universal
selector (*) is implied when no simple
selector is written.
...e> <div>this `div` is first.</div> <div>this <span>nested `span` is last</span>!</div> <div>this <em>nested `em` is first</em>, but this <em>nested `em` is last</em>!</div> <b>this `b` qualifies!</b> <div>this is the final `div`!</div> </article> css article :last-of-type { background-color: pink; } result specifications specification status comment
selectors level 4the definition of ':last-of-type' in that specification.
...
selectors level 3the definition of ':last-of-type' in that specification.
@namespace - CSS: Cascading Style Sheets
syntax /* default namespace */ @namespace url(xml-namespace-url); @namespace "xml-namespace-url"; /* prefixed namespace */ @namespace prefix url(xml-namespace-url); @namespace prefix "xml-namespace-url"; description the defined namespaces can be used to restrict the universal, type, and attribute
selectors to only select elements within that namespace.
...when a default namespace is defined, all universal and type
selectors (but not attribute
selectors, see note below) apply only to elements in that namespace.
...when a universal, type, or attribute
selector is prefixed with a namespace prefix, then that
selector only matches if the namespace and name of the element or attribute matches.
...to match this behaviour, the default namespace in css does not apply to attribute
selectors.
Adjacent sibling combinator - CSS: Cascading Style Sheets
the adjacent sibling combinator (+) separates two
selectors and matches the second element only if it immediately follows the first element, and both are children of the same parent element.
... /* paragraphs that come immediately after any image */ img + p { font-weight: bold; } syntax former_element + target_element { style properties } examples css li:first-of-type + li { color: red; } html <ul> <li>one</li> <li>two!</li> <li>three</li> </ul> result specifications specification status comment
selectors level 4the definition of 'next-sibling combinator' in that specification.
...
selectors level 3the definition of 'adjacent sibling combinator' in that specification.
... recommendation css level 2 (revision 1)the definition of 'adjacent sibling
selectors' in that specification.
Border-image generator - CSS: Cascading Style Sheets
this.topic][i](this.value); }; var createslider = function createslider(topic, label) { var slider = document.createelement('div'); slider.classname = 'ui-input-slider'; slider.setattribute('data-topic', topic); if (label !== undefined) slider.setattribute('data-info', label); new inputslider(slider); return slider; }; var init = function init() { var elem = document.query
selectorall('.ui-input-slider'); var size = elem.length; for (var i = 0; i < size; i++) new inputslider(elem[i]); }; return { init : init, setmax : setmax, setmin : setmin, setunit : setunit, setstep : setstep, getnode : getnode, getstep : getstep, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe, setprecision : setprecision, setsensivity : setsensivi...
...ibe = function unsubscribe(topic, callback) { var index = subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); }; var notify = function notify() { if (subscribers[this.topic] === undefined) return; for (var i in subscribers[this.topic]) { subscribers[this.topic][i](this.value); } }; var init = function init() { var elem, size; elem = document.query
selectorall('.ui-dropdown'); size = elem.length; for (var i = 0; i < size; i++) new dropdown(elem[i]); }; return { init : init, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe, createdropdown : createdropdown }; })(); /** * ui-buttonmanager */ var buttonmanager = (function checkboxmanager() { var subscribers = []; var buttons = []; var checkbox = func...
...ubscribe = function unsubscribe(topic, callback) { subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); }; var notify = function notify() { if (subscribers[this.topic] === undefined) return; for (var i = 0; i < subscribers[this.topic].length; i++) subscribers[this.topic][i](this.checkbox.checked); }; var init = function init() { var elem = document.query
selectorall('.ui-checkbox'); var size = elem.length; for (var i = 0; i < size; i++) new checkbox(elem[i]); }; return { init : init, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe }; })(); window.addeventlistener("load", function() { borderimage.init(); }); var borderimage = (function borderimage() { var getelembyid = document.getelementbyid.bind(document); ...
...code['source'] = getelembyid("out-border-source"); css_code['slice'] = getelembyid("out-border-slice"); css_code['width'] = getelembyid("out-border-width"); css_code['outset'] = getelembyid("out-border-outset"); css_code['repeat'] = getelembyid("out-border-repeat"); initborderslicecontrols(); initborderwidthcontrols(); initborderoutsetcontrols(); var elem = document.query
selectorall('.guideline'); var size = elem.length; for (var i = 0; i < size; i++) new guideline(elem[i]); previewcontrol.init(); buttonmanager.subscribe('slice-fill',setborderfill); buttonmanager.subscribe('drag-subject', updatedragoption); buttonmanager.setvalue('drag-subject', false); dropdownmanager.subscribe('image-repeat-x', setborderrepeat); dropdownmanager.subscribe('...
Linear-gradient Generator - CSS: Cascading Style Sheets
function unsubscribe(callback) { subscribers.indexof(callback); subscribers.splice(index, 1); }; var notify = function notify(topic, value) { if (subscribers[topic] === undefined || subscribers[topic].length === 0) return; var color = new color(value); for (var i in subscribers[topic]) subscribers[topic][i](color); }; var init = function init() { var elem = document.query
selectorall('.ui-color-picker'); var size = elem.length; for (var i = 0; i < size; i++) new colorpicker(elem[i]); }; return { init : init, color : color, rgbcolor : rgbcolor, rgbacolor : rgbacolor, hsvcolor : hsvcolor, hsvacolor : hsvacolor, hslcolor : hslcolor, hslacolor : hslacolor, setcolor : setcolor, getcolor : getcolor, subscribe : subscribe, unsubscribe : unsubscri...
...ibe = function unsubscribe(topic, callback) { var index = subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); }; var notify = function notify() { if (subscribers[this.topic] === undefined) return; for (var i in subscribers[this.topic]) { subscribers[this.topic][i](this.value); } }; var init = function init() { var elem, size; elem = document.query
selectorall('.ui-dropdown'); size = elem.length; for (var i = 0; i < size; i++) new dropdown(elem[i]); }; return { init : init, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe, createdropdown : createdropdown }; })(); /** * ui-slidersmanager */ var inputslidermanager = (function inputslidermanager() { 'use strict'; var subscribers = {}; var sliders = []...
...this.topic][i](this.value); }; var createslider = function createslider(topic, label) { var slider = document.createelement('div'); slider.classname = 'ui-input-slider'; slider.setattribute('data-topic', topic); if (label !== undefined) slider.setattribute('data-info', label); new inputslider(slider); return slider; }; var init = function init() { var elem = document.query
selectorall('.ui-input-slider'); var size = elem.length; for (var i = 0; i < size; i++) new inputslider(elem[i]); }; return { init : init, setmax : setmax, setmin : setmin, setunit : setunit, setstep : setstep, getnode : getnode, getstep : getstep, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe, setprecision : setprecision, setsensivity : setsensivi...
...; var unsubscribe = function unsubscribe(topic, callback) { subscribers[topic].indexof(callback); subscribers[topic].splice(index, 1); }; var notify = function notify() { if (subscribers[this.topic] === undefined) return; for (var i = 0; i < subscribers[this.topic].length; i++) subscribers[this.topic][i](this.value); }; var init = function init() { var elem = document.query
selectorall('.ui-slider'); var size = elem.length; for (var i = 0; i < size; i++) new slider(elem[i]); }; return { init : init, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe }; })(); window.addeventlistener("load", function() { lineargradienttool.init(); }); window.addeventlistener("load", function() { lineargradienttool.init(); }); var lineargradienttool =...
transition-delay - CSS: Cascading Style Sheets
ht background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:0.5s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:0.5s; transition-timing-function: linear; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ba...
...height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:1s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:1s; transition-timing-function: linear; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ba...
...height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:2s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:2s; transition-timing-function: linear; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ba...
...kground-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-delay' in that specification.
transition-duration - CSS: Cascading Style Sheets
ound-color font-size left top transform -webkit-transform color; -webkit-transition-duration:0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration:0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top -webkit-transform transform color; -webkit-transition-duration:1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top transform -webkit-transform color; -webkit-transition-duration:2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top transform -webkit-transform color; -webkit-transition-duration:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.query
selector("div.box"); if (el) { el.classname = "box1"; } else { el = document.query
selector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-duration' in that specification.
<input type="color"> - HTML: Hypertext Markup Language
here's an example that watches changes over time to the color value: colorpicker.addeventlistener("input", updatefirst, false); colorpicker.addeventlistener("change", watchcolorpicker, false); function watchcolorpicker(event) { document.query
selectorall("p").foreach(function(p) { p.style.color = event.target.value; }); } selecting the value if the <input> element's implementation of the color type on the user's browser doesn't support a color well, but is instead a text field for entering the color string directly, you can use the select() method to select the text currently in the edit field.
... var colorwell; var defaultcolor = "#0000ff"; window.addeventlistener("load", startup, false); initialization once the page is loaded, our load event handler, startup(), is called: function startup() { colorwell = document.query
selector("#colorwell"); colorwell.value = defaultcolor; colorwell.addeventlistener("input", updatefirst, false); colorwell.addeventlistener("change", updateall, false); colorwell.select(); } this gets a reference to the color <input> element in a variable called colorwell, then sets the color input's value to the value in defaultcolor.
... function updatefirst(event) { var p = document.query
selector("p"); if (p) { p.style.color = event.target.value; } } when the color picker is dismissed, indicating that the value will not be changing again (unless the user re-opens the color picker), a change event is sent to the element.
... we handle that event using the updateall() function, using event.target.value to obtain the final selected color: function updateall(event) { document.query
selectorall("p").foreach(function(p) { p.style.color = event.target.value; }); } this sets the color of every <p> block so that its color attribute matches the current value of the color input, which is referred to using event.target.
ui/frame - Archive of obsolete content
for example, this html document defines a <select> element and a couple of <span> elements, and includes a css file to style the content and a javascript script to implement behavior: <!doctype html> <html> <head> <link href="city-info.css" rel="stylesheet"></link> </head> <body> <select name="city" id="city-
selector"></select> <span id="time" class="info-element"></span> <span id="weather" class="info-element"></span> <script type="text/javascript" src="city-info.js"></script> </body> </html> if we save this document as "city-info.html" under the add-on's "data" directory, we can create a frame hosting it and add the frame to a toolbar like this: var { frame } = require("sdk/ui/frame"); var...
...message("ping", "*"); if the frame script has received a message from the add-on already, it can use the origin property of the event object passed to the message hander: // listen for messages from the add-on, and send a reply window.addeventlistener("message", function(event) { event.source.postmessage("pong", event.origin) }, false); this frame script listens to change events on the "city-
selector" <select> element, and sends a message to the add-on containing the value for the newly selected element.
... // city-info.js var city
selector = window.document.getelementbyid("city-
selector"); city
selector.addeventlistener("change", citychanged); function citychanged() { window.parent.postmessage(city
selector.value, "*"); } to listen for these messages in the main add-on code, you can assign a listener to the frame's message event.
Adding Toolbars and Toolbar Buttons - Archive of obsolete content
windows: /* the second and third
selectors at the bottom are necessary to prevent conflicts with installed themes.
... */ toolbarbutton.xulschoolhello-toolbarbutton, window:not([active="true"]) toolbarbutton.xulschoolhello-toolbarbutton, toolbar[iconsize="small"] toolbarbutton.xulschoolhello-toolbarbutton { list-style-image: url("chrome://xulschoolhello-os/skin/toolbar.png"); } #xulschoolhello-hello-world-button { -moz-image-region: rect(0px, 16px, 16px, 0px); } mac os x: /* the second and third
selectors at the bottom are necessary to prevent conflicts with installed themes.
... */ toolbarbutton.xulschoolhello-toolbarbutton, window:not([active="true"]) toolbarbutton.xulschoolhello-toolbarbutton, toolbar[iconsize="small"] toolbarbutton.xulschoolhello-toolbarbutton { list-style-image: url("chrome://xulschoolhello-os/skin/toolbar.png"); } #xulschoolhello-hello-world-button { -moz-image-region: rect(0px, 16px, 16px, 0px); } linux: /* the second and third
selectors at the bottom are necessary to prevent conflicts with installed themes.
Adding Style Sheets - Archive of obsolete content
you can use
selectors to select the element that you wish to have styled.
... (the
selector is the part before the curly brace in a style rule).
... the following list summarizes some of the
selectors available: button matches all button tags.
Styling a Tree - Archive of obsolete content
set the property on a row or cell, as in the following example: <treerow properties="makeitblue"> css
selectors for the tree the style sheet can take this property and use it to change the appearance of the row for unread messages or labels.
...the following is the syntax that needs to be used: treechildren::-moz-tree-row(makeitblue) { background-color: blue; } this style which has a complex
selector is used to style the background color of rows that have the 'makeitblue' property.
...this
selector matches some tree rows inside the treechildren element as pseudo-elements.
Building a Theme - Archive of obsolete content
when writing a theme, the easiest way to determine what css
selectors you need to write is to use the dom inspector which you should have installed in the setup step.
...to change its style within our theme, we need to write a
selector rule to select this class.
...search this file for the #navigator-toolbox
selector, and add a background: orange; rule to it.
CSS - MDN Web Docs Glossary: Definitions of Web-related terms
a css rule is a set of properties associated with a
selector.
... here is an example that makes every html paragraph yellow against a black background: /* the
selector "p" indicates that all paragraphs in the document will be affected by that rule */ p { /* the "color" property defines the text color, in this case yellow.
...*/ background-color: black } "cascading" refers to the rules that govern how
selectors are prioritized to change a page's appearance.
Practical positioning examples - Learn web development
first, add the following rule at the bottom of your css to remove the default padding-left and margin-top from the unordered list: .info-box ul { padding-left: 0; margin-top: 0; } note: we are using descendant
selectors with .info-box at the start of the chain throughout this example — this is so that we can insert this feature into a page with other content already on it, without fear of interfering with the styles applied to other parts of the page.
...put the following block of code, exactly as written in between your opening and closing <script> tags (you'll find these below the html content): var tabs = document.query
selectorall('.info-box li a'); var panels = document.query
selectorall('.info-box article'); for(i = 0; i < tabs.length; i++) { var tab = tabs[i]; settabhandler(tab, i); } function settabhandler(tab, tabpos) { tab.onclick = function() { for(i = 0; i < tabs.length; i++) { tabs[i].classname = ''; } tab.classname = 'active'; for(i = 0; i < panels.length; i++) { panels[i].
... setting the checked state there is one final bit of css to add — put the following at the bottom of your css: input[type=checkbox]:checked + aside { right: 0px; } the
selector is pretty complex here — we are selecting the <aside> element adjacent to the <input> element, but only when it is checked (note the use of the :checked pseudo-class to achieve this).
What are browser developer tools? - Learn web development
some browsers also have copy css path and copy xpath available, to allow you to copy the css
selector or xpath expression that would select the current html element.
... this will give you a window like the following: to see what happens, try entering the following snippets of code into the console one by one (and then pressing enter): alert('hello!'); document.query
selector('html').style.backgroundcolor = 'purple'; const mywordmark = document.createelement('img'); mywordmark.setattribute('src','https://blog.mozilla.org/press/wp-content/themes/onemozilla/img/mozilla-wordmark.png'); document.query
selector('h1').appendchild(mywordmark); now try entering the following incorrect versions of the code and see what you get.
... alert('hello!); document.cheese
selector('html').style.backgroundcolor = 'purple'; const mywordmark = document.createelement('img'); mybanana.setattribute('src','https://blog.mozilla.org/press/wp-content/themes/onemozilla/img/mozilla-wordmark.png'); document.query
selector('h1').appendchild(mywordmark); you'll start to see the kind of errors that the browser returns.
Example 5 - Learn web development
kground: #000; color: #ffffff; } javascript content // ------- // // helpers // // ------- // nodelist.prototype.foreach = function (callback) { array.prototype.foreach.call(this, callback); } // -------------------- // // function definitions // // -------------------- // function deactivateselect(select) { if (!select.classlist.contains('active')) return; var optlist = select.query
selector('.optlist'); optlist.classlist.add('hidden'); select.classlist.remove('active'); } function activeselect(select, selectlist) { if (select.classlist.contains('active')) return; selectlist.foreach(deactivateselect); select.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.query
selector('.optlist'); optlist.classlist.toggle('hidden'); } funct...
...ion highlightoption(select, option) { var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function updatevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.query
selector('.value'); var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (other) { other.setattribute('aria-selected', 'false'); }); optionlist[index].setattribute('aria-selected', 'true'); nativewidget.selectedindex = index; value.innerhtml = optionlist[index].innerhtml; highlightoption(select, optionlist[index]); }; function getindex(select) { var nativewidget = select.previouselementsibling; return nativewid...
...get.selectedindex; }; // ------------- // // event binding // // ------------- // window.addeventlistener("load", function () { var form = document.query
selector('form'); form.classlist.remove("no-widget"); form.classlist.add("widget"); }); window.addeventlistener('load', function () { var selectlist = document.query
selectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.query
selectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; updatevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('mouseover', function () { highlightoption(select, option); }); option.addeventlistener('click'...
Getting started with HTML - Learn web development
font-family: 'open sans light',helvetica,arial,sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...sans-serif; } h1 { color: blue; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } img { max-width: 100%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
Introduction to web APIs - Learn web development
indow.audiocontext || window.webkitaudiocontext; const audioctx = new audiocontext(); next, we create constants that store references to our <audio>, <button>, and <input> elements, and use the audiocontext.createmediaelementsource() method to create a mediaelementaudiosourcenode representing the source of our audio — the <audio> element will be played from: const audioelement = document.query
selector('audio'); const playbtn = document.query
selector('button'); const volumeslider = document.query
selector('.volume'); const audiosource = audioctx.createmediaelementsource(audioelement); next up we include a couple of event handlers that serve to toggle between play and pause when the button is pressed and reset the display back to the beginning when the song has finished playing: // play/pause ...
... the document object model (dom) api also has a simple entry point — its features tend to be found hanging off the document object, or an instance of an html element that you want to affect in some way, for example: const em = document.createelement('em'); // create a new em element const para = document.query
selector('p'); // reference an existing p element em.textcontent = 'hello there!'; // give em some text content para.appendchild(em); // embed em inside para the canvas api also relies on getting a context object to use to manipulate things, although in this case, it's a graphical context rather than an audio context.
... its context object is created by getting a reference to the <canvas> element you want to draw on, and then calling its htmlcanvaselement.getcontext() method: const canvas = document.query
selector('canvas'); const ctx = canvas.getcontext('2d'); anything that we want to do to the canvas is then achieved by calling properties and methods of the context object (which is an instance of canvasrenderingcontext2d), for example: ball.prototype.draw = function() { ctx.beginpath(); ctx.fillstyle = this.color; ctx.arc(this.x, this.y, this.size, 0, 2 * math.pi); ctx.fill(); }; note: you can see this code in action in our bouncing balls demo (see it running live also).
What went wrong? Troubleshooting JavaScript - Learn web development
the earliest instance you'll find in the javascript is on line 48: const loworhi = document.query
selector('loworhi'); at this point we are trying to make the variable contain a reference to an element in the document's html.
...line 48 is using a document.query
selector() method to get a reference to an element by selecting it with a css
selector.
... looking further up our file, we can find the paragraph in question: <p class="loworhi"></p> so we need a class
selector here, which begins with a dot (.), but the
selector being passed into the query
selector() method in line 48 has no dot.
Implementing feature detection - Learn web development
give it the following contents: const conditional = document.query
selector('.conditional'); const testelem = document.createelement('div'); if (testelem.style.flex !== undefined && testelem.style.flexflow !== undefined) { conditional.setattribute('href', 'flex-layout.css'); } else { conditional.setattribute('href', 'float-layout.css'); } here we are grabbing a reference to the second <link> element, and creating a <div> element as part of our test.
...the problem here is browser support — @supports is not supported at all in ie, and only supported in very recent versions of safari/ios webkit (9+/9.2+), whereas the javascript version should work in much older browsers (probably back to ie8 or 9, although older versions of ie will have additional problems, such as not supporting document.query
selector, and having a messed up box model).
...because all those class names have been put on the <html> element, you can target browsers that do or don't support a feature using specific descendant
selectors.
Handling common JavaScript problems - Learn web development
jquery for example provides its own fully-featured
selectors and dom manipuation libraries, to allow css-
selector type selecting of elements in javascript and easier dom building.
... it is not so important now we have modern features like document.query
selector()/document.query
selectorall()/node methods available across browsers, but it can still be useful when older browsers need supporting.
... apply the polyfill scripts to the page using the following code — place these above the existing <script> element so they will be available on the page already when we start trying to use fetch: <script src="es6-promise.js"></script> <script src="fetch.js"></script> inside the original <script>, add the following code: const myimage = document.query
selector('.my-image'); fetch('flowers.jpg').then(function(response) { response.blob().then(function(myblob) { let objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); now if you load it in a browser that doesn't support fetch (safari and ie are obvious candidates), you should still see the flower image appear — cool!
Localizing with Pontoon
project
selector (affiliates) switches between projects to localize.
... resource
selector (homepage) switches between project resources to localize, like subpages or localization files.
... locale
selector (slovenian) switches between languages to localize.
Mozilla Style System Documentation
for the css stylesheets, this process corresponds to css
selector matching.
... the output of css
selector matching as defined by the css specification is an ordered list of rules, where the order determines which declarations override other declarations.
...in mozilla, nscssdeclaration objects correspond to css declaration-blocks.) due to the high similarity of these lists between elements in the content tree, mozilla stores the output of the
selector matching process in a lexicographic tree, the rule tree.
Tips - Firefox Developer Tools
in the rules view: click the inspector icon () next to any
selector to highlight all elements that match it.
... $() is a shortcut to document.query
selector().
... $$() returns an array with the results from document.query
selectorall().
CSSStyleDeclaration.setProperty() - Web APIs
we then loop through the different rules contained inside the stylesheet, which are contained in the array found at stylesheet.cssrules; for each one, we check whether its cssstylerule.
selectortext property is equal to the
selector .box p, which indicates it is the one we want.
...height: 30px; line-height: 30px; } .box { display: flex; justify-content: center; align-items: center; height: calc(100% - 70px); } .box p { width: 50%; text-align: center; font-weight: bold; font-size: 40px; height: 150px; line-height: 150px; background: red; border: 5px solid purple; color: white; transition: all 1s; } javascript const borderbtn = document.query
selector('.border'); const bgcolorbtn = document.query
selector('.bgcolor'); const colorbtn = document.query
selector('.color'); const box = document.query
selector('.box'); function random(min,max) { const num = math.floor(math.random()*(max-min)) + min; return num; } function randomcolor() { return 'rgb(' + random(0,255) + ', ' + random(0,255) + ', ' + random(0,255) + ')'; } const stylesheet = do...
...cument.stylesheets[1]; let boxpararule; for(let i = 0; i < stylesheet.cssrules.length; i++) { if(stylesheet.cssrules[i].
selectortext === '.box p') { boxpararule = stylesheet.cssrules[i]; } } function setrandomborder() { const newborder = random(1, 50) + 'px solid ' + randomcolor(); boxpararule.style.setproperty('border', newborder); } function setrandombgcolor() { const newbgcolor = randomcolor(); boxpararule.style.setproperty('background-color', newbgcolor); } function setrandomcolor() { const newcolor = randomcolor(); boxpararule.style.setproperty('color', newcolor); } borderbtn.addeventlistener('click', setrandomborder); bgcolorbtn.addeventlistener('click', setrandombgcolor); colorbtn.addeventlistener('click', setrandomcolor); result specifications specifi...
Using FormData Objects - Web APIs
var formdata = new formdata(someformelement); for example: var formelement = document.query
selector("form"); var request = new xmlhttprequest(); request.open("post", "submitform.php"); request.send(new formdata(formelement)); you can also append additional data to the formdata object between retrieving it from a form and sending it, like this: var formelement = document.query
selector("form"); var formdata = new formdata(formelement); var request = new xmlhttprequest(); request.open("post", "...
... <input type="text" name="filelabel" size="12" maxlength="32" /><br /> <label>file to stash:</label> <input type="file" name="file" required /> <input type="submit" value="stash the file!" /> </form> <div></div> then you can send it using code like the following: var form = document.forms.nameditem("fileinfo"); form.addeventlistener('submit', function(ev) { var ooutput = document.query
selector("div"), odata = new formdata(form); odata.append("customfield", "this is some extra data"); var oreq = new xmlhttprequest(); oreq.open("post", "stash.php", true); oreq.onload = function(oevent) { if (oreq.status == 200) { ooutput.innerhtml = "uploaded!"; } else { ooutput.innerhtml = "error " + oreq.status + " occurred when trying to upload your file.<br \/>"; ...
... typically this is used as shown in our simple formdata event demo — in the javascript we reference a form: const formelem = document.query
selector('form'); in our submit event handler we use preventdefault to stop the default form submission, then invoke a formdata constructor to trigger the formdata event: formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); when the formdata event fires ...
ImageCapture - Web APIs
var imagecapture; function ongetusermediabuttonclick() { navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); }) .catch(error => console.log(error)); } function ongrabframebuttonclick() { imagecapture.grabframe() .then(imagebitmap => { const canvas = document.query
selector('#grabframecanvas'); drawcanvas(canvas, imagebitmap); }) .catch(error => console.log...
...(error)); } function ontakephotobuttonclick() { imagecapture.takephoto() .then(blob => createimagebitmap(blob)) .then(imagebitmap => { const canvas = document.query
selector('#takephotocanvas'); drawcanvas(canvas, imagebitmap); }) .catch(error => console.log(error)); } /* utils */ function drawcanvas(canvas, img) { canvas.width = getcomputedstyle(canvas).width.split('px')[0]; canvas.height = getcomputedstyle(canvas).height.split('px')[0]; let ratio = math.min(canvas.width / img.width, canvas.height / img.height); let x = (canvas.width - img.width * ratio) / 2; let y = (canvas.height - img.height * ratio) / 2; canvas.getcontext('2d').clearrect(0, 0, canvas.width, canvas.height); canvas.getcontext('2d').drawimage(img, 0, 0, img.width, img.height, x, y, img.wi...
...dth * ratio, img.height * ratio); } document.query
selector('video').addeventlistener('play', function() { document.query
selector('#grabframebutton').disabled = false; document.query
selector('#takephotobutton').disabled = false; }); specifications specification status comment mediastream image capturethe definition of 'imagecapture' in that specification.
SubtleCrypto.deriveBits() - Web APIs
async function derivesharedsecret(privatekey, publickey) { const sharedsecret = await window.crypto.subtle.derivebits( { name: "ecdh", namedcurve: "p-384", public: publickey }, privatekey, 128 ); const buffer = new uint8array(sharedsecret, 0, 5); const sharedsecretvalue = document.query
selector(".ecdh .derived-bits-value"); sharedsecretvalue.classlist.add("fade-in"); sharedsecretvalue.addeventlistener("animationend", () => { sharedsecretvalue.classlist.remove("fade-in"); }); sharedsecretvalue.textcontent = `${buffer}...[${sharedsecret.bytelength} bytes total]`; } // generate 2 ecdh key pairs: one for alice and one for bob // in more normal usage, they would generate their k...
...ame: "ecdh", namedcurve: "p-384" }, false, ["derivebits"] ); const generatebobskeypair = window.crypto.subtle.generatekey( { name: "ecdh", namedcurve: "p-384" }, false, ["derivebits"] ); promise.all([generatealiceskeypair, generatebobskeypair]).then(values => { const aliceskeypair = values[0]; const bobskeypair = values[1]; const derivebitsbutton = document.query
selector(".ecdh .derive-bits-button"); derivebitsbutton.addeventlistener("click", () => { // alice then generates a secret using her private key and bob's public key.
...{ const keymaterial = await getkeymaterial(); salt = window.crypto.getrandomvalues(new uint8array(16)); const derivedbits = await window.crypto.subtle.derivebits( { "name": "pbkdf2", salt: salt, "iterations": 100000, "hash": "sha-256" }, keymaterial, 256 ); const buffer = new uint8array(derivedbits, 0, 5); const derivedbitsvalue = document.query
selector(".pbkdf2 .derived-bits-value"); derivedbitsvalue.classlist.add("fade-in"); derivedbitsvalue.addeventlistener("animationend", () => { derivedbitsvalue.classlist.remove("fade-in"); }); derivedbitsvalue.textcontent = `${buffer}...[${derivedbits.bytelength} bytes total]`; } const derivebitsbutton = document.query
selector(".pbkdf2 .derive-bits-button"); derivebitsbutton.addeventlistener("...
Hello GLSL - Web APIs
="x-shader/x-fragment" id="fragment-shader"> #version 100 void main() { gl_fragcolor = vec4(0.18, 0.54, 0.34, 1.0); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.query
selector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.query
selector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl.a...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.query
selector("p").innerhtml = "shader program did not link successfully.
... var buffer; function initializeattributes() { gl.enablevertexattribarray(0); buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.vertexattribpointer(0, 1, gl.float, false, 0, 0); } function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.dr...
Scissor animation - Web APIs
position = [0, gl.drawingbufferheight]; var button = document.query
selector("button"); var timer; function startanimation(evt) { button.removeeventlistener(evt.type, startanimation, false); button.addeventlistener("click", stopanimation, false); document.query
selector("strong").innerhtml = "stop"; timer = setinterval(drawanimation, 17); drawanimation(); } function stopanimation(evt) { button.removeeventlistener(evt.type, stopanimation, fal...
...se); button.addeventlistener("click", startanimation, false); document.query
selector("strong").innerhtml = "start"; clearinterval(timer); } stopanimation({type: "click"}); } // variables to hold the size and velocity of the square.
...m()*(gl.drawingbufferwidth - size[0]), gl.drawingbufferheight ]; // random velocity between 1.0 and 7.0 velocity = 1.0 + 6.0*math.random(); color = getrandomcolor(); gl.clearcolor(color[0], color[1], color[2], 1.0); } } function getrandomcolor() { return [math.random(), math.random(), math.random()]; } function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.dr...
Textures from code - Web APIs
istancesqrd = distance * distance; gl_fragcolor = vec4( 0.2/distancesqrd, 0.1/distancesqrd, 0.0, 1.0 ); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.query
selector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.query
selector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl.a...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.query
selector("p").innerhtml = "shader program did not link successfully.
... buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, new float32array([0.0, 0.0]), gl.static_draw); gl.vertexattribpointer(0, 2, gl.float, false, 0, 0); } function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.dr...
WindowOrWorkerGlobalScope.setInterval() - Web APIs
color() { clearinterval(nintervid); } </script> </head> <body onload="changecolor();"> <div id="my_box"> <p>hello world</p> </div> <button onclick="stoptextcolor();">stop</button> </body> </html> example 3: typewriter simulation the following example simulates typewriter by first clearing and then slowly typing content into the nodelist that matches a specified group of
selectors.
... <!doctype html> <html> <head> <meta charset="utf-8" /> <title>javascript typewriter - mdn example</title> <script> function typewriter (s
selector, nrate) { function clean () { clearinterval(nintervid); btyping = false; bstart = true; ocurrent = null; asheets.length = nidx = 0; } function scroll (osheet, npos, beraseandstop) { if (!osheet.hasownproperty('parts') || amap.length < npos) { return true; } var orel, bexit = false; if (amap.length === npos) { amap.push(0); } while (amap[npos] < osheet.parts.length) { orel = osheet.parts[amap[npos]]; scroll(orel, npos + 1, beraseandstop) ?
....parts.length; nchild++) { onode.removechild(this.parts[nchild]); this.parts[nchild] = new sheet(this.parts[nchild]); } } var nintervid, ocurrent = null, btyping = false, bstart = true, nidx = 0, spart = "", asheets = [], amap = []; this.rate = nrate || 100; this.play = function () { if (btyping) { return; } if (bstart) { var aitems = document.query
selectorall(s
selector); if (aitems.length === 0) { return; } for (var nitem = 0; nitem < aitems.length; nitem++) { asheets.push(new sheet(aitems[nitem])); /* uncomment the following line if you have previously hidden your elements via css: */ // aitems[nitem].style.visibility = "visible"; } bstart = false; } nintervid = setinterval(typewrite, this...
:-moz-locale-dir(ltr) - CSS: Cascading Style Sheets
note: this
selector is mainly used by extensions and themes to adapt the user interface based on the user's locale.
... this
selector does not work properly from html; it always matches, regardless of whether the ui locale is left-to-right or right-to-left.
... syntax :-moz-locale-dir(ltr) examples this example doesn't work if you're not using firefox, and may not work even in firefox due to an issue with the
selector not working propertly with html content.
:-moz-locale-dir(rtl) - CSS: Cascading Style Sheets
note: this
selector is mainly used by extensions and themes to adapt the user interface based on the user's locale.
... this
selector does not work properly from html; it never matches, no matter whether the ui locale is left-to-right or right-to-left.
... syntax :-moz-locale-dir(rtl) examples this example will not work if you're not using firefox, and might not work properly even in firefox due to an issue with using this
selector in html.
:checked - CSS: Cascading Style Sheets
the :checked css pseudo-class
selector represents any radio (<input type="radio">), checkbox (<input type="checkbox">), or option (<option> in a <select>) element that is checked or toggled to an on state.
...
selectors level 4the definition of ':checked' in that specification.
...
selectors level 3the definition of ':checked' in that specification.
:disabled - CSS: Cascading Style Sheets
css input[type="text"]:disabled { background: #ccc; } javascript // wait for the page to finish loading document.addeventlistener('domcontentloaded', function () { // attach `change` event listener to checkbox document.getelementbyid('billing-checkbox').onchange = togglebilling; }, false); function togglebilling() { // select the billing text fields var billingitems = document.query
selectorall('#billing input[type="text"]'); // toggle the billing text fields for (var i = 0; i < billingitems.length; i++) { billingitems[i].disabled = !billingitems[i].disabled; } } result specifications specification status comment html living standardthe definition of ':disabled' in that specification.
...
selectors level 4the definition of ':disabled' in that specification.
...
selectors level 3the definition of ':disabled' in that specification.
:empty - CSS: Cascading Style Sheets
note: in
selectors level 4 the :empty pseudo-class was changed to act like :-moz-only-whitespace, but no browser currently supports this yet.
...| the paciello group hidden content for better a11y | go make things mdn understanding wcag, guideline 2.4 explanations understanding success criterion 2.4.4 | w3c understanding wcag 2.0 specifications specification status comment
selectors level 4the definition of 'the :empty pseudo-class' in that specification.
...
selectors level 3the definition of 'the :empty pseudo-class' in that specification.
:first-child - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
...d-color: black; padding: 5px; } result styling a list html <ul> <li>item 1</li> <li>item 2</li> <li>item 3 <ul> <li>item 3.1</li> <li>item 3.2</li> <li>item 3.3</li> </ul> </li> </ul> css ul li { color: blue; } ul li:first-child { color: red; font-weight: bold; } result specifications specification status comment
selectors level 4the definition of ':first-child' in that specification.
...
selectors level 3the definition of ':first-child' in that specification.
:focus-visible - CSS: Cascading Style Sheets
(many browsers show a “focus ring” by default in this case.) this
selector is useful to provide a different focus indicator based on the user’s input modality (mouse vs.
... syntax :focus-visible examples basic example in this example, the :focus-visible
selector uses the ua's behavior to determine when to match.
... specifications specification status comment
selectors level 4the definition of ':focus-visible' in that specification.
:last-child - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
...olor: black; padding: 5px; } result styling a list html <ul> <li>item 1</li> <li>item 2</li> <li>item 3 <ul> <li>item 3.1</li> <li>item 3.2</li> <li>item 3.3</li> </ul> </li> </ul> css ul li { color: blue; } ul li:last-child { border: 1px solid red; color: red; } result specifications specification status comment
selectors level 4the definition of ':last-child' in that specification.
...
selectors level 3the definition of ':last-child' in that specification.
:only-child - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
... element.</li> </ul> </li> <li>second <ul> <li>this list has three elements.</li> <li>this list has three elements.</li> <li>this list has three elements.</li> </ul> </li> </ol> css li li { list-style-type: disc; } li:only-child { color: red; list-style-type: square; } result specifications specification status comment
selectors level 4the definition of ':only-child' in that specification.
...
selectors level 3the definition of ':only-child' in that specification.
:only-of-type - CSS: Cascading Style Sheets
beginning with
selectors level 4, this is no longer required.
... <i>i am the only `i` child.</i> <em>i am `em` #1.</em> <em>i am `em` #2.</em> </div> </main> css main :only-of-type { color: red; } result specifications specification status comment
selectors level 4the definition of ':only-of-type' in that specification.
...
selectors level 3the definition of ':only-of-type' in that specification.
:root - CSS: Cascading Style Sheets
in html, :root represents the <html> element and is identical to the
selector html, except that its specificity is higher.
... /* selects the root element of the document: <html> in the case of html */ :root { background: yellow; } syntax :root examples declaring global css variables :root can be useful for declaring global css variables: :root { --main-color: hotpink; --pane-padding: 5px 42px; } specifications specification status comment
selectors level 4the definition of ':root' in that specification.
...
selectors level 3the definition of ':root' in that specification.
:target - CSS: Cascading Style Sheets
/* selects an element with an id matching the current url's fragment */ :target { border: 2px solid black; } for example, the following url has a fragment (denoted by the # sign) that points to an element called section2: http://www.example.com/index.html#section2 the following element would be selected by a :target
selector when the current url is equal to the above: <section id="section2">example</section> syntax :target examples a table of contents the :target pseudo-class can be used to highlight the portion of a page that has been linked to from a table of contents.
...
selectors level 4the definition of ':target' in that specification.
...
selectors level 3the definition of ':target' in that specification.
@page - CSS: Cascading Style Sheets
formal syntax @page <page-
selector-list> { <page-body> }where <page-
selector-list> = [ <page-
selector># ]?<page-body> = <declaration>?
...| <page-margin-box> <page-body>where <page-
selector> = <pseudo-page>+ | <ident> <pseudo-page>*<page-margin-box> = <page-margin-box-type> '{' <declaration-list> '}'where <pseudo-page> = : [ left | right | first | blank ]<page-margin-box-type> = @top-left-corner | @top-left | @top-center | @top-right | @top-right-corner | @bottom-left-corner | @bottom-left | @bottom-center | @bottom-right | @bottom-right-corner | @left-top | @left-middle | @left-bottom | @right-top | @right-middle | @right-bottom examples @page pseudo-class examples please refer to the various pseudo-classes of @page for examples.
... editor's draft adds the :recto and :verso page
selectors css paged media module level 3the definition of '@page' in that specification.
Color picker tool - CSS: Cascading Style Sheets
function unsubscribe(callback) { subscribers.indexof(callback); subscribers.splice(index, 1); }; var notify = function notify(topic, value) { if (subscribers[topic] === undefined || subscribers[topic].length === 0) return; var color = new color(value); for (var i in subscribers[topic]) subscribers[topic][i](color); }; var init = function init() { var elem = document.query
selectorall('.ui-color-picker'); var size = elem.length; for (var i = 0; i < size; i++) new colorpicker(elem[i]); }; return { init : init, color : color, rgbcolor : rgbcolor, rgbacolor : rgbacolor, hsvcolor : hsvcolor, hsvacolor : hsvacolor, hslcolor : hslcolor, hslacolor : hslacolor, setcolor : setcolor, getcolor : getcolor, subscribe : subscribe, unsubscribe : unsubscri...
...this.topic][i](this.value); }; var createslider = function createslider(topic, label) { var slider = document.createelement('div'); slider.classname = 'ui-input-slider'; slider.setattribute('data-topic', topic); if (label !== undefined) slider.setattribute('data-info', label); new inputslider(slider); return slider; }; var init = function init() { var elem = document.query
selectorall('.ui-input-slider'); var size = elem.length; for (var i = 0; i < size; i++) new inputslider(elem[i]); }; return { init : init, setmax : setmax, setmin : setmin, setunit : setunit, setstep : setstep, getnode : getnode, getstep : getstep, setvalue : setvalue, subscribe : subscribe, unsubscribe : unsubscribe, setprecision : setprecision, setsensivity : setsensivi...
...witchpickingmodeto(hsl); else switchpickingmodeto(hsv); }); hsv.addeventlistener('click', function() { switchpickingmodeto(hsv); }); hsl.addeventlistener('click', function() { switchpickingmodeto(hsl); }); parent.appendchild(icon); parent.appendchild(button); }; var setpickerdraganddrop = function setpickerdraganddrop() { var preview = document.query
selector('#picker .preview-color'); var picking_area = document.query
selector('#picker .picking-area'); preview.setattribute('draggable', 'true'); preview.addeventlistener('drop', drop); preview.addeventlistener('dragstart', dragstart); preview.addeventlistener('dragover', allowdropevent); picking_area.addeventlistener('drop', drop); picking_area.addeventlistener('dragover', allowdr...
Stacking context example 3 - CSS: Cascading Style Sheets
« css « understanding css z-index stacking context example 3 this last example shows problems that arise when mixing several positioned elements in a multi-level html hierarchy and when z-indexes are assigned using class
selectors.
...usually this kind of menu is script-generated either client-side or server-side, so style rules are assigned with a class
selector instead of the id
selector.
... level #1 this problem can be avoided by removing overlapping between different level menus, or by using individual (and different) z-index values assigned through the id
selector instead of class
selector, or by flattening the html hierarchy.
Column combinator - CSS: Cascading Style Sheets
the column combinator (||) is placed between two css
selectors.
... it matches only those elements matched by the second
selector that belong to the column elements matched by the first.
... /* table cells that belong to the "selected" column */ col.selected || td { background: gray; } syntax column-
selector || cell-
selector { /* style properties */ } examples html <table border="1"> <colgroup> <col span="2"/> <col class="selected"/> </colgroup> <tbody> <tr> <td>a <td>b <td>c </tr> <tr> <td colspan="2">d</td> <td>e</td> </tr> <tr> <td>f</td> <td colspan="2">g</td> </tr> </tbody> </table> css col.selected || td { background: gray; color: white; font-weight: bold; } result specifications specification status comment
selectors level 4the definition of 'column combinator' in that specification.
General sibling combinator - CSS: Cascading Style Sheets
the general sibling combinator (~) separates two
selectors and matches the second element only if it follows the first element (though not necessarily immediately), and both are children of the same parent element.
...lor: red; } syntax former_element ~ target_element { style properties } examples css p ~ span { color: red; } html <span>this is not red.</span> <p>here is a paragraph.</p> <code>here is some code.</code> <span>and here is a red span!</span> <code>more code...</code> <span>and this is a red span!</span> result specifications specification status comment
selectors level 4the definition of 'subsequent-sibling combinator' in that specification.
...
selectors level 3the definition of 'general sibling combinator' in that specification.
Pseudo-elements - CSS: Cascading Style Sheets
a css pseudo-element is a keyword added to a
selector that lets you style a specific part of the selected element(s).
... syntax
selector::pseudo-element { property: value; } you can use only one pseudo-element in a
selector.
... it must appear after the simple
selectors in the statement.
WebKit CSS extensions - CSS: Cascading Style Sheets
note: if there is an invalid pseudo-class within in a chain or group of
selectors, the whole
selector list is invalid.
...-meter-suboptimum-value -webkit-media-text-track-container ::-webkit-outer-spin-button ::-webkit-progress-bar ::-webkit-progress-inner-element ::-webkit-progress-value ::-webkit-search-cancel-button ::-webkit-search-results-button ::-webkit-slider-runnable-track ::-webkit-slider-thumb note: generally, if there is an invalid pseudo-element or pseudo-class within in a chain or group of
selectors, the whole
selector list is invalid.
... if a pseudo-element (but not pseudo-class) has a -webkit- prefix, as of firefox 63, blink, webkit and gecko browsers assume it is valid, not invalidating the
selector list.
Audio and Video Delivery - Developer guides
here's a trick that stops the download at once: var mediaelement = document.query
selector("#mymediaelementid"); mediaelement.removeattribute("src"); mediaelement.load(); by removing the media element's src attribute and invoking the load() method, you release the resources associated with the video, which stops the network download.
... var mediaelement = document.query
selector('#mediaelementid'); mediaelement.seekable.start(0); // returns the starting time (in seconds) mediaelement.seekable.end(0); // returns the ending time (in seconds) mediaelement.currenttime = 122; // seek to 122 seconds mediaelement.played.end(0); // returns the number of seconds the browser has played specifying playback range when specifying the uri of media for an <audio> or <video>...
...then you can replace the video with its fallback content: <video controls> <source src="dynamicsearch.mp4" type="video/mp4"></source> <a href="dynamicsearch.mp4"> <img src="dynamicsearch.jpg" alt="dynamic app search in firefox os"> </a> <p>click image to play a video demo of dynamic app search</p> </video> var v = document.query
selector('video'), sources = v.query
selectorall('source'), lastsource = sources[sources.length-1]; lastsource.addeventlistener('error', function(ev) { var d = document.createelement('div'); d.innerhtml = v.innerhtml; v.parentnode.replacechild(d, v); }, false); audio/video javascript libraries a number of audio and video javascript libaries exist.
Challenge solutions - Developer guides
selectors second paragraph blue challenge without changing your html file, add a single rule to your css file that keeps all the initial letters the same color as they are now, but makes all the other text in the second paragraph blue.
... solution add a rule with an id
selector of #second and a declaration color: blue;, as shown below: #second { color: blue; } a more specific
selector, p#second also works.
... solution change the
selector of the new rule to be a tag
selector using p: p { color: blue; } the rules for the other colors all have more specific
selectors, so they override the blue of the paragraph.
Array.prototype.map() - JavaScript
[2, 8, 18] // numbers is still [1, 4, 9] using map generically this example shows how to use map on a string to get an array of bytes in the ascii encoding representing the character values: let map = array.prototype.map let a = map.call('hello world', function(x) { return x.charcodeat(0) }) // a now equals [72, 101, 108, 108, 111, 32, 87, 111, 114, 108, 100] using map generically query
selectorall this example shows how to iterate through a collection of objects collected by query
selectorall.
... this is because query
selectorall returns a nodelist (which is a collection of objects).
... in this case, we return all the selected options' values on the screen: let elems = document.query
selectorall('select option:checked') let values = array.prototype.map.call(elems, function(obj) { return obj.value }) an easier way would be the array.from() method.
<feDisplacementMap> - SVG: Scalable Vector Graphics
xc(x,y) and yc(x,y) are the component values of the channel designated by xchannel
selector and ychannel
selector.
... usage context categoriesfilter primitive elementpermitted contentany number of the following elements, in any order:<animate>, <set> attributes global attributes core attributes presentation attributes filter primitive attributes class style specific attributes in in2 scale xchannel
selector ychannel
selector dom interface this element implements the svgfedisplacementmapelement interface.
... example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of '<fedisplacementmap>' in that specification.
Elements - Archive of obsolete content
only immediate children are matched against the
selector.
... for example, an xml fragment <customelement><foobar><hoge/></foobar></customelement> with an binding definition <binding id="customelement"><content><xul:box><children includes="hoge"/></xul:box></content></binding> for the customelement element, <xul:box/> becomes empty because the
selector includes="hoge" doesn't match for the immediate child foobar element.
gestalt - Archive of obsolete content
method of install object syntax int gestalt ( string
selector ); parameters the gestalt method takes the following parameters:
selector the
selector code for the information you want.
...the format depends on the select code specified in the
selector parameter.
Using Firebug and jQuery (Screencast) - Archive of obsolete content
related links: firebug firefox extension jquery javascript library jquery
selector documentation digg learning jquery: jquerify bookmarklet if you wish to use greasemonkey instead of a bookmarklet, then by all means, please do so.
... more tips: here are some more jquery
selectors that you can use on a digg post: $("li.c-bury > div").remove(); - remove all buried comments, but none of the direct replies.
::-ms-track - Archive of obsolete content
applying the color property within the ::-ms-track
selector affects the tick marks inside the track area.
... allowable properties only the following css properties can be used in a rule with ::-ms-track in its
selector.
Audio for Web games - Game development
const trackels = document.query
selectorall('li'); we want to make sure each file has loaded and been decoded into a buffer before we use it, so let's create an async function to allow us to do this: async function getfile(filepath) { const response = await fetch(filepath); const arraybuffer = await response.arraybuffer(); const audiobuffer = await audioctx.decodeaudiodata(arraybuffer); return audiobuffer; } we can then use...
...{ tracksource.start(); offset = audioctx.currenttime; } else { tracksource.start(0, audioctx.currenttime - offset); } return tracksource; } finally, let's loop over our <li> elements, grab the correct file for each one and then allow playback by hiding the "loading" text and displaying the play button: trackels.foreach((el, i) => { // get children const anchor = el.query
selector('a'); const loadtext = el.query
selector('p'); const playbutton = el.query
selector('button'); // load file loadfile(anchor.href).then((track) => { // set loading to false el.dataset.loading = 'false'; // hide loading text loadtext.style.display = 'none'; // show button playbutton.style.display = 'inline-block'; // allow play on click playbutton.addevent...
Images, media, and form elements - Learn web development
we are using attribute
selectors to target the different input types.
... previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
The box model - Learn web development
add display: inline-block to the rule with the .links-list a
selector, and you will see how it fixes this issue by causing the padding to be respected by other elements.
... previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Legacy layout methods - Learn web development
update the second css rule (with the .wrapper
selector) as follows: body { width: 90%; max-width: 980px; margin: 0 auto; } .wrapper { padding-right: 2.08333333%; } not only have we given it a percentage width, we have also added a max-width property in order to stop the layout becoming too wide.
... next, update the fourth css rule (with the .col
selector) like so: .col { float: left; margin-left: 2.08333333%; width: 6.25%; background: rgb(255, 150, 150); } now comes the slightly more laborious part — we need to update all our .col.span rules to use percentages rather than pixel widths.
Use CSS to solve common problems - Learn web development
common use cases basics how to apply css to the dom how to use whitespace in css how to write comments in css how to select elements via element name, class or id how to select elements via attribute name and content how to use pseudo-classes how to use pseudo-elements how to apply multiple
selectors to the same rule how to specify colors in css how to debug css in the browser css and text how to style text how to customize a list of elements how to style links how to add shadows to text boxes and layouts how to size css boxes how to control overflowing content how to control the part of a css box that the background is drawn under how do i define inline, block, and inlin...
... general how to calculate specificity of a css
selector how to control inheritance in css advanced effects how to use filters in css how to use blend modes in css layout using css flexible boxes using css multi-column layouts using css generated content ...
Client-side form validation - Learn web development
const form = document.getelementsbytagname('form')[0]; const email = document.getelementbyid('mail'); const emailerror = document.query
selector('#mail + span.error'); email.addeventlistener('input', function (event) { // each time the user types something, we check if the // form fields are valid.
...> <span class="error" aria-live="polite"></span> </label> </p> <!-- some legacy browsers need to have the `type` attribute explicitly set to `submit` on the `button`element --> <button type="submit">submit</button> </form> similarly, the css doesn't need to change very much; we've just turned the :invalid css pseudo-class into a real class and avoided using the attribute
selector that doesn't work on internet explorer 6.
Example 3 - Learn web development
kground: #000; color: #ffffff; } javascript content // ------- // // helpers // // ------- // nodelist.prototype.foreach = function (callback) { array.prototype.foreach.call(this, callback); } // -------------------- // // function definitions // // -------------------- // function deactivateselect(select) { if (!select.classlist.contains('active')) return; var optlist = select.query
selector('.optlist'); optlist.classlist.add('hidden'); select.classlist.remove('active'); } function activeselect(select, selectlist) { if (select.classlist.contains('active')) return; selectlist.foreach(deactivateselect); select.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.query
selector('.optlist'); optlist.classlist.toggle('hidden'); } funct...
...ion highlightoption(select, option) { var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; // ------------- // // event binding // // ------------- // window.addeventlistener("load", function () { var form = document.query
selector('form'); form.classlist.remove("no-widget"); form.classlist.add("widget"); }); window.addeventlistener('load', function () { var selectlist = document.query
selectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.query
selectorall('.option'); optionlist.foreach(function (option) { option.addeventlistener('mouseover', function () { highlightoption(select, option); }); ...
Sending forms through JavaScript - Learn web development
let's look at an example: <button>click me!</button> and now the javascript: const btn = document.query
selector('button'); function senddata( data ) { console.log( 'sending data' ); const xhr = new xmlhttprequest(); let urlencodeddata = "", urlencodeddatapairs = [], name; // turn the data object into an array of url-encoded key/value pairs.
...now for the javascript: const btn = document.query
selector('button'); function senddata( data ) { const xhr = new xmlhttprequest(), fd = new formdata(); // push our data into our formdata object for( name in data ) { fd.append( name, data[ name ] ); } // define what happens on successful data submission xhr.addeventlistener( 'load', function( event ) { alert( 'yeah!
UI pseudo-classes - Learn web development
more recently, the css
selector level 3 and css basic ui level 3 added more pseudo-classes related to html forms that provide several other useful targetting conditions that you can take advantage of.
...toggle the disabling of the billing address fields: // wait for the page to finish loading document.addeventlistener('domcontentloaded', function () { // attach `change` event listener to checkbox document.getelementbyid('billing-checkbox').addeventlistener('change', togglebilling); }, false); function togglebilling() { // select the billing text fields let billingitems = document.query
selectorall('#billing input[type="text"]'); // select the billing text labels let billinglabels = document.query
selectorall('.billing-label'); // toggle the billing text fields and labels for (let i = 0; i < billingitems.length; i++) { billingitems[i].disabled = !billingitems[i].disabled; if(billinglabels[i].getattribute('class') === 'billing-label disabled-label') { billinglabels[...
Images in HTML - Learn web development
ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.query
selector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
HTML table basics - Learn web development
these exist because it can be a bit annoying and inefficient having to specify styling on columns — you generally have to specify your styling information on every <td> or <th> in the column, or use a complex
selector such as :nth-child().
...to set other properties you'll have to either style every <td> or <th> in the column, or use a complex
selector such as :nth-child().
Cooperative asynchronous JavaScript: Timeouts and intervals - Learn web development
const spinner = document.query
selector('div'); let rotatecount = 0; let starttime = null; let raf; below the previous code, insert a draw() function that will be used to contain our animation code, which includes the timestamp parameter: function draw(timestamp) { } inside draw(), add the following lines.
... inside the empty <script> element on your page, start by adding the following lines of code that define some constants and variables you'll need in the rest of the code: const spinner = document.query
selector('.spinner p'); const spinnercontainer = document.query
selector('.spinner'); let rotatecount = 0; let starttime = null; let raf; const btn = document.query
selector('button'); const result = document.query
selector('.result'); in order, these are: a reference to the spinner, so you can animate it.
Video and Audio APIs - Learn web development
next we use generated content to display an icon on each button: we use the ::before
selector to display the content before each <button> element.
... at the top of this file, insert the following code: const media = document.query
selector('video'); const controls = document.query
selector('.controls'); const play = document.query
selector('.play'); const stop = document.query
selector('.stop'); const rwd = document.query
selector('.rwd'); const fwd = document.query
selector('.fwd'); const timerwrapper = document.query
selector('.timer'); const timer = document.query
selector('.timer span'); const timerbar = document.query
selector('.tim...
Setting up your own test automation environment - Learn web development
for example, to select an element by id: const element = driver.findelement(by.id('myelementid')); one of the most useful ways to find an element by css — the by.css method allows you to select an element using a css
selector enter the following at the bottom of your quick_test.js code now: const button = driver.findelement(by.css('button:nth-of-type(1)')); testing your element there are many ways to interact with your web documents and elements on them.
...in general, you should make sure that your tests are: using good locator strategies: when you are interacting with the document, make sure that you use locators and page objects that are unlikely to change — if you have a testable element that you want to perform a test on, make sure that it has a stable id, or position on the page that can be selected using a css
selector, which isn't going to just change with the next site iteration.
Performance
ript or jsm instead load frame scripts on demand bad: // addon.js services.mm.loadframescript("framescript.js", /*delayed:*/ true) // stuff communicating with the framescript // framescript.js function onlyonceinabluemoon() { // we only need this during a total solar eclipse while goat blood rains from the sky sendasyncmessage('my-addon:paragraph-count', {num: content.document.query
selectorall('p').length}) } addmessagelistener("my-addon:request-from-parent", onlyonceinabluemoon) better: // addon.js function ontoolbarbutton(event) { let tabmm = gbrowser.mcurrentbrowser.frameloader.messagemanager; let button = event.target; let callback = (message) => { tabmm.removemessagelistener("my-addon:paragraph-count", callback) decoratebutton(button, message.data.num) } ta...
...bmm.addmessagelistener("my-addon:paragraph-count", callback); tabmm.loadframescript("data:,sendasyncmessage('my-addon:paragraph-count', {num: content.document.query
selectorall('p').length})", false) } function decoratebutton(button, count) { // do stuff with result } this executes the script only when it is needed and only in one tab and allows it to be garbage-collected immediately after execution.
L20n Javascript API
ctx.localize(['hello', 'new'], function(l10n) { var node = document.query
selector('[data-l10n-id=hello]'); node.textcontent = l10n.entities.hello.value; node.classlist.remove('hidden'); }); ctx.registerlocales(defaultlocale: string?, availablelocales: array<string>?) register the default locale of the context instance, as well as all other locales available to the context instance before the language negotiation.
... ctx.localize(['hello', 'about'], function(l10n) { var node = document.query
selector('[data-l10n-id=hello]'); node.textcontent = l10n.entities.hello.value; node.classlist.remove('hidden'); }); the callback becomes bound to the entities on the ids list.
Parser API
interface xmlattribute
selector <: expression { type: "xmlattribute
selector"; attribute: expression; } an e4x attribute
selector expression, i.e., an @ expression.
... xmlattribute
selector(expr[, loc]) expr: customexpression loc: sourcelocation returns: customxml/customexpression callback to produce a custom xml attribute
selector node.
Standard OS Libraries
to call objective-c based api from ctypes, use the following functions in libobjc.dylib: objc_getclass to get class sel_registername to register
selector name objc_msgsend and some variants to send message to class and instance objective-c code can be translated into c code by the following rule: // objective-c code nsevent loc = [nsevent mouselocation]; // pseudo c code nsevent loc = (nspoint)objc_msgsend(objc_getclass("nsevent"), sel_registername("mouselocation")); example: [nsevent mouselocation] comp...
...onents.utils.import("resource://gre/modules/ctypes.jsm"); let objc = ctypes.open(ctypes.libraryname("objc")); let id = ctypes.structtype("objc_object").ptr; let sel = ctypes.structtype("objc_
selector").ptr; let objc_getclass = objc.declare("objc_getclass", ctypes.default_abi, id, ctypes.char.ptr); let sel_registername = objc.declare("sel_registername", ctypes.default_abi, sel, ctypes.char.ptr); let objc_msgsend = objc.declare("objc_msgsend", ctypes.default_abi, id, id, ...
Introduction to DOM Inspector - Firefox Developer Tools
in order to find out what the actual name of the file is being used to provide the search go icon, you can select the css rules viewer from this menu and see the various
selectors and rules that have been applied.
... the rule that applies the search icon to the element uses a class simple
selector and uses a list-style-image property to point to a file in the current theme.
CSS Flexbox Inspector: Examine Flexbox layouts - Firefox Developer Tools
flex container options the flex container section of the layout view looks like this: there are two settings you can change in the flex container section: you can control the color of the overlay by clicking on the small circle next to the
selector.
...each entry displays the item's
selector.
AudioContext.createMediaStreamDestination() - Web APIs
<!doctype html> <html> <head> <title>createmediastreamdestination() demo</title> </head> <body> <h1>createmediastreamdestination() demo</h1> <p>encoding a pure sine wave to an opus file </p> <button>make sine wave</button> <audio controls></audio> <script> var b = document.query
selector("button"); var clicked = false; var chunks = []; var ac = new audiocontext(); var osc = ac.createoscillator(); var dest = ac.createmediastreamdestination(); var mediarecorder = new mediarecorder(dest.stream); osc.connect(dest); b.addeventlistener("click", function(e) { if (!clicked) { mediarecorder.start(); osc.start(0); ...
... var blob = new blob(chunks, { 'type' : 'audio/ogg; codecs=opus' }); document.query
selector("audio").src = url.createobjecturl(blob); }; </script> </body> </html> note: you can view this example live, or study the source code, on github.
AudioTrackList: change event - Web APIs
bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.audiotracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); // changing the value of `enabled` will trigger the `change` event const toggletrackbutton = document.query
selector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.audiotracks[0]; track.enabled = !track.enabled; }); using the onchange event handler property: const videoelement = document.
...query
selector('video'); videoelement.audiotracks.onchange = (event) => { console.log(`'${event.type}' event fired`); }; // changing the value of `enabled` will trigger the `change` event const toggletrackbutton = document.query
selector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.audiotracks[0]; track.enabled = !track.enabled; }); specifications specification status html living standardthe definition of 'change' in that specification.
AudioTrackList.length - Web APIs
example this snippet gets the number of audio tracks in the first <video> element found in the dom by query
selector().
... var videoelem = document.query
selector("video"); var numaudiotracks = 0; if (videoelem.audiotracks) { numaudiotracks = videoelem.audiotracks.length; } note that this sample checks to be sure htmlmediaelement.audiotracks is defined, to avoid failing on browsers without support for audiotrack.
CSS.escape() - Web APIs
the css.escape() static method returns a cssomstring containing the escaped string passed as parameter, mostly for use as part of a css
selector.
... examples basic results css.escape(".foo#bar") // "\.foo\#bar" css.escape("()[]{}") // "\(\)\[\]\{\}" css.escape('--a') // "--a" css.escape(0) // "\30 ", the unicode code point of '0' is 30 css.escape('\0') // "\ufffd", the unicode replacement character in context uses to escape a string for use as part of a
selector, the escape() method can be used: var element = document.query
selector('#' + css.escape(id) + ' > img'); the escape() method can also be used for escaping strings, although it escapes characters that don't strictly need to be escaped: var element = document.query
selector('a[href="#' + css.escape(fragment) + '"]'); specification specification status comment css object ...
CSSPageRule - Web APIs
interface csspagerule : cssrule { attribute domstring
selectortext; readonly attribute cssstyledeclaration style; }; properties as a cssrule, csspagerule also implements the properties of this interface.
... it has the following specific properties: csspagerule.
selectortext represents the text of the page
selector associated with the at-rule.
CSSPseudoElement.type - Web APIs
the type read-only property of the csspseudoelement interface returns the type of the pseudo-element as a string, represented in the form of a css
selector.
... syntax var typeofpseudoelement = csspseudoelement.type; value a cssomstring containing one of the following values: "::before" "::after" "::marker" examples the example below demonstrates the relationship between csspseudoelement.type and element.pseudo(): const myelement = document.query
selector('q'); const my
selector = '::after'; const csspseudoelement = myelement.pseudo(my
selector); const typeofpseudoelement = csspseudoelement.type; console.log(my
selector === typeofpseudoelement); // outputs true specifications specification status comment css pseudo-elements level 4the definition of 'type' in that specification.
CSSPseudoElement - Web APIs
csspseudoelement.type read only returns the pseudo-element
selector as a cssomstring.
... const element = document.query
selector('q'); const csspseudoelement = element.pseudo('::before'); console.log(csspseudoelement.element); // outputs [object htmlquoteelement] console.log(csspseudoelement.type); // outputs '::before' specifications specification status comment css pseudo-elements level 4the definition of 'csspseudoelement' in that specification.
CanvasRenderingContext2D.arc() - Web APIs
const canvas = document.query
selector('canvas'); const ctx = canvas.getcontext('2d'); ctx.beginpath(); ctx.arc(100, 75, 50, 0, 2 * math.pi); ctx.stroke(); result different shapes demonstrated this example draws various shapes to show what is possible with arc().
... html <canvas width="150" height="200"></canvas> javascript const canvas = document.query
selector('canvas'); const ctx = canvas.getcontext('2d'); // draw shapes for (let i = 0; i <= 3; i++) { for (let j = 0; j <= 2; j++) { ctx.beginpath(); let x = 25 + j * 50; // x coordinate let y = 25 + i * 50; // y coordinate let radius = 20; // arc radius let startangle = 0; // starting point on circle let endangle = math.pi + (math.pi * j) / 2; // end point on circle let anticlockwise = i % 2 == 1; // draw anticlockwise ctx.arc(x, y, radius, startangle, endangle, anticlockwise); if (i > 1) { ctx.fill(); } else { ...
Basic animations - Web APIs
tible" content="ie=edge"> <title>nokia 1100:snake..member berries</title> </head> <body> <div class="keypress hide"> <div class="up" onclick="emit(38)">↑</div> <div class="right" onclick="emit(39)">→</div> <div class="left" onclick="emit(37)">←</div> <div class="down" onclick="emit(40)">↓</div> </div> <div class="banner" id="
selector"> <div> time :<span id="time">0</span> </div> <div>lousygames ©</div> <div> score :<span id="score">0</span> </div> <div class="touch off" onclick="touch(this)">touch</div> </div> <canvas id="main"></canvas> </body> <style> body { margin: 0; overflow: hidden; background: #000 } .b...
...anner { text-align: center; color: #fff; background: #3f51b5; line-height: 29px; position: fixed; left: 0; top: 0; right: 0; font-family: monospace; height: 30px; opacity: .4; display: flex; transition: .5s } .banner:hover { opacity: 1 } div#
selector>div { flex-basis: 30% } @keyframes diss { from { opacity: 1 } to { opacity: 0 } } .keypress>div { border: dashed 3px #fff; height: 48%; width: 48%; display: flex; align-content: center; justify-content: center; align-self: center; align-items: center; font-size: -webkit-x...
Using channel messaging - Web APIs
var input = document.getelementbyid('message-input'); var output = document.getelementbyid('message-output'); var button = document.query
selector('button'); var iframe = document.query
selector('iframe'); var channel = new messagechannel(); var port1 = channel.port1; // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for button clicks button.addeventlistener('click', onclick); // listen for messages on port1 port1.onmessage = onmessage; // transfer port2 to the iframe ifram...
... receiving the port and message in the iframe over in the iframe, we have the following javascript: var list = document.query
selector('ul'); var port2; // listen for the initial port transfer message window.addeventlistener('message', initport); // setup the transferred port function initport(e) { port2 = e.ports[0]; port2.onmessage = onmessage; } // handle messages received on port2 function onmessage(e) { var listitem = document.createelement('li'); listitem.textcontent = e.data; list.appendchild(listitem); por...
CustomElementRegistry.whenDefined() - Web APIs
<menu-item>item n</menu-item> </nav-menu> </nav> const container = document.getelementbyid('menu-container'); const placeholder = container.query
selector('.menu-placeholder'); // fetch all the children of menu that are not yet defined.
... const undefinedelements = container.query
selectorall(':not(:defined)'); const promises = [...undefinedelements].map( button => customelements.whendefined(button.localname) ); // wait for all the children to be upgraded, // then remove the placeholder.
DOMTokenList - Web APIs
first, the html: <p class="a b c"></p> now the javascript: let para = document.query
selector("p"); let classes = para.classlist; para.classlist.add("d"); para.textcontent = `paragraph classlist is "${classes}"`; the output looks like this: trimming of whitespace and removal of duplicates methods that modify the domtokenlist (such as domtokenlist.add()) automatically trim any excess whitespace and remove duplicate values from the list.
... for example: <span class=" d d e f"></span> let span = document.query
selector("span"); let classes = span.classlist; span.classlist.add("x"); span.textcontent = `span classlist is "${classes}"`; the output looks like this: specifications specification status comment domthe definition of 'domtokenlist' in that specification.
Document.getElementById() - Web APIs
if you need to get access to an element which doesn't have an id, you can use query
selector() to find the element using any
selector.
... unlike some other element-lookup methods such as document.query
selector() and document.query
selectorall(), getelementbyid() is only available as a method of the global document object, and not available as a method on all element objects in the dom.
Document.getElementsByClassName() - Web APIs
ist of matching elements, *not* the element itself console.log(test); //htmlcollection[1] var testtarget = parentdom.getelementsbyclassname("test")[0]; // the first element, as we wanted console.log(testtarget); //<p class="test">hello world 2</p> </script> </body> </html> multiple classes example document.getelementsbyclassname works very similarly to document.query
selector and document.query
selectorall.
...98%;height:7em"></textarea> javascript // getelementsbyclassname only selects elements that have both given classes var allorangejuicebyclass = document.getelementsbyclassname('orange juice'); var result = "document.getelementsbyclassname('orange juice')"; for (var i=0, len=allorangejuicebyclass.length|0; i<len; i=i+1|0) { result += "\n " + allorangejuicebyclass[i].textcontent; } // query
selector only selects full complete matches var allorangejuicequery = document.query
selectorall('.orange.juice'); result += "\n\ndocument.query
selectorall('.orange.juice')"; for (var i=0, len=allorangejuicequery.length|0; i<len; i=i+1|0) { result += "\n " + allorangejuicequery[i].textcontent; } document.getelementbyid("resultarea").value = result; result specifications specification ...
Document - Web APIs
document.query
selector() returns the first element node within the document, in document order, that matches the specified
selectors.
... document.query
selectorall() returns a list of all the element nodes within the document that match the specified
selectors.
Examples of web and XML development using the DOM - Web APIs
you can access these stylesheets and their rules individually using the stylesheet, style, and cssrule objects, as demonstrated in this example, which prints out all of the style rule
selectors to the console.
... var ss = document.stylesheets; for(var i = 0; i < ss.length; i++) { for(var j = 0; j < ss[i].cssrules.length; j++) { dump( ss[i].cssrules[j].
selectortext + "\n" ); } } for a document with a single stylesheet in which the following three rules are defined: body { background-color: darkblue; } p { font-face: arial; font-size: 10pt; margin-left: .125in; } #lumpy { display: none; } this script outputs the following: body p #lumpy example 5: event propagation this example demonstrates how events fire and are handled in the dom in a very simple way.
Element: compositionend event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.query
selector('input[type="text"]'); inputelement.addeventlistener('compositionend', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="event...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.query
selector('input[type="text"]'); const log = document.query
selector('.event-log-contents'); const clearlog = document.query
selector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.add...
Element: compositionstart event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.query
selector('input[type="text"]'); inputelement.addeventlistener('compositionstart', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="eve...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.query
selector('input[type="text"]'); const log = document.query
selector('.event-log-contents'); const clearlog = document.query
selector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.add...
Element: compositionupdate event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.query
selector('input[type="text"]'); inputelement.addeventlistener('compositionupdate', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="ev...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.query
selector('input[type="text"]'); const log = document.query
selector('.event-log-contents'); const clearlog = document.query
selector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.add...
Element.innerHTML - Web APIs
javascript function log(msg) { var logelem = document.query
selector(".log"); var time = new date(); var timestr = time.tolocaletimestring(); logelem.innerhtml += timestr + ": " + msg + "<br/>"; } log("logging mouse events inside this container..."); the log() function creates the log output by getting the current time from a date object using tolocaletimestring(), and building a string with the timestamp and the message text.
...thod that logs information about mouseevent based events (such as mousedown, click, and mouseenter): function logevent(event) { var msg = "event <strong>" + event.type + "</strong> at <em>" + event.clientx + ", " + event.clienty + "</em>"; log(msg); } then we use this as the event handler for a number of mouse events on the box that contains our log: var boxelem = document.query
selector(".box"); boxelem.addeventlistener("mousedown", logevent); boxelem.addeventlistener("mouseup", logevent); boxelem.addeventlistener("click", logevent); boxelem.addeventlistener("mouseenter", logevent); boxelem.addeventlistener("mouseleave", logevent); html the html is quite simple for our example.
Using Fetch - Web APIs
const formdata = new formdata(); const filefield = document.query
selector('input[type="file"]'); formdata.append('username', 'abc123'); formdata.append('avatar', filefield.files[0]); fetch('https://example.com/profile/avatar', { method: 'put', body: formdata }) .then(response => response.json()) .then(result => { console.log('success:', result); }) .catch(error => { console.error('error:', error); }); uploading multiple files files can be uploaded using an...
... const formdata = new formdata(); const photos = document.query
selector('input[type="file"][multiple]'); formdata.append('title', 'my vegas vacation'); for (let i = 0; i < photos.files.length; i++) { formdata.append('photos', photos.files[i]); } fetch('https://example.com/posts', { method: 'post', body: formdata, }) .then(response => response.json()) .then(result => { console.log('success:', result); }) .catch(error => { console.error('error:', error); }); processing a text file line by line the chunks that are read from a response are not broken neatly at line boundaries and are uint8arrays, not strings.
Using files from web applications - Web APIs
accessing the first selected file using a classical dom
selector: const selectedfile = document.getelementbyid('input').files[0]; accessing selected file(s) on a change event it is also possible (but not mandatory) to access the filelist through the change event.
...this allows us to select all of the images the user has chosen for uploading using document.query
selectorall(), like this: function sendfiles() { const imgs = document.query
selectorall(".obj"); for (let i = 0; i < imgs.length; i++) { new fileupload(imgs[i], imgs[i].file); } } line 2 fetches a nodelist, called imgs, of all the elements in the document with the css class obj.
FileReader.readAsDataURL() - Web APIs
example html <input type="file" onchange="previewfile()"><br> <img src="" height="200" alt="image preview..."> javascript function previewfile() { const preview = document.query
selector('img'); const file = document.query
selector('input[type=file]').files[0]; const reader = new filereader(); reader.addeventlistener("load", function () { // convert image file to base64 string preview.src = reader.result; }, false); if (file) { reader.readasdataurl(file); } } live result example reading multiple files html <input id="browse" type="file" onchange="pr...
...eviewfiles()" multiple> <div id="preview"></div> javascript function previewfiles() { var preview = document.query
selector('#preview'); var files = document.query
selector('input[type=file]').files; function readandpreview(file) { // make sure `file.name` matches our extensions criteria if ( /\.(jpe?g|png|gif)$/i.test(file.name) ) { var reader = new filereader(); reader.addeventlistener("load", function () { var image = new image(); image.height = 100; image.title = file.name; image.src = this.result; preview.appendchild( image ); }, false); reader.readasdataurl(file); } } if (files) { [].foreach.call(files, readandpreview); } } note: the filereader() constructor was not supported by internet e...
Using the Geolocation API - Web APIs
body { padding: 20px; background-color:#ffffc9 } button { margin: .5rem 0; } html <button id = "find-me">show my location</button><br/> <p id = "status"></p> <a id = "map-link" target="_blank"></a> javascript function geofindme() { const status = document.query
selector('#status'); const maplink = document.query
selector('#map-link'); maplink.href = ''; maplink.textcontent = ''; function success(position) { const latitude = position.coords.latitude; const longitude = position.coords.longitude; status.textcontent = ''; maplink.href = `https://www.openstreetmap.org/#map=18/${latitude}/${longitude}`; maplink.textcontent = `latitude: $...
...{latitude} °, longitude: ${longitude} °`; } function error() { status.textcontent = 'unable to retrieve your location'; } if(!navigator.geolocation) { status.textcontent = 'geolocation is not supported by your browser'; } else { status.textcontent = 'locating…'; navigator.geolocation.getcurrentposition(success, error); } } document.query
selector('#find-me').addeventlistener('click', geofindme); result ...
Geolocation API - Web APIs
body { padding: 20px; background-color:#ffffc9 } button { margin: .5rem 0; } html <button id = "find-me">show my location</button><br/> <p id = "status"></p> <a id = "map-link" target="_blank"></a> javascript function geofindme() { const status = document.query
selector('#status'); const maplink = document.query
selector('#map-link'); maplink.href = ''; maplink.textcontent = ''; function success(position) { const latitude = position.coords.latitude; const longitude = position.coords.longitude; status.textcontent = ''; maplink.href = `https://www.openstreetmap.org/#map=18/${latitude}/${longitude}`; maplink.textcontent = `latitude: $...
...{latitude} °, longitude: ${longitude} °`; } function error() { status.textcontent = 'unable to retrieve your location'; } if(!navigator.geolocation) { status.textcontent = 'geolocation is not supported by your browser'; } else { status.textcontent = 'locating…'; navigator.geolocation.getcurrentposition(success, error); } } document.query
selector('#find-me').addeventlistener('click', geofindme); result specifications specification status comment geolocation api recommendation ...
GlobalEventHandlers.onkeypress - Web APIs
html <input> <p id="log"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.onkeypress = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result filter keys with a regular expression this example filters the characters typed into a form field using a regular expression.
... html <label>enter numbers only: <input> </label> javascript function numbersonly(event) { return event.charcode === 0 || /\d/.test(string.fromcharcode(event.charcode)); } const input = document.query
selector('input'); input.onkeypress = numbersonly; // prevent pasting (since pasted content might include non-number characters) input.onpaste = event => false; result capture the typing of a hidden word the following javascript function will do something after the user types the word "exit" in any point of a page.
HTMLContentElement.select - Web APIs
it is a domstring containing a space-separated list of css
selectors that select the content to insert in place of the <content> element.
... syntax object.select = "css
selector css
selector ..."; example // select <h1> elements and elements with class="error" mycontentobject.select = "h1 .error"; specifications this feature is no longer defined by any standards.
HTMLDialogElement: cancel event - Web APIs
bubbles no cancelable yes interface event event handler oncancel examples live example html <dialog class="example-dialog"> <button class="close" type="reset">close</button> </dialog> <button class="open-dialog">open dialog</button> <div class="result"></div> css button, div { margin: .5rem; } js const result = document.query
selector('.result'); const dialog = document.query
selector('.example-dialog'); dialog.addeventlistener('cancel', (event) => { result.textcontent = 'dialog was canceled'; }); const opendialog = document.query
selector('.open-dialog'); opendialog.addeventlistener('click', () => { if (typeof dialog.showmodal === 'function') { dialog.showmodal(); result.textcontent = ''; } else { res...
...ult.textcontent = 'the dialog api is not supported by this browser'; } }); const closebutton = document.query
selector('.close'); closebutton.addeventlistener('click', () => { dialog.close(); }); result specifications specification status html living standardthe definition of 'cancel' in that specification.
HTMLDialogElement: close event - Web APIs
bubbles no cancelable no interface event event handler property onclose examples live example html <dialog class="example-dialog"> <button class="close" type="reset">close</button> </dialog> <button class="open-dialog">open dialog</button> <div class="result"></div> css button, div { margin: .5rem; } js const result = document.query
selector('.result'); const dialog = document.query
selector('.example-dialog'); dialog.addeventlistener('close', (event) => { result.textcontent = 'dialog was closed'; }); const opendialog = document.query
selector('.open-dialog'); opendialog.addeventlistener('click', () => { if (typeof dialog.showmodal === 'function') { dialog.showmodal(); result.textcontent = ''; } else { resul...
...t.textcontent = 'the dialog api is not supported by this browser'; } }); const closebutton = document.query
selector('.close'); closebutton.addeventlistener('click', () => { dialog.close(); }); result specifications specification status html living standardthe definition of 'close' in that specification.
HTMLElement: animationcancel event - Web APIs
const animated = document.query
selector('.animated'); animated.addeventlistener('animationcancel', () => { console.log('animation canceled'); }); animated.style.display = 'none'; the same, but using the onanimationcancel property instead of addeventlistener(): const animated = document.query
selector('.animated'); animated.onanimationcancel = () => { console.log('animation canceled'); }; animated.style.display = 'none'; live e...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.query
selector('p.animation'); const animationeventlog = document.query
selector('.animation-example>.event-log'); const applyanimation = document.query
selector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationitera...
HTMLElement: animationend event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationend examples this example gets an element that's being animated and listens for the animationend event: const animated = document.query
selector('.animated'); animated.addeventlistener('animationend', () => { console.log('animation ended'); }); the same, but using the onanimationend event handler property: const animated = document.query
selector('.animated'); animated.onanimationend = () => { console.log('animation ended'); }; live example html <div class="animation-example"> <div class="container"> <p class="animat...
... height: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { margin-left: 100%; width: 300%; } to { margin-left: 0%; width: 100%; } } js const animation = document.query
selector('p.animation'); const animationeventlog = document.query
selector('.animation-example>.event-log'); const applyanimation = document.query
selector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationitera...
HTMLElement: animationiteration event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationiteration examples this code uses animationiteration to keep track of the number of iterations an animation has completed: const animated = document.query
selector('.animated'); let iterationcount = 0; animated.addeventlistener('animationiteration', () => { iterationcount++; console.log(`animation iteration count: ${iterationcount}`); }); the same, but using the onanimationiteration event handler property: const animated = document.query
selector('.animated'); let iterationcount = 0; animated.onanimationiteration = () => { iterationcount++; con...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.query
selector('p.animation'); const animationeventlog = document.query
selector('.animation-example>.event-log'); const applyanimation = document.query
selector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationitera...
HTMLElement: animationstart event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationstart examples this listens for the animationstart event and logs a message when it is fired: const animated = document.query
selector('.animated'); animated.addeventlistener('animationstart', () => { console.log('animation started'); }); the same, but using onanimationstart: const animated = document.query
selector('.animated'); animated.onanimationstart = () => { console.log('animation started'); }; live example html <div class="animation-example"> <div class="container"> <p class="animation">you chose ...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.query
selector('p.animation'); const animationeventlog = document.query
selector('.animation-example>.event-log'); const applyanimation = document.query
selector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationitera...
HTMLElement: change event - Web APIs
">select one …</option> <option value="chocolate">chocolate</option> <option value="sardine">sardine</option> <option value="vanilla">vanilla</option> </select> </label> <div class="result"></div> body { display: grid; grid-template-areas: "select result"; } select { grid-area: select; } .result { grid-area: result; } javascript const selectelement = document.query
selector('.ice-cream'); selectelement.addeventlistener('change', (event) => { const result = document.query
selector('.result'); result.textcontent = `you like ${event.target.value}`; }); result text input element for some elements, including <input type="text">, the change event doesn't fire until the control loses focus.
... html <input placeholder="enter some text" name="name"/> <p id="log"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.addeventlistener('change', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'change' in that specification.
HTMLElement: transitioncancel event - Web APIs
bubbles yes cancelable no interface transitionevent event handler property globaleventhandlers.ontransitioncancel examples this code gets an element that has a transition defined and adds a listener to the transitioncancel event: const transition = document.query
selector('.transition'); transition.addeventlistener('transitioncancel', () => { console.log('transition canceled'); }); the same, but using the ontransitioncancel property instead of addeventlistener(): const transition = document.query
selector('.transition'); transition.ontransitioncancel = () => { console.log('transition canceled'); }; live example in the following example, we have a simple ...
... const message = document.query
selector('.message'); const el = document.query
selector('.transition'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitioncancel', function() { message.textcontent = 'transitioncancel fired'; }); el.addeventlistener...
HTMLElement: transitionend event - Web APIs
examples this code gets an element that has a transition defined and adds a listener to the transitionend event: const transition = document.query
selector('.transition'); transition.addeventlistener('transitionend', () => { console.log('transition ended'); }); the same, but using the ontransitionend: const transition = document.query
selector('.transition'); transition.ontransitionend = () => { console.log('transition ended'); }; live example in the following example, we have a simple <div> element, styled with a transition that includes a...
... const message = document.query
selector('.message'); const el = document.query
selector('.transition'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitioncancel', function() { message.textcontent = 'transitioncancel fired'; }); el.addeventlistener...
HTMLImageElement.x - Web APIs
let logbox = document.query
selector("pre"); let tbl = document.getelementbyid("userinfo") let log = msg => { logbox.innerhtml += `${msg}<br>`; } let cell = tbl.rows[1].cells[2]; let image = cell.query
selector("img"); log(`image's global x: ${image.x}`); log(`image's global y: ${image.y}`); this uses the <table>'s rows property to get a list of the rows in the table, from which it looks up row 1 (which, being a zero-based inde...
... from there, we can get the <img> element itself from the cell by calling query
selector() on the htmltablecellelement representing that cell.
HTMLImageElement.y - Web APIs
let logbox = document.query
selector("pre"); let tbl = document.getelementbyid("userinfo") let log = msg => { logbox.innerhtml += `${msg}<br>`; } let cell = tbl.rows[1].cells[2]; let image = cell.query
selector("img"); log(`image's global x: ${image.x}`); log(`image's global y: ${image.y}`); this uses the <table>'s rows property to get a list of the rows in the table, from which it looks up row 1 (which, being a zero-based inde...
... from there, we can get the <img> element itself from the cell by calling query
selector() on the htmltablecellelement representing that cell.
HTMLMediaElement: emptied event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('emptied', (event) => { console.log('uh oh.
...did you call load()?'); }); using the onemptied event handler property: const video = document.query
selector('video'); video.onemptied = (event) => { console.log('uh oh.
HTMLMediaElement: loadeddata event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('loadeddata', (event) => { console.log('yay!
... the readystate just increased to ' + 'have_current_data or greater for the first time.'); }); using the onloadeddata event handler property: const video = document.query
selector('video'); video.onloadeddata = (event) => { console.log('yay!
HTMLMediaElement: loadedmetadata event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('loadedmetadata', (event) => { console.log('the duration and dimensions ' + ' of the media and tracks are now known.
... '); }); using the onloadedmetadata event handler property: const video = document.query
selector('video'); video.onloadedmetadata = (event) => { console.log('the duration and dimensions ' + ' of the media and tracks are now known.
HTMLMediaElement: pause event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('pause', (event) => { console.log('the boolean paused property is now true.
... either the ' + 'pause() method was called or the autoplay attribute was toggled.'); }); using the onpause event handler property: const video = document.query
selector('video'); video.onpause = (event) => { console.log('the boolean paused property is now true.
HTMLMediaElement: play event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('play', (event) => { console.log('the boolean paused property is now false.
... either the ' + 'play() method was called or the autoplay attribute was toggled.'); }); using the onplay event handler property: const video = document.query
selector('video'); video.onplay = (event) => { console.log('the boolean paused property is now false.
HTMLMediaElement: timeupdate event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('timeupdate', (event) => { console.log('the currenttime attribute has been updated.
... again.'); }); using the ontimeupdate event handler property: const video = document.query
selector('video'); video.ontimeupdate = (event) => { console.log('the currenttime attribute has been updated.
Key Values - Web APIs
learn how to use these key values in javascript using keyboardevent.key special values | modifier keys | whitespace keys | navigation keys | editing keys | ui keys | device keys | ime and composition keys | function keys | phone keys | multimedia keys | audio control keys | tv control keys | media controller keys | speech recognition keys | document keys | application
selector keys | browser control keys | numeric keypad keys special values values of key which have special meanings other than identifying a specific key or character.
... application
selector keys some keyboards offer special keys for launching or switching to certain common applications.
MediaDevices.getUserMedia() - Web APIs
var constraints = { audio: true, video: { width: 1280, height: 720 } }; navigator.mediadevices.getusermedia(constraints) .then(function(mediastream) { var video = document.query
selector('video'); video.srcobject = mediastream; video.onloadedmetadata = function(e) { video.play(); }; }) .catch(function(err) { console.log(err.name + ": " + err.message); }); // always check for errors at the end.
...w error('getusermedia is not implemented in this browser')); } // otherwise, wrap the call to the old navigator.getusermedia with a promise return new promise(function(resolve, reject) { getusermedia.call(navigator, constraints, resolve, reject); }); } } navigator.mediadevices.getusermedia({ audio: true, video: true }) .then(function(stream) { var video = document.query
selector('video'); // older browsers may not have srcobject if ("srcobject" in video) { video.srcobject = stream; } else { // avoid using this in new browsers, as it is going away.
Using Navigation Timing - Web APIs
for example, to measure the perceived loading time for a page: window.addeventlistener("load", function() { let now = new date().gettime(); let loadingtime = now - performance.timing.navigationstart; document.query
selector(".output").innertext = loadingtime + " ms"; }, false); this code, executed when the load event occurs, subtracts from the current time the time at which the navigation whose timing was recorded began (performance.timing.navigationstart), and outputs that information to the screen by inserting it into an element.
...avigation.type_navigate: output += "navigation"; break; case performancenavigation.type_reload: output += "reload"; break; case performancenavigation.type_back_forward: output += "history"; break; default: output += "unknown"; break; } output += "<br/>redirects: " + performance.navigation.redirectcount; document.query
selector(".output").innerhtml = output; }, false); this amends the previous example by looking at the contents of the performance.navigation object.
Navigator.getUserMedia() - Web APIs
your callback can then assign the stream to the desired object (such as an <audio> or <video> element), as shown in the following example: function(stream) { var video = document.query
selector('video'); video.srcobject = stream; video.onloadedmetadata = function(e) { // do something with the video here.
... navigator.getusermedia = navigator.getusermedia || navigator.webkitgetusermedia || navigator.mozgetusermedia; if (navigator.getusermedia) { navigator.getusermedia({ audio: true, video: { width: 1280, height: 720 } }, function(stream) { var video = document.query
selector('video'); video.srcobject = stream; video.onloadedmetadata = function(e) { video.play(); }; }, function(err) { console.log("the following error occurred: " + err.name); } ); } else { console.log("getusermedia not supported"); } ...
Node.getRootNode() - Web APIs
(see the full source code): <!-- source: https://github.com/jserz/js_piece/blob/master/dom/node/getrootnode()/demo/getrootnode.html --> <div class="js-parent"> <div class="js-child"></div> </div> <div class="js-shadowhost"></div> <script> // works on chrome 54+,opera 41+ var parent = document.query
selector('.js-parent'), child = document.query
selector('.js-child'), shadowhost = document.query
selector('.js-shadowhost'); console.log(parent.getrootnode().nodename); // #document console.log(child.getrootnode().nodename); // #document // create a shadowroot var shadowroot = shadowhost.attachshadow({mode:'open'}); shadowroot.innerhtml = '<style>div{background:#2bb8aa;}</style>' ...
... + '<div class="js-shadowchild">content</div>'; var shadowchild = shadowroot.query
selector('.js-shadowchild'); // the default value of composed is false console.log(shadowchild.getrootnode() === shadowroot); // true console.log(shadowchild.getrootnode({composed:false}) === shadowroot); // true console.log(shadowchild.getrootnode({composed:true}).nodename); // #document </script> specifications specification status comment domthe definition of 'getrootnode()' in that specification.
Request() - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { return response.blob(); }).then(function(response) { var objecturl = url.createobjecturl(response); myimage.src = objecturl; }); in our fetch request with init example (see fetch request init live) we do the same thing except that we pass in an init object when we invoke fetch(): var myimage =...
... document.query
selector('img'); var myheaders = new headers(); myheaders.append('content-type', 'image/jpeg'); var myinit = { method: 'get', headers: myheaders, mode: 'cors', cache: 'default' }; var myrequest = new request('flowers.jpg',myinit); fetch(myrequest).then(function(response) { ...
SVGFEDisplacementMapElement - Web APIs
svgfedisplacementmapelement.xchannel
selector read only an svganimatedenumeration corresponding to the xchannelselect attribute of the given element.
... svgfedisplacementmapelement.ychannel
selector read only an svganimatedenumeration corresponding to the ychannelselect attribute of the given element.
SubtleCrypto.deriveKey() - Web APIs
let encryptbutton = document.query
selector(".ecdh .encrypt-button"); encryptbutton.addeventlistener("click", () => { encrypt(alicessecretkey); }); // bob can use his copy to decrypt the message.
... let decryptbutton = document.query
selector(".ecdh .decrypt-button"); decryptbutton.addeventlistener("click", () => { decrypt(bobssecretkey); }); } pbkdf2 in this example we ask the user for a password, then use it to derive an aes key using pbkdf2, then use the aes key to encrypt a message.
TextTrackList.length - Web APIs
example this snippet gets the number of text tracks in the first media element found in the dom by query
selector().
... var mediaelem = document.query
selector("video, audio"); var numtexttracks = 0; if (mediaelem.texttracks) { numtexttracks = mediaelem.texttracks.length; } note that this sample checks to be sure htmlmediaelement.texttracks is defined, to avoid failing on browsers without support for texttrack.
VideoTrackList: change event - Web APIs
bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.videotracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); // changing the value of `selected` will trigger the `change` event const toggletrackbutton = document.query
selector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.videotracks[0]; track.selected = !track.selected; }); using the onchange event handler property: const videoelement = do...
...cument.query
selector('video'); videoelement.videotracks.onchange = (event) => { console.log(`'${event.type}' event fired`); }; // changing the value of `selected` will trigger the `change` event const toggletrackbutton = document.query
selector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.videotracks[0]; track.selected = !track.selected; }); specifications specification status html living standardthe definition of 'change' in that specification.
VideoTrackList.length - Web APIs
example this snippet gets the number of video tracks in the first <video> element found in the dom by query
selector().
... var videoelem = document.query
selector("video"); var numvideotracks = 0; if (videoelem.videotracks) { numvideotracks = videoelem.videotracks.length; } note that this sample checks to be sure htmlmediaelement.videotracks is defined, to avoid failing on browsers without support for videotrack.
Color masking - Web APIs
: inherit; font-weight : 900; color : white; margin : auto; padding : 0.6em 1.2em; } #red-toggle { background-color : red; } #green-toggle { background-color : green; } #blue-toggle { background-color : blue; } window.addeventlistener("load", function setupanimation (evt) { "use strict" window.removeeventlistener(evt.type, setupanimation, false); var canvas = document.query
selector("canvas"); var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.query
selector("p").innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return; } gl.viewport(0, 0, gl.drawingbufferwidth, gl.drawingbufferheight); var timer = setinterval(drawanimation, 1000); var mask ...
...= [true, true, true]; var redtoggle = document.query
selector("#red-toggle"), greentoggle = document.query
selector("#green-toggle"), bluetoggle = document.query
selector("#blue-toggle"); redtoggle.addeventlistener("click", setcolormask, false); greentoggle.addeventlistener("click", setcolormask, false); bluetoggle.addeventlistener("click", setcolormask, false); function setcolormask(evt) { var index = evt.target === greentoggle && 1 || evt.target === bluetoggle && 2 || 0; mask[index] = !mask[index]; if (mask[index] === true) evt.target.innerhtml="on"; else evt.target.innerhtml="off"; gl.colormask(mask[0], mask[1], mask[2], true); drawanimation(); }; function drawanimation () { var color = getrandomcolor(); gl.clear...
Raining rectangles - Web APIs
"use strict" window.addeventlistener("load", setupanimation, false); var gl, timer, rainingrect, scoredisplay, missesdisplay; function setupanimation (evt) { window.removeeventlistener(evt.type, setupanimation, false); if (!(gl = getrenderingcontext())) return; gl.enable(gl.scissor_test); rainingrect = new rectangle(); timer = settimeout(drawanimation, 17); document.query
selector("canvas") .addeventlistener("click", playerclick, false); var displays = document.query
selectorall("strong"); scoredisplay = displays[0]; missesdisplay = displays[1]; } var score = 0, misses = 0; function drawanimation () { gl.scissor(rainingrect.position[0], rainingrect.position[1], rainingrect.size[0] , rainingrect.size[1]); gl.clear(gl.color_buffer_bit); rainingrect.
...ion = [ randnums[2]*(gl.drawingbufferwidth - rect.size[0]), gl.drawingbufferheight ]; rect.velocity = 1.0 + 6.0*math.random(); rect.color = getrandomvector(); gl.clearcolor(rect.color[0], rect.color[1], rect.color[2], 1.0); function getrandomvector() { return [math.random(), math.random(), math.random()]; } } function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.dr...
Movement, orientation, and motion: A WebXR example - Web APIs
window.addeventlistener("load", onload); function onload() { xrbutton = document.query
selector("#enter-xr"); xrbutton.addeventlistener("click", onxrbuttonclick); projectionmatrixout = document.query
selector("#projection-matrix div"); modelmatrixout = document.query
selector("#model-view-matrix div"); cameramatrixout = document.query
selector("#camera-matrix div"); mousematrixout = document.query
selector("#mouse-matrix div"); if (!navigator.xr || enableforcepolyfill) { conso...
... function sessionstarted(session) { let refspacetype; xrsession = session; xrbutton.innertext = "exit webxr"; xrsession.addeventlistener("end", sessionended); let canvas = document.query
selector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); if (allowmouserotation) { canvas.addeventlistener("pointermove", handlepointermove); canvas.addeventlistener("contextmenu", (event) => { event.preventdefault(); }); } if (allowkeyboardmotion) { document.addeventlistener("keydown", handlekeydown); } shaderprogram = initshaderprogram(gl, vssource, fssourc...
Web Audio API best practices - Web APIs
here is a simple example of creating the context from inside a click event: const button = document.query
selector('button'); button.addeventlistener('click', function() { const audioctx = new audiocontext(); }, false); if however, you create the context outside of a user gesture, its state will be set to suspended and it will need to be started after user interaction.
... const audioctx = new audiocontext(); const button = document.query
selector('button'); button.addeventlistener('click', function() { // check if context is in suspended state (autoplay policy) if (audioctx.state === 'suspended') { audioctx.resume(); } }, false); you might instead be working with an offlineaudiocontext, in which case you can resume the suspended audio context with the startrendering() method.
Example and tutorial: Simple synth keyboard - Web APIs
let keyboard = document.query
selector(".keyboard"); let wavepicker = document.query
selector("select[name='waveform']"); let volumecontrol = document.query
selector("input[name='volume']"); references to elements we'll need access to are obtained: keyboard is the container element into which the keys will be placed.
... notefreq.foreach(function(keys, idx) { let keylist = object.entries(keys); let octaveelem = document.createelement("div"); octaveelem.classname = "octave"; keylist.foreach(function(key) { if (key[0].length == 1) { octaveelem.appendchild(createkey(key[0], idx, key[1])); } }); keyboard.appendchild(octaveelem); }); document.query
selector("div[data-note='b'][data-octave='5']").scrollintoview(false); sineterms = new float32array([0, 0, 1, 0, 1]); cosineterms = new float32array(sineterms.length); customwaveform = audiocontext.createperiodicwave(cosineterms, sineterms); for (i=0; i<9; i++) { osclist[i] = []; } } setup(); the table which maps note names and octaves to their frequenies is created by calling create...
Using the Web Speech API - Web APIs
var diagnostic = document.query
selector('.output'); var bg = document.query
selector('html'); var hints = document.query
selector('.hints'); var colorhtml= ''; colors.foreach(function(v, i, a){ console.log(v, i); colorhtml += '<span style="background-color:' + v + ';"> ' + v + ' </span>'; }); hints.innerhtml = 'tap/click then say a color to change the background color of the app.
... var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('.txt'); var voiceselect = document.query
selector('select'); var pitch = document.query
selector('#pitch'); var pitchvalue = document.query
selector('.pitch-value'); var rate = document.query
selector('#rate'); var ratevalue = document.query
selector('.rate-value'); var voices = []; populating the select element to populate the <select> element with...
Using Web Workers - Web APIs
var ofragm = document.createdocumentfragment(); ofragm.appendchild(document.createtextnode(smsg)); ofragm.appendchild(document.createelement('br')); document.query
selector('#logdisplay').appendchild(ofragm); } </script> <script type="text/js-worker"> // this script won't be parsed by js engines because its mime type is text/js-worker.
... // in the past...: // blob builder existed // ...but now we use blob...: var blob = new blob(array.prototype.map.call(document.query
selectorall('script[type=\'text\/js-worker\']'), function (oscript) { return oscript.textcontent; }),{type: 'text/javascript'}); // creating a new document.worker property containing all our "text/js-worker" scripts.
Window.getDefaultComputedStyle() - Web APIs
<style> h3:after { content: ' rocks!'; } </style> <h3>generated content</h3> <script> var h3 = document.query
selector('h3'), result = getdefaultcomputedstyle(h3, ':after').content; console.log('the generated content is: ', result); // returns 'none' </script> notes the returned value is, in certain known cases, expressly incorrect by deliberate intent.
... in particular, to avoid the so called css history leak security issue, browsers may expressly "lie" about the used value for a link and always return values as if a user has never visited the linked site, and/or limit the styles that can be applied using the :visited pseudo-
selector.
window.location - Web APIs
rty: <!doctype html> <html> <head> <meta charset="utf-8"/> <title>mdn example</title> <script> function shownode (onode) { document.documentelement.scrolltop = onode.offsettop; document.documentelement.scrollleft = onode.offsetleft; } function showbookmark (sbookmark, busehash) { if (arguments.length === 1 || busehash) { location.hash = sbookmark; return; } var obookmark = document.query
selector(sbookmark); if (obookmark) { shownode(obookmark); } } </script> <style> span.intlink { cursor: pointer; color: #0000ff; text-decoration: underline; } </style> </head> <body> <p>lorem ipsum dolor sit amet, consectetur adipiscing elit.
... _itframe++; } function _chkowner () { if (_isbot) { _isbot = false; return; } if (_scrollid > -1) { clearinterval(_scrollid); _scrollid = -1; } } if (window.addeventlistener) { window.addeventlistener("scroll", _chkowner, false); } else if (window.attachevent) { window.attachevent("onscroll", _chkowner); } return function (sbookmark, busehash) { var onode = document.query
selector(sbookmark); _scrolly = document.documentelement.scrolltop; _scrollx = document.documentelement.scrollleft; _bookmark = sbookmark; _usehash = busehash === true; _nodex = onode.offsetleft; _nodey = onode.offsettop; _itframe = 1; if (_scrollid === -1) { _scrollid = setinterval(_next, math.round(nduration / nframes)); } }; })(); specifications specification status...
WindowOrWorkerGlobalScope.fetch() - Web APIs
const myimage = document.query
selector('img'); let myrequest = new request('flowers.jpg'); fetch(myrequest) .then(function(response) { if (!response.ok) { throw new error(`http error!
... status: ${response.status}`); } return response.blob(); }) .then(function(response) { let objecturl = url.createobjecturl(response); myimage.src = objecturl; }); in the fetch with init then request example (see fetch request init live), we do the same thing except that we pass in an init object when we invoke fetch(): const myimage = document.query
selector('img'); let myheaders = new headers(); myheaders.append('content-type', 'image/jpeg'); const myinit = { method: 'get', headers: myheaders, mode: 'cors', cache: 'default' }; let myrequest = new request('flowers.jpg'); fetch(myrequest, myinit).then(function(response) { // ...
ARIA live regions - Accessibility
in english, mars carries a name of the roman god of war, and is often referred to as the "red planet".' } }; function renderplanetinfo(planet) { const planettitle = document.query
selector('#planettitle'); const planetdescription = document.query
selector('#planetdescription'); if (planet in planets_info) { planettitle.textcontent = planets_info[planet].title; planetdescription.textcontent = planets_info[planet].description; } else { planettitle.textcontent = 'no planet selected'; planetdescription.textcontent = 'select a planet to view its description'; } }...
... const renderplanetinfobutton = document.query
selector('#renderplanetinfobutton'); renderplanetinfobutton.addeventlistener('click', event => { const planetsselect = document.query
selector('#planetsselect'); const selectedplanet = planetsselect.options[planetsselect.selectedindex].value; renderplanetinfo(selectedplanet); }); as the user selects a new planet, the information in the live region will be announced.
ARIA: switch role - Accessibility
document.query
selectorall(".switch").foreach(function(theswitch) { theswitch.addeventlistener("click", handleclickevent, false); }); function handleclickevent(evt) { let el = evt.target; if (el.getattribute("aria-checked") == "true") { el.setattribute("aria-checked", "false"); } else { el.setattribute("aria-checked", "true"); } } css the purpose of the css is to establish a look and feel for t...
...ria-checked="false"] :last-child, [role="switch"][aria-checked="true"] :first-child { color: #bbd; } label.switch { font: 16px "open sans", "arial", sans-serif; line-height: 20px; user-select: none; vertical-align: middle; -moz-user-select: none; -ms-user-select: none; -webkit-user-select: none; -o-user-select: none; } the most interesting part is probably the use of attribute
selectors and the :first-child and :last-child pseudo-classes to do all the heavy lifting of changing the appearance of the switch based on whether it's on or off.
ARIA: tab role - Accessibility
window.addeventlistener("domcontentloaded", () => { const tabs = document.query
selectorall('[role="tab"]'); const tablist = document.query
selector('[role="tablist"]'); // add a click event handler to each tab tabs.foreach(tab => { tab.addeventlistener("click", changetabs); }); // enable arrow navigation between tabs in the tab list let tabfocus = 0; tablist.addeventlistener("keydown", e => { // move right if (e.keycode === 39 || e.keycode === 37) { ...
... at the start, move to the end if (tabfocus < 0) { tabfocus = tabs.length - 1; } } tabs[tabfocus].setattribute("tabindex", 0); tabs[tabfocus].focus(); } }); }); function changetabs(e) { const target = e.target; const parent = target.parentnode; const grandparent = parent.parentnode; // remove all current selected tabs parent .query
selectorall('[aria-selected="true"]') .foreach(t => t.setattribute("aria-selected", false)); // set this tab as selected target.setattribute("aria-selected", true); // hide all tab panels grandparent .query
selectorall('[role="tabpanel"]') .foreach(p => p.setattribute("hidden", true)); // show the selected panel grandparent.parentnode .query
selector(`#${target.getattribute("a...
An overview of accessible web applications and widgets - Accessibility
tate of a checkbox or radio button aria-disabled: indicates that an element is visible, but not editable or otherwise operable aria-grabbed: indicates the 'grabbed' state of an object in a drag-and-drop operation (for a full list of aria states, consult the aria list of states and properties.) developers should use aria states to indicate the state of ui widget elements and use css attribute
selectors to alter the visual appearance based on the state changes (rather than using script to change a class name on the element).
...attribute-based
selector for indicating state div.tooltip[aria-hidden="true"] { display: none; } the javascript to update the aria-hidden property has the form shown in example 2c.
-webkit-box-reflect - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
:-moz-only-whitespace - CSS: Cascading Style Sheets
note: in
selectors level 4 the :empty
selector was changed to act like :-moz-only-whitespace, but no browser currently supports this yet.
... examples html <div> </div> css :root { overflow: hidden; max-width: 100vw; max-height: 100vh; } div { background-color: #ccc; box-sizing: border-box; height: 100vh; min-height: 16px; min-height: 1rem; } div { border: 4px solid red; } :-moz-only-whitespace { border-color: lime; } result specifications briefly defined as :blank in
selectors level 4, but then the functionality was merged into :empty and :blank redefined to mean empty <input>.
::after (:after) - CSS: Cascading Style Sheets
we can also support keyboard users with this technique, by adding a tabindex of 0 to make each span keyboard focusable, and using a css :focus
selector.
...
selectors level 3the definition of '::after' in that specification.
::before (:before) - CSS: Cascading Style Sheets
0.5em 0.5em 0.5em 2em; background: lightgrey; font-family: sans-serif; } li.done { background: #ccff99; } li.done::before { content: ''; position: absolute; border-color: #009933; border-style: solid; border-width: 0 0.3em 0.25em 0; height: 1em; top: 1.3em; left: 0.6em; margin-top: -1em; transform: rotate(45deg); width: 0.5em; } javascript var list = document.query
selector('ul'); list.addeventlistener('click', function(ev) { if (ev.target.tagname === 'li') { ev.target.classlist.toggle('done'); } }, false); here is the above code example running live.
...
selectors level 3the definition of '::before' in that specification.
:active - CSS: Cascading Style Sheets
living standard
selectors level 4the definition of ':active' in that specification.
...
selectors level 3the definition of ':active' in that specification.
:any-link - CSS: Cascading Style Sheets
the :any-link css pseudo-class
selector represents an element that acts as the source anchor of a hyperlink, independent of whether it has been visited.
...ny-link examples html <a href="https://example.com">external link</a><br> <a href="#">internal target link</a><br> <a>placeholder link (won't get styled)</a> css a:any-link { border: 1px solid blue; color: orange; } /* webkit browsers */ a:-webkit-any-link { border: 1px solid blue; color: orange; } result specifications specification status comment
selectors level 4the definition of ':any-link' in that specification.
:blank - CSS: Cascading Style Sheets
note: the :blank
selector is considered at risk, as the csswg keeps changing it.
... html <textarea></textarea> css textarea:blank { border: 3px solid red; } result specifications specification status comment
selectors level 4the definition of ':blank' in that specification.
:default - CSS: Cascading Style Sheets
what this
selector matches is defined in html standard §4.16.3 pseudo-classes — it may match the <button>, <input type="checkbox">, <input type="radio">, and <option> elements: a default option element is the first one with the selected attribute, or the first enabled option in dom order.
...
selectors level 4the definition of ':default' in that specification.
:dir() - CSS: Cascading Style Sheets
note: be aware that the behavior of the :dir() pseudo-class is not equivalent to the [dir=…] attribute
selectors.
...
selectors level 4the definition of ':dir()' in that specification.
:focus-within - CSS: Cascading Style Sheets
(this includes descendants in shadow trees.) /* selects a <div> when one of its descendants is focused */ div:focus-within { background: cyan; } this
selector is useful, to take a common example, for highlighting an entire <form> container when the user focuses on one of its <input> fields.
...e">given name:</label> <input id="given_name" type="text"> <br> <label for="family_name">family name:</label> <input id="family_name" type="text"> </form> css form { border: 1px solid; color: gray; padding: 4px; } form:focus-within { background: #ff8; color: black; } input { margin: 4px; } result specifications specification status comment
selectors level 4the definition of ':focus-within' in that specification.
:host - CSS: Cascading Style Sheets
/* selects a shadow root host */ :host { font-weight: bold; } syntax :host examples styling the shadow host the following snippets are taken from our host-
selectors example (see it live also).
... in this example we have a simple custom element — <context-span> — that you can wrap around text: <h1>host
selectors <a href="#"><context-span>example</context-span></a></h1> inside the element's constructor, we create style and span elements, fill the span with the content of the custom element, and fill the style element with some css rules: let style = document.createelement('style'); let span = document.createelement('span'); span.textcontent = this.textcontent; const shadowroot = this.attachshadow({mode: 'open'}); shadowroot.appendchild(style); shadowroot.appendchild(span); style.textcontent = 'span:hover { text-decoration: underline; }' + ':host-context(h1) { font-style: italic; }' + ':host-context(h1):after { content: " - no links in header...
:hover - CSS: Cascading Style Sheets
whatwg html github issues
selectors level 4the definition of ':hover' in that specification.
... css working group drafts github issues
selectors level 3the definition of ':hover' in that specification.
:indeterminate - CSS: Cascading Style Sheets
/* selects any <input> whose state is indeterminate */ input:indeterminate { background: lime; } elements targeted by this
selector are: <input type="checkbox"> elements whose indeterminate property is set to true by javascript <input type="radio"> elements, when all radio buttons with the same name value in the form are unchecked <progress> elements in an indeterminate state syntax :indeterminate examples checkbox & radio button this example applies special styles to the labels associated with indeterminate form f...
...
selectors level 4the definition of ':indeterminate' in that specification.
:lang() - CSS: Cascading Style Sheets
v lang="fr"><q>this french quote has a <q>nested</q> quote inside.</q></div> <div lang="de"><q>this german quote has a <q>nested</q> quote inside.</q></div> css :lang(en) > q { quotes: '\201c' '\201d' '\2018' '\2019'; } :lang(fr) > q { quotes: '« ' ' »'; } :lang(de) > q { quotes: '»' '«' '\2039' '\203a'; } result specifications specification status comment
selectors level 4the definition of ':lang()' in that specification.
...
selectors level 3the definition of ':lang()' in that specification.
:link - CSS: Cascading Style Sheets
living standard
selectors level 4the definition of ':link' in that specification.
...
selectors level 3the definition of ':link' in that specification.
:nth-last-of-type() - CSS: Cascading Style Sheets
examples html <div> <span>this is a span.</span> <span>this is another span.</span> <em>this is emphasized.</em> <span>wow, this span gets limed!!!</span> <strike>this is struck through.</strike> <span>here is one last span.</span> </div> css span:nth-last-of-type(2) { background-color: lime; } result specifications specification status comment
selectors level 4the definition of ':nth-last-of-type' in that specification.
...
selectors level 3the definition of ':nth-last-of-type' in that specification.
:nth-of-type() - CSS: Cascading Style Sheets
hs */ p:nth-of-type(2n+1) { color: red; } /* even paragraphs */ p:nth-of-type(2n) { color: blue; } /* first paragraph */ p:nth-of-type(1) { font-weight: bold; } /* this has no effect, as the .fancy class is only on the 4th p element, not the 1st */ p.fancy:nth-of-type(1) { text-decoration: underline; } result specifications specification status comment
selectors level 4the definition of ':nth-of-type' in that specification.
...
selectors level 3the definition of ':nth-of-type' in that specification.
:read-only - CSS: Cascading Style Sheets
input:-moz-read-only, textarea:-moz-read-only, input:read-only, textarea:read-only { border: 0; box-shadow: none; background-color: white; } textarea:-moz-read-write, textarea:read-write { box-shadow: inset 1px 1px 3px #ccc; border-radius: 5px; } you can find the full source code at readonly-confirmation.html; this renders like so: styling read-only non-form controls this
selector doesn't just select <input>/<textarea> elements — it will select any element that cannot be edited by the user.
...
selectors level 4the definition of ':read-only' in that specification.
:read-write - CSS: Cascading Style Sheets
input:-moz-read-only, textarea:-moz-read-only, input:read-only, textarea:read-only { border: 0; box-shadow: none; background-color: white; } textarea:-moz-read-write, textarea:read-write { box-shadow: inset 1px 1px 3px #ccc; border-radius: 5px; } you can find the full source code at readonly-confirmation.html; this renders like so: styling read-write non-form controls this
selector doesn't just select <input>/<textarea> elements — it will select any element that can be edited by the user, such as a <p> element with contenteditable set on it.
...
selectors level 4the definition of ':read-write' in that specification.
:state() - CSS: Cascading Style Sheets
examples fill in a simple example that nicely shows a typical usage of the
selector, then perhaps some more complex examples.
... my code block and/or include a list of links to useful code samples that live elsewhere: x y z specifications specification status comment unknownthe definition of 'the :state()
selector' in that specification.
additive-symbols - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
negative - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
pad - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
prefix - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
suffix - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
symbols - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
@keyframes - CSS: Cascading Style Sheets
each @keyframes rule contains a style list of keyframe
selectors, which specify percentages along the animation when the keyframe occurs, and a block containing the styles for that keyframe.
...to { margin-top: 100px; } } @keyframes important2 { from { margin-top: 50px; margin-bottom: 100px; } to { margin-top: 150px !important; /* ignored */ margin-bottom: 50px; } } formal syntax @keyframes <keyframes-name> { <keyframe-block-list> }where <keyframes-name> = <custom-ident> | <string><keyframe-block-list> = <keyframe-block>+where <keyframe-block> = <keyframe-
selector># { <declaration-list> }where <keyframe-
selector> = from | to | <percentage> examples css animation examples see using css animations for examples.
CSS Animations tips and tricks - CSS: Cascading Style Sheets
function play() { document.query
selector(".box").classname = "box"; window.requestanimationframe(function(time) { window.requestanimationframe(function(time) { document.query
selector(".box").classname = "box changing"; }); }); } this looks weird, doesn't it?
... of course, we also need to add an event handler to our "run" button so it'll actually do something: document.query
selector(".runbutton").addeventlistener("click", play, false); result stopping an animation simply removing the animation-name applied to an element will make it jump or cut to its next state.
Introducing the CSS Cascade - CSS: Cascading Style Sheets
that means rules whose
selector matches the given element and which are part of an appropriate media at-rule.
... so three declarations are in competition: margin-left: 0 margin-left: 3px margin-left: 1px the last one is ignored (on a screen), and the first two have the same
selector, hence the same specificity.
Breadcrumb Navigation - CSS: Cascading Style Sheets
recipe download this example note: the example above uses two
selectors to insert content before every li except the first one.
... this could also be achieved using one
selector only: .breadcrumb li:not(:first-child)::before { content: "→"; } this solution uses a more complex
selector, but requires less rules.
Using CSS custom properties (variables) - CSS: Cascading Style Sheets
like any other property, this is written inside a ruleset, like so: element { --main-bg-color: brown; } note that the
selector given to the ruleset defines the scope that the custom property can be used in.
...the property is only set for the matching
selector and its descendants, like any normal css.
background-image - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
background - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
border-image-source - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
content - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<leader-type> = dotted | solid | space | <string>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
cross-fade() - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)where <image-tags> = ltr | rtl<image-src> = <url> | <string><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><linear-gradient()> = linear-gradient( [ <angle> | to <side-or-corner> ]?
mask-border-source - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
mask-image - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
mask - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...nt()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()><box> = border-box | padding-box | content-boxwhere <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
shape-outside - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-
selector> )<paint()> = paint( <ident>, <declaration-value>?
...| [ [ left | right ] <length-percentage> ] && [ [ top | bottom ] <length-percentage> ] ]<fill-rule> = nonzero | evenodd<image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-
selector> = <hash-token><cf-mixing-image> = <percentage>?
transition-timing-function - CSS: Cascading Style Sheets
m: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration: 7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration: 2s; } function updatetransition() { var els = document.query
selectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .ease { transition-timing-function: ease; } .easein { transition-timing-function: ease-in; } .easeout { transition-timing-function: ease-out; } .easeinout { transition-timing-function: ease-in-out; } .l...
...tom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration:7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration:2s; } function updatetransition() { var els = document.query
selectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .jump-start { transition-timing-function: steps(5, jump-start); } .jump-end { transition-timing-function: steps(5, jump-end); } .jump-none { transition-timing-function: steps(5, jump-none); } .jump-both { ...
Creating and triggering events - Developer guides
elem.dispatchevent(event); event bubbling it is often desirable to trigger an event from a child element, and have an ancestor catch it; optionally, with data: <form> <textarea></textarea> </form> const form = document.query
selector('form'); const textarea = document.query
selector('textarea'); // create a new event, allow bubbling, and provide any data you want to pass to the "detail" property const eventawesome = new customevent('awesome', { bubbles: true, detail: { text: () => textarea.value } }); // the form element listens for the custom "awesome" event and then consoles the output of the passed text() method form.
...ail.text())); // as the user types, the textarea inside the form dispatches/triggers the event to fire, and uses itself as the starting point textarea.addeventlistener('input', e => e.target.dispatchevent(eventawesome)); creating and dispatching events dynamically elements can listen for events that haven't been created yet: <form> <textarea></textarea> </form> const form = document.query
selector('form'); const textarea = document.query
selector('textarea'); form.addeventlistener('awesome', e => console.log(e.detail.text())); textarea.addeventlistener('input', function() { // create and dispatch/trigger an event on the fly // note: optionally, we've also leveraged the "function expression" (instead of the "arrow function expression") so "this" will represent the element this.dispat...
DOM onevent handlers - Developer guides
you can specify an on<…> event handler for a particular event (such as click) for a given object in different ways: adding an html attribute named on<eventtype>: <button onclick="handleclick()">, or by setting the corresponding property from javascript: document.query
selector("button").onclick = function(event) { … }.
... let logelement = document.query
selector('div'); let el = document.query
selector("a"); function log(msg) { logelement.innerhtml += `${msg}<br>` }; function anchoronclick(event) { log("changed onclick handler") }; // original handler log(`element's onclick as a javascript property: <code> ${el.onclick.tostring()} </code>`); //changing handler using .onclick log('<br>changing onclick handler using <strong> onclick property </strong> ')...
<a>: The Anchor element - HTML: Hypertext Markup Language
<a href="" download="my_painting.png">download my painting</a> </p> <canvas width="300" height="300"></canvas> css html { font-family: sans-serif; } canvas { background: #fff; border: 1px dashed; } a { display: inline-block; background: #69c; color: #fff; padding: 5px 10px; } javascript var canvas = document.query
selector('canvas'), c = canvas.getcontext('2d'); c.fillstyle = 'hotpink'; function draw(x, y) { if (isdrawing) { c.beginpath(); c.arc(x, y, 10, 0, math.pi*2); c.closepath(); c.fill(); } } canvas.addeventlistener('mousemove', event => draw(event.offsetx, event.offsety) ); canvas.addeventlistener('mousedown', () => isdrawing = true); canvas.addeventlistener('mouseup', () => isdra...
...wing = false); document.query
selector('a').addeventlistener('click', event => event.target.href = canvas.todataurl() ); result security and privacy <a> elements can have consequences for users’ security and privacy.
<input type="checkbox"> - HTML: Hypertext Markup Language
var overall = document.query
selector('input[id="enchtbl"]'); var ingredients = document.query
selectorall('ul input'); overall.addeventlistener('click', function(e) { e.preventdefault(); }); for(var i = 0; i < ingredients.length; i++) { ingredients[i].addeventlistener('click', updatedisplay); } function updatedisplay() { var checkedcount = 0; for(var i = 0; i < ingredients.length; i++) { if(ingred...
...ther"> </div> <div> <button type="submit">submit form</button> </div> </fieldset> </form> css html { font-family: sans-serif; } form { width: 600px; margin: 0 auto; } div { margin-bottom: 10px; } fieldset { background: cyan; border: 5px solid blue; } legend { padding: 10px; background: blue; color: cyan; } javascript var othercheckbox = document.query
selector('input[value="other"]'); var othertext = document.query
selector('input[id="othervalue"]'); othertext.style.visibility = 'hidden'; othercheckbox.addeventlistener('change', () => { if(othercheckbox.checked) { othertext.style.visibility = 'visible'; othertext.value = ''; } else { othertext.style.visibility = 'hidden'; } }); specifications specification status co...
<input type="date"> - HTML: Hypertext Markup Language
for example: var datecontrol = document.query
selector('input[type="date"]'); datecontrol.value = '2017-06-01'; console.log(datecontrol.value); // prints "2017-06-01" console.log(datecontrol.valueasnumber); // prints 1496275200000, a unix timestamp this code finds the first <input> element whose type is date, and sets its value to 2017-06-01 (june 1st, 2017).
... // define variables var nativepicker = document.query
selector('.nativedatepicker'); var fallbackpicker = document.query
selector('.fallbackdatepicker'); var fallbacklabel = document.query
selector('.fallbacklabel'); var yearselect = document.query
selector('#year'); var monthselect = document.query
selector('#month'); var dayselect = document.query
selector('#day'); // hide fallback initially fallbackpicker.style.display = 'none'; fallbacklabel.style.display =...
<input type="datetime-local"> - HTML: Hypertext Markup Language
you can also get and set the date value in javascript using the htmlinputelement.value property, for example: var datecontrol = document.query
selector('input[type="datetime-local"]'); datecontrol.value = '2017-06-01t08:30'; there are several methods provided by javascript's date that can be used to convert numeric date information into a properly-formatted string, or you can do it manually.
... // define variables var nativepicker = document.query
selector('.nativedatetimepicker'); var fallbackpicker = document.query
selector('.fallbackdatetimepicker'); var fallbacklabel = document.query
selector('.fallbacklabel'); var yearselect = document.query
selector('#year'); var monthselect = document.query
selector('#month'); var dayselect = document.query
selector('#day'); var hourselect = document.query
selector('#hour'); var minuteselect = document.queryselec...
<input type="file"> - HTML: Hypertext Markup Language
notes you cannot set the value of a file picker from a script — doing something like the following has no effect: const input = document.query
selector("input[type=file]"); input.value = "foo"; when a file is chosen using an <input type="file">, the real path to the source file is not shown in the input's value attribute for obvious security reasons.
... const input = document.query
selector('input'); const preview = document.query
selector('.preview'); input.style.opacity = 0; note: opacity is used to hide the file input instead of visibility: hidden or display: none, because assistive technology interprets the latter two styles to mean the file input isn't interactive.
<input type="month"> - HTML: Hypertext Markup Language
you can also get and set the date value in javascript using the htmlinputelement.value property, for example: <label for="bday-month">what month were you born in?</label> <input id="bday-month" type="month" name="bday-month" value="2017-06"> var monthcontrol = document.query
selector('input[type="month"]'); monthcontrol.value = '1978-06'; additional attributes in addition to the attributes common to <input> elements, month inputs offer the following attributes: attribute description list the id of the <datalist> element that contains the optional pre-defined autocomplete options max the latest year and month to accept as a valid i...
... // define variables var nativepicker = document.query
selector('.nativedatepicker'); var fallbackpicker = document.query
selector('.fallbackdatepicker'); var fallbacklabel = document.query
selector('.fallbacklabel'); var yearselect = document.query
selector('#year'); var monthselect = document.query
selector('#month'); // hide fallback initially fallbackpicker.style.display = 'none'; fallbacklabel.style.display = 'none'; // test whether a new date input falls...
<input type="number"> - HTML: Hypertext Markup Language
xample, to adjust the width of the input to be only as wide as is needed to enter a three-digit number, we can change our html to include an id and to shorten our placeholder since the field will be too narrow for the text we have been using so far: <input type="number" placeholder="x10" step="10" min="0" max="100" id="number"> then we add some css to narrow the width of the element with the id
selector #number: #number { width: 3em; } the result looks like this: offering suggested values you can provide a list of default options from which the user can select by specifying the list attribute, which contains as its value the id of a <datalist>, which in turn contains one <option> element per suggested value.
... div { margin-bottom: 10px; position: relative; } input[type="number"] { width: 100px; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5px; } and finally, the javascript: let metersinputgroup = document.query
selector('.metersinputgroup'); let feetinputgroup = document.query
selector('.feetinputgroup'); let metersinput = document.query
selector('#meters'); let feetinput = document.query
selector('#feet'); let inchesinput = document.query
selector('#inches'); let switchbtn = document.query
selector('input[type="button"]'); switchbtn.addeventlistener('click', function() { if(switchbtn.getattribute('class') === 'me...
<input type="time"> - HTML: Hypertext Markup Language
et a default value for the input by including a valid time in the value attribute when creating the <input> element, like so: <label for="appt-time">choose an appointment time: </label> <input id="appt-time" type="time" name="appt-time" value="13:30"> you can also get and set the date value in javascript using the htmlinputelement.value property, for example: var timecontrol = document.query
selector('input[type="time"]'); timecontrol.value = '15:30'; time value format the value of the time input is always in 24-hour format that includes leading zeros: hh:mm, regardless of the input format, which is likely to be selected based on the user's locale (or by the user agent).
... // define variables var nativepicker = document.query
selector('.nativetimepicker'); var fallbackpicker = document.query
selector('.fallbacktimepicker'); var fallbacklabel = document.query
selector('.fallbacklabel'); var hourselect = document.query
selector('#hour'); var minuteselect = document.query
selector('#minute'); // hide fallback initially fallbackpicker.style.display = 'none'; fallbacklabel.style.display = 'none'; // test whether a new date input fal...
<input type="week"> - HTML: Hypertext Markup Language
you can also get and set the value in javascript using the input element's value property, for example: var weekcontrol = document.query
selector('input[type="week"]'); weekcontrol.value = '2017-w45'; additional attributes in addition to the attributes common to <input> elements, week inputs offer the following attributes: attribute description max the latest year and week to accept as valid input min the earliest year and week to accept as valid input readonly a boolean which, if pres...
... // define variables var nativepicker = document.query
selector('.nativeweekpicker'); var fallbackpicker = document.query
selector('.fallbackweekpicker'); var fallbacklabel = document.query
selector('.fallbacklabel'); var yearselect = document.query
selector('#year'); var weekselect = document.query
selector('#fallbackweek'); // hide fallback initially fallbackpicker.style.display = 'none'; fallbacklabel.style.display = 'none'; // test whether a new date input...
<template>: The Content Template element - HTML: Hypertext Markup Language
if ('content' in document.createelement('template')) { // instantiate the table with the existing html tbody // and the row with the template var tbody = document.query
selector("tbody"); var template = document.query
selector('#productrow'); // clone the new row and insert it into the table var clone = template.content.clonenode(true); var td = clone.query
selectorall("td"); td[0].textcontent = "1235646565"; td[1].textcontent = "stuff"; tbody.appendchild(clone); // clone the new row and insert it into the table var clone2 = template.
...content.clonenode(true); td = clone2.query
selectorall("td"); td[0].textcontent = "0384928528"; td[1].textcontent = "acme kidney beans 2"; tbody.appendchild(clone2); } else { // find another way to add the rows to the table because // the html template element is not supported.
Critical rendering path - Web Performance
in terms of
selector performance, less specific
selectors are faster than more specific ones.
...when it comes to css,
selector performance optimization, improvements will only be in microseconds.
SVG documentation index - SVG: Scalable Vector Graphics
255 xchannel
selector filters, needsexample, svg, svg attribute the xchannel
selector attribute indicates which color channel from in2 to use to displace the pixels in in along the x-axis.
... 267 ychannel
selector filters, svg, svg attribute the ychannel
selector attribute indicates which color channel from in2 to use to displace the pixels in in along the y-axis.
Web Components
:host(): selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the
selector given as the function's parameter matches the shadow host.
... :host-context(): selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the
selector given as the function's parameter matches the shadow host's ancestor(s) in the place it sits inside the dom hierarchy.
Index - XPath
found 57 pages: # page tags and summary 1 xpath css
selectors, dom, jxon, landing, path, xml, xpath, xslt xpath stands for xml path language.
... 16 comparison of css
selectors and xpath css, draft, needscontent, reference,
selectors, xpath this article seeks to document the difference between css
selectors and xpath for web developers to be able to better choose the right tool for the right job.
XPath
xpath is mainly used in xslt, but can also be used as a much more powerful way of navigating through the dom of any xml-like language document using xpathexpression, such as html and svg, instead of relying on the document.getelementbyid() or parentnode.query
selectorall() methods, the node.childnodes properties, and other dom core features.
... related topics xslt, xquery, xml, dom, jxon, jsonpath comparison of css
selectors and xpath ...
Content Scripts - Archive of obsolete content
+ ' window.alert("the context menu was clicked on url:\\n" + href);' + '};' + 'window.addeventlistener("myaddonid-contextmenu-clicked",' + ' function(event){contextmenualert(event.detail);});' }); let cm = require("sdk/context-menu"); cm.item({ label: "alert url", context: [ cm.urlcontext(["*.mozilla.org"]), cm.
selectorcontext("a[href]") ], contentscript: 'self.on("click", function (node, data) {' + ' var event = new customevent("myaddonid-contextmenu-clicked",' + ' {detail:node.href});' + ' window.dispatchevent(event);' + '});' }); cross-domain content scripts by default, content scripts don't have...
page-worker - Archive of obsolete content
for example, this add-on loads a page from wikipedia, and runs a content script in it to send all the headers back to the main add-on code: var pageworkers = require("sdk/page-worker"); // this content script sends header titles from the page to the add-on: var script = "var elements = document.query
selectorall('h2 > span'); " + "for (var i = 0; i < elements.length; i++) { " + " postmessage(elements[i].textcontent) " + "}"; // create a page worker that loads wikipedia: pageworkers.page({ contenturl: "http://en.wikipedia.org/wiki/internet", contentscript: script, contentscriptwhen: "ready", onmessage: function(message) { console.log(message); } })...
Setting up an extension development environment - Archive of obsolete content
for example, rather than having content myextension jar:chrome/myextension.jar!/content/ use content myextension chrome/content/ preventing the first launch extension
selector requires gecko 8.0(firefox 8.0 / thunderbird 8.0 / seamonkey 2.5) starting in firefox 8, on the first launch of a new version of firefox, it presents user interface letting users select which third party add-ons to keep.
Index of archived content - Archive of obsolete content
javascript timers javascript daemons management label and description lookupnamespaceuri lookupprefix miscellaneous modules on page load page loading post data to window preferences progress listeners query
selector rosetta running applications svg animation svg general scrollbar sidebar stringview tabbox toolbar tree uri parsing view source for xul applications windows xml-related code snippets xml:ba...
XBL 1.0 Reference - Archive of obsolete content
he nsidomdocumentxbl interface anonymous content introduction scoping and access using the dom content generation rules for generation attribute forwarding insertion points <children> handling dom changes event flow and targeting flow and targeting across scopes focus and blur events mouseover and mouseout events anonymous content and css
selectors and scopes binding stylesheets binding implementations introduction methods properties inheritance of implementations event handlers example - sticky notes updated and adjusted for the current firefox implementation.
XML in Mozilla - Archive of obsolete content
see also e4x xquery code snippets for query
selector - useful techniques for navigating dom using css
selectors on xml dom documents (firefox 3.5 only) identifying xml elements and documents parsing and serializing xml ...
findbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata close() return type: no return value closes the notification or findbar and removes it from its enclosing notificationbox or findbar.
Introduction to XUL - Archive of obsolete content
interface xulelement : element { nodelist getelementsbyattribute(in domstring name, in domstring value); }; getelementsbyattribute functions as does its namesake in xuldocument, though this version returns only those elements which match the criteria and are descendants (in css
selector terminology) of the given element.
textbox (Toolkit autocomplete) - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata getsearchat( index ) return type: string returns the search component with the given index.
Textbox (XPFE autocomplete) - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata addsession( session ) obsolete since gecko 26 return type: nsiautocompletesession adds a new session object to the autocomplete widget.
Complete - Archive of obsolete content
the css stylesheet uses the corresponding
selector #all-custom-1 to provide the appropriate image: button-1.png file structure in the new file structure, there is a skin directory for all the themes.
Using the standard theme - Archive of obsolete content
meaning, some internal default will be applied, which does by no means correspond to the standard theme (the theme currently chosen by the user in the theme
selector), or even the default theme delivered with your the base application.
action - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
arrowscrollbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
assign - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
bbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
binding - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related tbd ...
bindings - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related tbd ...
box - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements vbox, hbox ...
broadcaster - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
broadcasterset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
browser - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata addprogresslistener( listener ) return type: no return value add a progress listener to the browser which will monitor loaded documents.
button - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider, nsidomxulbuttonelement ...
caption - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements groupbox, checkbox ...
checkbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider, nsidomxulcheckboxelement ...
colorpicker - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsidomxulcontrolelement bugs the onchange event only fires if attribute type is set to "button".
column - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, rows, row ...
columns - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, column, rows, row.
command - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related xul:list of commands ...
commandset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
conditions - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
content - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata relacionados tbd ...
datepicker - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsidomxulcontrolelement ...
deck - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related stack ...
description - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes header a class used for headings.
dialog - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata acceptdialog() return type: no return value accepts the dialog and closes it, similar to pressing the ok button.
dialogheader - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements dialog, window ...
dropmarker - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
editor - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
grid - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements columns, column, rows, row.
grippy - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
groupbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
hbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements box, vbox ...
iframe - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related nsiaccessibleprovider ...
image - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes alert-icon class that adds an alert icon.
key - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata details on key, keycode, and modifiers attributes for example, consider the following key: <key key="r" modifiers="shift"/> this key will only match when the shif...
keyset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
label - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
listbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata additemtoselection( item ) return type: no return value selects the given item, without deselecting any other items that are already selected.
listcell - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes listcell-iconic use this class to have an image appear on the listcell.
listcol - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcols, listhead, listheader, listitem ...
listcols - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listhead, listheader, listitem ...
listhead - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listcols, listheader, listitem ...
listheader - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listcols, listhead, listitem ...
listitem - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
member - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
menu - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appenditem( label, value ) return type: element creates a new item and adds it to the end of the existing list of items.
menubar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements menu, menuitem, menulist, menupopup, menuseparator interfaces nsiaccessibleprovider ...
menuitem - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes menuitem-iconic use this class to have an image appear on the menuitem.
menulist - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appenditem( label, value, description ) return type: element creates a new menuitem element and adds it to the end of the menulist.
menupopup - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
menuseparator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements menu, menubar, menuitem, menulist, menupopup interfaces nsiaccessibleprovider, nsidomxulcontaineritemelement, nsidomxulselectcontrolitemelem...
notification - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata close() return type: no return value closes the notification or findbar and removes it from its enclosing notificationbox or findbar.
notificationbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appendnotification( label , value , image , priority , buttons, eventcallback ) return type: element create a new notification and display it.
observes - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
page - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
panel - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
param - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
popupset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements popup, menupopup ...
preference - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata events change when a preference value changes, an onchange/change event is fired on the <preference> element.
preferences - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related preferences system documentation: introduction: getting started | examples | troubleshooting reference: prefwindow | prefpane | preferences | prefe...
prefpane - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata events paneload this event is fired on the pane element when the pane is fully loaded (e.g.
prefwindow - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata acceptdialog() return type: no return value accepts the dialog and closes it, similar to pressing the ok button.
progressmeter - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
query - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
queryset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
radio - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements radiogroup, checkbox interfaces nsiaccessibleprovider, nsidomxulselectcontrolitemelement, nsidomxullabeledcontrolelement ...
radiogroup - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appenditem( label, value ) return type: element creates a new item and adds it to the end of the existing list of items.
resizer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
richlistbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata additemtoselection( item ) return type: no return value selects the given item, without deselecting any other items that are already selected.
richlistitem - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider, nsidomxulselectcontrolitemelement ...
row - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, column, rows.
rows - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, column, row.
rule - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scale - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata decrease() return type: no return value decreases the value of the scale or number box by the increment.
script - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scrollbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scrollbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scrollcorner - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
separator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
spacer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements separator, splitter ...
spinbuttons - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
splitter - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
stack - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related deck ...
statusbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements statusbarpanel interfaces nsiaccessibleprovider ...
<statusbarpanel> - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
stringbundle - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related xul property files ...
stringbundleset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
tab - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata notes note: prior to gecko 1.9, disabling tabs fails; even while disabled, they still accept events.
tabbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tabs, tab, tabpanels, tabpanel.
tabbrowser - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata addprogresslistener( listener ) return type: no return value add a progress listener to the browser which will monitor loaded documents.
tabpanel - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tabbox, tabs, tab, tabpanels.
tabpanels - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tabbox, tabs, tab, tabpanel.
tabs - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata advanceselectedtab( dir, wrap ) return type: no return value if the argument dir is set to 1, the currently selected tab changes to the next tab.
template - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
textbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
textnode - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
timepicker - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsidomxulcontrolelement ...
titlebar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
toolbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes chromeclass-toolbar when this class is used, the toolbar will be hidden when a window is opened by setting the toolbar option to no in the...
toolbarbutton - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox interfaces ...
toolbargrippy - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox interfaces nsiacces...
toolbaritem - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox ...
toolbarpalette - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox ...
toolbarseparator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarset, toolbarspacer, toolbarspring, toolbox ...
toolbarset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarspacer, toolbox ...
toolbarspacer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspring, toolbox interfaces nsiacces...
toolbarspring - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbox inter...
toolbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appendcustomtoolbar( name, currentset ) firefox only return type: element adds a custom toolbar to the toolbox with the given name.
tooltip - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
tree - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata startediting( row, column ) return type: no return value activates user editing of the given cell, which is specified by row index number and the nsitreecolumn in ...
treecell - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treerow and treeseparator.
treechildren - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata example <tree flex="1"> <treecols> <treecol id="sender" label="sender" flex="1"/> <treecol id="subject" label="subject" flex="2"/> </treecols> <treec...
treecol - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following class may be used to style the element.
treecols - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecol, treechildren, treeitem, treerow, treecell and treeseparator.
treeitem - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treerow, treecell and treeseparator.
treerow - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treecell and treeseparator.
treeseparator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treerow and treecell.
triple - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
vbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements box, hbox ...
where - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
window - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata see also: dom window object methods note the error message "xml parsing error: undefined entity...<window" can be caused by a missing or unreachable dtd file refer...
wizard - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata « xul reference home advance( pageid ) return type: no return value call this method to go to the next page.
wizardpage - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), query
selector(), query
selectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related wizard ...
Property (CSS) - MDN Web Docs Glossary: Definitions of Web-related terms
here's an example of a css rule: /* "div" is a
selector indicating that all the div elements */ /* in the document will be styled by that rule */ div { /* the property "color" with the value "black" indicates */ /* that the text will have the color black */ color: black; /* the property "background-color" with the value "white" indicates */ /* that the background color of the elements will be white */ background-color: white; } learn more general knowledge learn css technical reference the css reference on mdn the css working group current work ...
MDN Web Docs Glossary: Definitions of Web-related terms
ol) and srtp (secure rtp) rtsp: real-time streaming protocol ruby s safe same-origin policy scm scope screen reader script-supporting element scroll container scrollport sctp sdp search engine second-level domain secure sockets layer (ssl)
selector (css) self-executing anonymous function semantics seo serialization server server timing session hijacking sgml shadow tree shim signature signature (functions) signature (security) simd simple header simple response header sisd site ...
Accessible multimedia - Learn web development
we will first need to store references to each of the controls — add the following to the top of your javascript file: const playpausebtn = document.query
selector('.playpause'); const stopbtn = document.query
selector('.stop'); const rwdbtn = document.query
selector('.rwd'); const fwdbtn = document.query
selector('.fwd'); const timelabel = document.query
selector('.time'); next, we need to grab a reference to the video/audio player itself — add this line below the previous lines: const player = document.query
selector('video'); this holds a reference to a ...
Backgrounds and borders - Learn web development
previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Handling different text directions - Learn web development
previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Overflowing content - Learn web development
previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Sizing items in CSS - Learn web development
previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
CSS values and units - Learn web development
previous overview: building blocks next in this module cascade and inheritance css
selectors type, class, and id
selectors attribute
selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Using your new knowledge - Learn web development
font-family color border-bottom font-weight font-size text-decoration i have used a mixture of
selectors, styling elements such as h1 and h2, but also creating a class for the job title and styling that.
What is CSS? - Learn web development
for example "i want the main heading on my page to be shown as large red text." the following code shows a very simple css rule that would achieve the styling described above: h1 { color: red; font-size: 5em; } the rule opens with a
selector .
Fundamental text and font styling - Learn web development
id="code" class="css-input" style="width: 90%;height: 10em;padding: 10px;border: 1px solid #0095dd;"> p { } </textarea> <h2>output</h2> <div class="output" style="width: 90%;height: 10em;padding: 10px;border: 1px solid #0095dd;"></div> <div class="controls"> <input id="reset" type="button" value="reset" style="margin: 10px 10px 0 0;"> </div> </div> const htmlinput = document.query
selector(".html-input"); const cssinput = document.query
selector(".css-input"); const reset = document.getelementbyid("reset"); let htmlcode = htmlinput.value; let csscode = cssinput.value; const output = document.query
selector(".output"); const styleelem = document.createelement('style'); const headelem = document.query
selector('head'); headelem.appendchild(styleelem); function drawoutput() { output.
Styling lists - Learn web development
d;"></textarea> <h2>output</h2> <div class="output" style="width: 90%;height: 12em;padding: 10px;border: 1px solid #0095dd;overflow: auto;"></div> <div class="controls"> <input id="reset" type="button" value="reset" style="margin: 10px 10px 0 0;"> <input id="solution" type="button" value="show solution" style="margin: 10px 0 0 10px;"> </div> </div> var htmlinput = document.query
selector(".html-input"); var cssinput = document.query
selector(".css-input"); var reset = document.getelementbyid("reset"); var htmlcode = htmlinput.value; var csscode = cssinput.value; var output = document.query
selector(".output"); var solution = document.getelementbyid("solution"); var styleelem = document.createelement('style'); var headelem = document.query
selector('head'); headelem.appendchild(styl...
The HTML5 input types - Learn web development
to actually display the current value, and update it as it changed, you must use javascript, but this is relatively easy to do: const price = document.query
selector('#price'); const output = document.query
selector('.price-output'); output.textcontent = price.value; price.addeventlistener('input', function() { output.textcontent = price.value; }); here we store references to the range input and the output in two variables.
HTML forms in legacy browsers - Learn web development
mycolor" name="color"> </label> supported not supported form buttons there are two ways to define buttons within html forms: the <input> element with its attribute type set to the values button, submit, reset or image the <button> element <input> the <input> element can make things a little difficult if you want to apply some css by using the element
selector: <input type="button" value="click me"> if we remove the border on all inputs, can we restore the default appearance on input buttons only?
Example 2 - Learn web development
m; box-shadow: 0 .2em .4em rgba(0,0,0,.4); -moz-box-sizing : border-box; box-sizing : border-box; min-width : 100%; max-height: 10em; /* 100px */ overflow-y: auto; overflow-x: hidden; } .select .option { padding: .2em .3em; } .select .highlight { background: #000; color: #ffffff; } javascript content window.addeventlistener("load", function () { var form = document.query
selector('form'); form.classlist.remove("no-widget"); form.classlist.add("widget"); }); result for js no js html content <form class="no-widget"> <select name="myfruit"> <option>cherry</option> <option>lemon</option> <option>banana</option> <option>strawberry</option> <option>apple</option> </select> <div class="select"> <span class="value">cherry</span> ...
Styling web forms - Learn web development
as well as the basic css tools covered above, we've also been provided with several
selectors — ui pseudo-classes — that enable styling based on the current state of the ui.
The web and web standards - Learn web development
the following simple javascript will store a reference to our paragraph in memory and change the text inside it: let pelem = document.query
selector('p'); pelem.textcontent = 'we changed the text!'; in the house analogy, javascript is like the cooker, tv, microwave, or hairdryer — the things that give your house useful functionality tooling once you've learned the "raw" technologies that can be used to build web pages (such as html, css, and javascript), you'll soon start to come across various tools that can be used to make your wo...
Adding vector graphics to the Web - Learn web development
" disabled> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.query
selector('.output'); let code = textarea.value; let userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
From object to iframe — other embedding technologies - Learn web development
solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.query
selector('.output'); let code = textarea.value; let userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 's...
Responsive images - Learn web development
note: when testing this with a desktop browser, if the browser fails to load the narrower images when you've got its window set to the narrowest width, have a look at what the viewport is (you can approximate it by going into the browser's javascript console and typing in document.query
selector('html').clientwidth).
Video and audio content - Learn web development
for example, you can watch for the addtrack event being fired on the associated audiotracklist object (retrieved via htmlmediaelement.audiotracks) to be informed when audio tracks are added to the media: const mediaelem = document.query
selector("video"); mediaelem.audiotracks.onaddtrack = function(event) { audiotrackadded(event.track); } you'll find more information about this in our trackevent documentation.
Choosing the right approach - Learn web development
single delayed operation repeating operation multiple sequential operations multiple simultaneous operations no yes no (unless it is the same one) no code example a simple animated spinner; you can find this example live on github (see the source code also): const spinner = document.query
selector('div'); let rotatecount = 0; let starttime = null; let raf; function draw(timestamp) { if(!starttime) { starttime = timestamp; } rotatecount = (timestamp - starttime) / 3; if(rotatecount > 359) { rotatecount %= 360; } spinner.style.transform = 'rotate(' + rotatecount + 'deg)'; raf = requestanimationframe(draw); } draw(); pitfalls you can't cho...
General asynchronous programming concepts - Learn web development
in our simple-sync.html example (see it running live), we add a click event listener to a button so that when clicked, it runs a time-consuming operation (calculates 10 million dates then logs the final one to the console) and then adds a paragraph to the dom: const btn = document.query
selector('button'); btn.addeventlistener('click', () => { let mydate; for(let i = 0; i < 10000000; i++) { let date = new date(); mydate = date } console.log(mydate); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; document.body.appendchild(pelem); }); when running the example, open your javascript console then click the button — y...
Introducing asynchronous JavaScript - Learn web development
let's look at a simple example (see it live here, and see the source): const btn = document.query
selector('button'); btn.addeventlistener('click', () => { alert('you clicked me!'); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; document.body.appendchild(pelem); }); in this block, the lines are executed one after the other: we grab a reference to a <button> element that is already available in the dom.
Functions — reusable blocks of code - Learn web development
you generally use an anonymous function along with an event handler, for example the following would run the code inside the function whenever the associated button is clicked: const mybutton = document.query
selector('button'); mybutton.onclick = function() { alert('hello'); } the above example would require there to be a <button> element available on the page to select and click.
Client-side storage - Learn web development
add the following lines to your javascript file: // create needed constants const rememberdiv = document.query
selector('.remember'); const forgetdiv = document.query
selector('.forget'); const form = document.query
selector('form'); const nameinput = document.query
selector('#entername'); const submitbtn = document.query
selector('#submitname'); const forgetbtn = document.query
selector('#forgetname'); const h1 = document.query
selector('h1'); const personalgreeting = document.query
selector('.personal-greeting'); ...
Drawing graphics - Learn web development
now add the following lines of javascript inside the <script> element: const canvas = document.query
selector('.mycanvas'); const width = canvas.width = window.innerwidth; const height = canvas.height = window.innerheight; here we have stored a reference to the canvas in the canvas constant.
Fetching data from the server - Learn web development
const versechoose = document.query
selector('select'); const poemdisplay = document.query
selector('pre'); versechoose.onchange = function() { const verse = versechoose.value; updatedisplay(verse); }; let's define our updatedisplay() function.
Basic math in JavaScript — numbers and operators - Learn web development
for now, let's look at a quick example: <button>start machine</button> <p>the machine is stopped.</p> const btn = document.query
selector('button'); const txt = document.query
selector('p'); btn.addeventlistener('click', updatebtn); function updatebtn() { if (btn.textcontent === 'start machine') { btn.textcontent = 'stop machine'; txt.textcontent = 'the machine has started!'; } else { btn.textcontent = 'start machine'; txt.textcontent = 'the machine is stopped.'; } } open in new window you can see the equ...
Silly story generator - Learn web development
the following for example turns the background of the <html> element red — so the entire browser window should go red if the javascript is applied properly: document.query
selector('html').style.backgroundcolor = 'red'; math.round() is a built-in javascript method that simply rounds the result of a calculation to the nearest whole number.
HTMLIFrameElement.getContentDimensions()
examples var browser = document.query
selector('iframe'); var request = browser.getcontentdimensions(); request.onsuccess = function() { console.log("page size:", request.result.width + "x" + request.result.height); } request.onerror = function() { console.log("download error"); } specification not part of any specification.
HTMLIFrameElement.getManifest()
examples var browser = document.query
selector('iframe'); browser.addeventlistener('mozbrowserloadend',function() { var request = browser.getmanifest().then(function(json) { console.log(json); }); }); specification not part of any specification.
HTMLIFrameElement.getMuted()
example callback version: var browser = document.query
selector('iframe'); var request = browser.getmuted(); request.onsuccess = function() { if(request.result) { console.log('the browser is muted.'); } else { console.log('the browser is unmuted.'); } } promise version: var browser = document.query
selector('iframe'); browser.getmuted().then(function(muted) { if(muted) { console.log('the browser is muted.'); } else { console.log...
HTMLIFrameElement.getScreenshot()
examples var browser = document.query
selector('iframe'); var request = browser.getscreenshot(100, 100); request.onsuccess = function() { var blob = request.result; var url = url.createobjecturl(blob); } specification not part of any specification.
HTMLIFrameElement.getStructuredData()
examples var browser = document.query
selector('iframe'); browser.addeventlistener('mozbrowserloadend',function() { var request = browser.getstructureddata(); request.onsuccess = function() { console.log(request.result); } }); running this code in a browser api app and then loading up a page that contains microdata (such as the website of british alt-country band salter cane) will result in a json object being returned, along the l...
HTMLIFrameElement.getVisible()
example var browser = document.query
selector('iframe'); var request = browser.getvisible(); request.onsuccess = function() { console.log('the visible state is: ' + this.result ?
HTMLIFrameElement.getVolume()
example callback version: var browser = document.query
selector('iframe'); var request = browser.getvolume(); request.onsuccess = function() { console.log('the current browser volume is ' + request.result); } promise version: var browser = document.query
selector('iframe'); browser.getvolume().then(function(volume) { console.log('the current browser volume is ' + volume); }); specification not part of any specification.
mozbrowseractivitydone
examples var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowseractivitydone", function(event) { if(event.details.success) { console.log('activity completed successfully'); } else { console.log('activity not completed successfully'); } }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchang...
mozbrowserasyncscroll
examples var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserasyncscroll", function( event ) { console.log("the scroll top position of the document is:" + event.details.top + "px"); }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowserti...
mozbrowseraudioplaybackchange
examples var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowseraudioplaybackchange", function(event) { console.log(event.details); }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsertitlechange mozbrowserusernameandpasswordrequired ...
mozbrowsercaretstatechanged
examples var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsercaretstatechanged", function( event ) { // do stuff with event.details }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsertitlechange mozbrowserusernameandpasswordrequired ...
mozbrowserclose
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserclose", function() { console.log("browser window has been closed; iframe will be destroyed."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbr...
mozbrowsercontextmenu
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsercontextmenu", function(event) { console.log("asking for menu:" + json.stringify(event.details)); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowse...
mozbrowserdocumentfirstpaint
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserdocumentfirstpaint", function() { console.log("first content painted."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozb...
mozbrowsererror
re netinterrupt nettimeout cspblocked phishingblocked malwareblocked unwantedblocked offline malformeduri redirectloop unknownsockettype netreset notcached isprinting deniedportaccess proxyresolvefailure proxyconnectfailure contentencodingfailure remotexul unsafecontenttype corruptedcontenterror certerror other example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsererror", function( event ) { console.log("an error occurred:" + event.detail); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange ...
mozbrowserfindchange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserfindchange", function(event) { console.log("currently highlighted: " + event.details.activematchordinal + " out of " + event.details.numberofmatches); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowser...
mozbrowserfirstpaint
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserfirstpaint", function(event) { console.log("first content painted."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozbrow...
mozbrowsericonchange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsericonchange", function( event ) { console.log("the url of the new favicon is:" + event.details.href); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozb...
mozbrowserloadend
var browser = document.query
selector("iframe"); browser.addeventlistener('mozbrowserloadend',function(e) { stopreload.textcontent = 'r'; console.log(e.detail.backgroundcolor); controls.style.background = e.detail.backgroundcolor; }); browser.addeventlistener('mozbrowserloadend',function() { stopreload.textcontent = 'r'; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror m...
mozbrowserloadstart
var browser = document.query
selector("iframe"); browser.addeventlistener('mozbrowserloadstart',function() { stopreload.textcontent = 'x'; }); browser.addeventlistener('mozbrowserloadend',function() { stopreload.textcontent = 'r'; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserlocationchange mozbrowseropenwindow mozbrows...
mozbrowserlocationchange
var browser = document.query
selector("iframe"); browser.addeventlistener('mozbrowserlocationchange', function (event) { urlbar.value = event.detail.url; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozbrowserusernam...
mozbrowsermanifestchange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsermanifestchange", function(event) { console.log("new manifest url: " + event.details.href); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowse...
mozbrowsermetachange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsermetachange", function(event) { console.log("a meta tag has been " + event.details.type + ".
mozbrowseropensearch
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowseropensearch", function( event ) { console.log("new search engine encountered: " + event.details.title); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrow...
mozbrowseropentab
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowseropentab", function( event ) { console.log("a new document has opened containing the content at " + event.details.url + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozbrow...
mozbrowseropenwindow
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowseropenwindow", function( event ) { console.log("a new window has opened containing the content at " + event.details.url + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozbro...
mozbrowserresize
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserresize", function( event ) { console.log("the new window size is " + event.details.width + " x " + event.details.height + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozb...
mozbrowserscroll
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserscroll", function( event ) { console.log("the new scroll position is " + event.details.left + " across and " + event.details.top + "down."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange moz...
mozbrowserscrollareachanged
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserscrollareachanged", function( event ) { console.log("the new scroll area is " + event.details.width + " x " + event.details.height + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbr...
mozbrowserscrollviewchange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserscrollviewchange", function( event ) { console.log("scrolling has " + event.details.state + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozbrowsertitlechange mozbrowseru...
mozbrowsersecuritychange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsersecuritychange", function( event ) { console.log("the ssl state is:" + event.details.state); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsertitlechange mozbrowserusernamean...
mozbrowserselectionstatechanged
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowserselectionstatechanged", function( event ) { if(event.details.visible) { console.log("the current selection is visible."); } else { console.log("the current selection is not visible."); } }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbro...
mozbrowsershowmodalprompt
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsershowmodalprompt", function( event ) { console.log("asking for prompt:" + json.stringify(event.detail)); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbro...
mozbrowsertitlechange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowsertitlechange", function( event ) { console.log("the title of the document is:" + event.detail); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowm...
mozbrowserusernameandpasswordrequired
example var browser = document.query
selector("iframe[mozbrowser]"); browser.addeventlistener("mozbrowserusernameandpasswordrequired", function( event ) { console.log("the auth realm is:" + event.detail.realm); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecurity...
mozbrowservisibilitychange
example var browser = document.query
selector("iframe"); browser.addeventlistener("mozbrowservisibilitychange", function( event ) { if(event.details.visible) { console.log("the browser is visible."); } else { console.log("the browser is hidden."); } }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocat...
HTMLIFrameElement.mute()
example var browser = document.query
selector('iframe'); browser.mute(); specification not in a specification.
HTMLIFrameElement.purgeHistory()
examples domrequest: var browser = document.query
selector('iframe'); var request = browser.purgehistory(); request.onsuccess = function() { console.log('history deleted!'); } request.onerror = function() { console.error(this.error.name); } promise: var browser = document.query
selector('iframe'); browser.purgehistory().then(function() { console.log('history deleted!'); }, function(error) { console.error(this.error.name); }); specification...
HTMLIframeElement.removeNextPaintListener()
examples var browser = document.query
selector('iframe'); function onnextpaint() { console.log("paint has occured"); } browser.addnextpaintlistener(onnextpaint); browser.removenextpaintlistener(onnextpaint); specification not part of any specification.
HTMLIFrameElement.sendMouseEvent()
examples var browser = document.query
selector('iframe'); browser.sendmouseevent("mousemove", x, y, 0, 0, 0); browser.sendmouseevent("mousedown", x, y, 0, 1, 0); browser.sendmouseevent("mouseup", x, y, 0, 1, 0); specification not part of any specification.
HTMLIFrameElement.sendTouchEvent()
examples var browser = document.query
selector('iframe'); browser.sendtouchevent("touchstart", [1], [x], [y], [2], [2], [20], [0.5], 1, 0); specification not part of any specification.
HTMLIFrameElement.setActive()
example var browser = document.query
selector('iframe'); browser.setactive(); specification not part of any specification.
HTMLIFrameElement.setVisible()
examples var browser = document.query
selector('iframe'); browser.setvisible(true); specification not part of any specification.
HTMLIFrameElement.setVolume()
example var browser = document.query
selector('iframe'); browser.setvolume(0.5); specification not part of any specification.
HTMLIFrameElement.unmute()
example var browser = document.query
selector('iframe'); browser.unmute(); specification not part of any specification.
HTMLIFrameElement.zoom()
examples var browser = document.query
selector('iframe'); var zoomfactor = 1; zoomin.addeventlistener('touchend',function() { zoomfactor += 0.1; browser.zoom(zoomfactor); }); zoomout.addeventlistener('touchend',function() { zoomfactor -= 0.1; browser.zoom(zoomfactor); }); specification not part of any specification.
overflow-clip-box-block
opqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box-block: padding-box; } javascript function scrollsomeelements() { var elms = document.query
selectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
overflow-clip-box-inline
pqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box-inline: padding-box; } javascript function scrollsomeelements() { var elms = document.query
selectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
overflow-clip-box
abcdefghijklmnopqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box: padding-box; } js function scrollsomeelements() { var elms = document.query
selectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
Getting from Content to Layout
the frame constructor takes these notifications and does the following: dispatches "restyle events" which trigger the reprocessing of relevant css
selectors and any restyling that needs to occur.
PopupNotifications.jsm
this is normally specified in css using list-style-image and the .popup-notification-icon[popupid=...]
selector.
TimerFirings logging
_shot): [content] http://widgets.outbrain.com/outbrain.js:20:330 186 fn timer (one_shot): nsbrowserstatusfilter::timeouthandler 138 fn timer (one_shot): [content] https://self-repair.mozilla.org/repair/:7:13669 118 fn timer (one_shot): [content] http://a.visualrevenue.com/vrs.js:6:9423 108 fn timer (slack): layeractivitytracker 104 fn timer (slack): nsidocument::
selectorcache 104 fn timer (slack): cctimerfired ...
NSS_3.12.3_release_notes.html
bug 394077: libpkix need to return revocation status of a cert bug 412468: modify certutil bug 417092: modify pkix_cert
selector api to return an error if cert was rejected.
nsIDOMWindowUtils
getpropertyvalue(apropertyname) except that, when the link whose presence in history is allowed to influence aelement's style is visited, get the value the property would have if allowed all properties to change as a result of :visited
selectors (except for cases where getcomputedstyle uses data from the frame).
Use SQLite
storage of 2mb: var db = opendatabase('mydb', '1.0', 'test db', 2 * 1024 * 1024); var msg; db.transaction(function (tx) { tx.executesql('create table if not exists logs (id unique, log)'); tx.executesql('insert into logs (id, log) values (1, "foobar")'); tx.executesql('insert into logs (id, log) values (2, "logmsg")'); msg = '<p>log message created and row inserted.</p>'; document.query
selector('#status').innerhtml = msg; }); db.transaction(function (tx) { tx.executesql('select * from logs', [], function (tx, results) { var len = results.rows.length, i; msg = "<p>found rows: " + len + "</p>"; document.query
selector('#status').innerhtml += msg; for (i = 0; i < len; i++){ msg = "<p><b>" + results.rows.item(i).log + "</b></p>"; document.query
selector('#status').i...
Browser Console - Firefox Developer Tools
this example here makes it so that when you mouse over the "clear" button it will clear the browser console: components.utils.import("resource://devtools/shared/loader.jsm"); var hudservice = devtools.require("devtools/client/webconsole/hudservice"); var hud = hudservice.getbrowserconsole(); var clearbtn = hud.chromewindow.document.query
selector('.webconsole-clear-console-button'); clearbtn.addeventlistener('mouseover', function() { hud.jsterm.clearoutput(true); }, false); bonus features available for add-on sdk add-ons, the console api is available automatically.
AbortController.AbortController() - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.query
selector('.download'); var abortbtn = document.query
selector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController.abort() - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.query
selector('.download'); var abortbtn = document.query
selector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController.signal - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.query
selector('.download'); var abortbtn = document.query
selector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.query
selector('.download'); var abortbtn = document.query
selector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortSignal - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.query
selector('.download'); var abortbtn = document.query
selector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
Ambient Light Events - Web APIs
example if ('ondevicelight' in window) { window.addeventlistener('devicelight', function(event) { var body = document.query
selector('body'); if (event.value < 50) { body.classlist.add('darklight'); body.classlist.remove('brightlight'); } else { body.classlist.add('brightlight'); body.classlist.remove('darklight'); } }); } else { console.log('devicelight event not supported'); } specifications specification status comment ambient light sensorthe definition ...
Animation.commitStyles() - Web APIs
examples const divelem = document.query
selector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); }); specifications specification status comment web animationsthe definition of 'commitstyles()' in that specification.
Animation.onremove - Web APIs
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.query
selector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and a...
Animation.persist() - Web APIs
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.query
selector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and a...
Animation.replaceState - Web APIs
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.query
selector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and a...
Animation.updatePlaybackRate() - Web APIs
examples a speed
selector component would benefit from smooth updating of updateplaybackrate(), as demonstrated below: speed
selector.addeventlistener('input', evt => { cartoon.updateplaybackrate(parsefloat(evt.target.value)); cartoon.ready.then(() => { console.log(`playback rate set to ${cartoon.playbackrate}`); }); }); specifications specification status comment web animationsthe def...
Attr.localName - Web APIs
html content <button id="example">click me</button> javascript content const element = document.query
selector("#example"); element.addeventlistener("click", function() { const attribute = element.attributes[0]; alert(attribute.localname); }); notes the local name of an attribute is the part of the attribute's qualified name that comes after the colon.
AudioBuffer.getChannelData() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var button = document.query
selector('button'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; // stereo var channels = 2; // create an empty two second stereo buffer at the // sample rate of the audiocontext var framecount = audioctx.samplerate * 2.0; var myarraybuffer = audioctx.createbuffer(2, framecount, audioctx.samplerate); button.onclick = func...
AudioContext.createMediaElementSource() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and he...
AudioContext.createMediaStreamSource() - Web APIs
var pre = document.query
selector('pre'); var video = document.query
selector('video'); var myscript = document.query
selector('script'); var range = document.query
selector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audio:...
AudioListener.dopplerFactor - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.forwardX - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.forwardY - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.forwardZ - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.positionX - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.positionY - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.positionZ - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.setOrientation() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.setPosition() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.speedOfSound - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.upX - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.upY - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener.upZ - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioListener - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
AudioParam.exponentialRampToValueAtTime() - Web APIs
this is pretty useful for fade in/fade out effects: // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; var exprampplus = document.query
selector('.exp-ramp-plus'); var exprampminus = document.query
selector('.exp-ramp-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // ...
AudioParam.linearRampToValueAtTime() - Web APIs
// create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; var linearrampplus = document.query
selector('.linear-ramp-plus'); var linearrampminus = document.query
selector('.linear-ramp-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(my...
AudioParam.setTargetAtTime() - Web APIs
// create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; var attimeplus = document.query
selector('.at-time-plus'); var attimeminus = document.query
selector('.at-time-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // crea...
AudioParam.setValueAtTime() - Web APIs
ttons are pressed, the currgain variable is incremented/decremented by 0.25, then the setvalueattime() method is used to set the gain value equal to currgain, one second from now (audioctx.currenttime + 1.) // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; var targetattimeplus = document.query
selector('.set-target-at-time-plus'); var targetattimeminus = document.query
selector('.set-target-at-time-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmed...
AudioParam.setValueCurveAtTime() - Web APIs
ebaudio-examples repo for the source code, or view the example live.) when this button is pressed, setvaluecurveattime() is used to change the gain value between the values contained in the wavearray array: // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; var valuecurve = document.query
selector('.value-curve'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node and set it's gain value to 0.5 var gainnode = ...
AudioProcessingEvent - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.query
selector('script'); var mypre = document.query
selector('pre'); var playbutton = document.query
selector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(s...
AudioTrack - Web APIs
usage notes to get an audiotrack for a given media element, use the element's audiotracks property, which returns an audiotracklist object from which you can get the individual tracks contained in the media: var el = document.query
selector("video"); var tracks = el.audiotracks; you can then access the media's individual tracks using either array syntax or functions such as foreach().
AudioTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.audiotracks.addeventlistener('addtrack', (event) => { console.log(`audio track: ${event.track.label} added`); }); using the onaddtrack event handler property: const videoelement = document.query
selector('video'); videoelement.audiotracks.onaddtrack = (event) => { console.log(`audio track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
AudioTrackList.onaddtrack - Web APIs
document.query
selector("video").audiotracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'audiotracklist.onaddtrack' in that specification.
AudioTrackList.onchange - Web APIs
var tracklist = document.query
selector("video").audiotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackenabledbutton(track.id, track.enabled); }); }; the updatetrackenabledbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's enabled flag to determine ...
AudioTrackList.onremovetrack - Web APIs
document.query
selector("my-video").audiotracks.onremovetrack = function(event) { mytrackcount = document.query
selector("my-video").audiotracks.length; }; the current number of audio tracks remaining in the media element is obtained from audiotracklist property length.
AudioTrackList: removetrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.audiotracks.addeventlistener('removetrack', (event) => { console.log(`audio track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const videoelement = document.query
selector('video'); videoelement.audiotracks.onremovetrack = (event) => { console.log(`audio track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specification.
AudioTrackList - Web APIs
var audiotracks = document.query
selector("video").audiotracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
BaseAudioContext.createBufferSource() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var button = document.query
selector('button'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; // stereo var channels = 2; // create an empty two second stereo buffer at the // sample rate of the audiocontext var framecount = audioctx.samplerate * 2.0; var myarraybuffer = audioctx.createbuffer(2, framecount, audioctx.samplerate); button.onclick = func...
BaseAudioContext.createGain() - Web APIs
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.query
selector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); }...
BaseAudioContext.createPanner() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
BaseAudioContext.createScriptProcessor() - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.query
selector('script'); var mypre = document.query
selector('pre'); var playbutton = document.query
selector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(s...
BaseAudioContext.createStereoPanner() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.query
selector('audio'); var pancontrol = document.query
selector('.panning-control'); var panvalue = document.query
selector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler function...
BaseAudioContext.decodeAudioData() - Web APIs
note: you can run the example live (or view the source.) // define variables var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var source; var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); // use xhr to load an audio track, and // decodeaudiodata to decode it and stick it in a buffer.
BatteryManager.charging - Web APIs
example html content <div id="charging">(charging state unknown)</div> javascript content navigator.getbattery().then(function(battery) { var charging = battery.charging; document.query
selector('#charging').textcontent = charging ; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.chargingTime - Web APIs
example html content <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.chargingtime; document.query
selector('#chargingtime').textcontent = battery.chargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.dischargingTime - Web APIs
example html content <div id="dischargingtime">(discharging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.dischargingtime; document.query
selector('#dischargingtime').textcontent = battery.dischargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.level - Web APIs
example html content <div id="level">(battery level unknown)</div> javascript content navigator.getbattery().then(function(battery) { var level = battery.level; document.query
selector('#level').textcontent = level; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onchargingchange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.onchargingchange = chargingchange(); function chargingchange() { document.query
selector('#level').textcontent = battery.level; document.query
selector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onchargingtimechange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.onchargingtimechange = chargingtimechange(); function chargingtimechange(){ document.query
selector('#level').textcontent = battery.level; document.query
selector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.ondischargingtimechange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.ondischargingtimechange = dischargingtimechange; function dischargingtimechange(){ document.query
selector('#level').textcontent = battery.level; document.query
selector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onlevelchange - Web APIs
example html <div id="level">(battery level unknown)</div> <div id="statebaterry">(charging state unknown)</div> javascript navigator.getbattery().then(function(battery) { battery.onlevelchange = function(){ document.query
selector('#level').textcontent = battery.level; if(battery.charging) { document.query
selector('#statebaterry').textcontent = "charging time: " + (battery.chargingtime / 60); } else { document.query
selector('#statebaterry').textcontent = "discharging time: " + (battery.dischargingtime / 60); } }; }); specifications specification status ...
BiquadFilterNode.getFrequencyResponse() - Web APIs
2] = 3000; myfrequencyarray[3] = 4000; myfrequencyarray[4] = 5000; var magresponseoutput = new float32array(5); var phaseresponseoutput = new float32array(5); next we create a <ul> element in our html to contain our results, and grab a reference to it in our javascript: <p>biquad filter frequency response for: </p> <ul class="freq-response-output"> </ul> var freqresponseoutput = document.query
selector('.freq-response-output'); finally, after creating our biquad filter, we use getfrequencyresponse() to generate the response data and put it in our arrays, then loop through each data set and output them in a human-readable list at the bottom of the page: var biquadfilter = audioctx.createbiquadfilter(); biquadfilter.type = "lowshelf"; biquadfilter.frequency.value = 1000; biquadfilter.gain.valu...
Body.blob() - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest) .then(response => response.blob()) .then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); specifications specification status comment fetchthe definition of 'blob()' in that specification.
Body.bodyUsed - Web APIs
html content <img class="my-image" src="https://udn.realityripple.com/samples/46/29059a2b39.png"> js content var myimage = document.query
selector('.my-image'); fetch('https://upload.wikimedia.org/wikipedia/commons/7/77/delete_key1.jpg').then(function(response) { console.log(response.bodyused); var res = response.blob(); console.log(response.bodyused); return res; }).then(function(response) { var objecturl = url.createobjecturl(response); myimage.src = objecturl; }); specifications specification statu...
Body.json() - Web APIs
const mylist = document.query
selector('ul'); const myrequest = new request('products.json'); fetch(myrequest) .then(response => response.json()) .then(data => { for (const product of data.products) { let listitem = document.createelement('li'); listitem.appendchild( document.createelement('strong') ).textcontent = product.name; listitem.append( ` can be found in ${ product.lo...
Body.text() - Web APIs
let myarticle = document.query
selector('article'); let mylinks = document.query
selectorall('ul a'); for(let i = 0; i <= mylinks.length-1; i++) { mylinks[i].onclick = function(e) { e.preventdefault(); let linkdata = e.target.getattribute('data-page'); getdata(linkdata); } }; function getdata(pageid) { console.log(pageid); var myrequest = new request(pageid + '.txt'); fetch(myrequest).then(function(response) { ...
Body - Web APIs
html content <img class="my-image" src="https://udn.realityripple.com/samples/46/29059a2b39.png"> js content const myimage = document.query
selector('.my-image'); fetch('https://upload.wikimedia.org/wikipedia/commons/7/77/delete_key1.jpg') .then(res => res.blob()) .then(res => { const objecturl = url.createobjecturl(res); myimage.src = objecturl; }); specifications specification status comment fetchthe definition of 'body' in that specification.
BroadcastChannel: message event - Web APIs
1px solid black; padding: .5rem; height: 150px; font-family: "fira sans", sans-serif; } h1 { font: 1.6em "fira sans", sans-serif; margin-bottom: 1rem; } textarea { padding: .2rem; } label, br { margin: .5rem 0; } button { vertical-align: top; height: 1.5rem; } const channel = new broadcastchannel('example-channel'); const messagecontrol = document.query
selector('#message'); const broadcastmessagebutton = document.query
selector('#broadcast-message'); broadcastmessagebutton.addeventlistener('click', () => { channel.postmessage(messagecontrol.value); }) receiver 1 <h1>receiver 1</h1> <div id="received"></div> body { border: 1px solid black; padding: .5rem; height: 100px; font-family: "fira sans", sans-serif; } h1 { font: 1.6e...
CSS - Web APIs
css.escape() can be used to escape a string mostly for use as part of a css
selector.
CSSImageValue - Web APIs
we then get() the background-image from the stylemap and stringify it: // get the element const button = document.query
selector( 'button' ); // retrieve all computed styles with computedstylemap() const allcomputedstyles = button.computedstylemap(); // return the cssimagevalue example console.log( allcomputedstyles.get('background-image') ); console.log( allcomputedstyles.get('background-image').tostring() ); specifications specification status comment css typed om level 1the definition of '...
CSSMathSum - Web APIs
<div>has width</div> we assign a width div { width: calc(30% - 20px); } we add the javascript const stylemap = document.query
selector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values ); // cssnumericarray {0: cssunitvalue, 1: cssunitvalue, length: 2} console.log( stylemap.get('width').values[0] ); // cssunitvalue {val...
CSSMathValue.operator - Web APIs
<div>my width has a <code>calc()</code> function</div> we assign a width with a calculation div { width: calc(50% - 0.5vw); } we add the javascript const stylemap = document.query
selector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').values ); // cssnumericarray {0: cssunitvalue, 1: cssmathnegate, length: 2} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values[1].operator ) // 'negate' ...
CSSMathValue - Web APIs
<div>has width</div> we assign a width with a calculation div { width: calc(30% - 20px); } we add the javascript const stylemap = document.query
selector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values[1].value ); // -20 the cssmathvalue.operator returns 'sum' because stylemap.get('width').values[1].value ); is -20: adding a negative number.
CSSPseudoElement.element - Web APIs
examples the example below demonstrates the relationship between csspseudoelement.element and element.pseudo(): const myelement = document.query
selector('q'); const csspseudoelement = myelement.pseudo('::after'); const originatingelement = csspseudoelement.element; console.log(myelement === originatingelement); // outputs true console.log(myelement.parentelement === originatingelement); // outputs false console.log(myelement.lastelementchild === csspseudoelement); // outputs false console.log(myelement.lastchild === csspseu...
CSSRule.cssText - Web APIs
therefore, to modify it, use the stylesheet's cssrules[index] properties .
selectortext and .style (or its sub-properties).
CSSRule - Web APIs
the relationships between these constants and the interfaces are: type value rule-specific interface comments and examples cssrule.style_rule 1 cssstylerule the most common kind of rule:
selector { prop1: val1; prop2: val2; } cssrule.import_rule 3 cssimportrule an @import rule.
CSSStyleDeclaration.getPropertyPriority() - Web APIs
example the following javascript code checks whether margin is marked as important in a css
selector rule: var declaration = document.stylesheets[0].cssrules[0].style; var isimportant = declaration.getpropertypriority('margin') === 'important'; specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.getpropertypriority()' in that specification.
CSSStyleDeclaration.getPropertyValue() - Web APIs
example the following javascript code queries the value of the margin property in a css
selector rule: var declaration = document.stylesheets[0].cssrules[0].style; var value = declaration.getpropertyvalue('margin'); // "1px 2px" specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.getpropertyvalue()' in that specification.
CSSStyleDeclaration.removeProperty() - Web APIs
example the following javascript code removes the background-color css property from a
selector rule: var declaration = document.stylesheets[0].rules[0].style; var oldvalue = declaration.removeproperty('background-color'); specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.removeproperty()' in that specification.
CSSStyleRule.style - Web APIs
syntax styleobj = cssrule.style example function stilo() { alert(document.stylesheets[0].cssrules[0].style.csstext); } // displays "background-color: gray;" notes the declaration block is that part of the style rule that appears within the braces and that actually provides the style definitions (for the
selector, the part that comes before the braces).
CSSStyleRule - Web APIs
properties cssstylerule.
selectortext returns the textual representation of the
selector for this rule, e.g.
CSSStyleSheet - Web APIs
addrule() adds a new rule to the stylesheet given the
selector to which the style applies and the style block to apply to the matching elements.
Using the CSS Painting API - Web APIs
using the paint worklet to use the paint worklet, we need to register it using addmodule() and include it in our css, ensuring the css
selector matches a dom node in our html registering the worklet the setup and design of our paint worklet took place in the external script shown above.
CSS Painting API - Web APIs
li { --boxcolor: hsla(55, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 2px); } li:nth-of-type(3n) { --boxcolor: hsla(155, 90%, 60%, 1.0); background-image: paint(hollowhighlights, filled, 3px); } li:nth-of-type(3n+1) { --boxcolor: hsla(255, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 1px); } we've included a custom property in the
selector block defining a boxcolor.
CanvasRenderingContext2D.getTransform() - Web APIs
html <canvas width="240"></canvas> <canvas width="240"></canvas> css canvas { border: 1px solid black; } javascript const canvases = document.query
selectorall('canvas'); const ctx1 = canvases[0].getcontext('2d'); const ctx2 = canvases[1].getcontext('2d'); ctx1.settransform(1, .2, .8, 1, 0, 0); ctx1.fillrect(25, 25, 50, 50); let storedtransform = ctx1.gettransform(); console.log(storedtransform); ctx2.settransform(storedtransform); ctx2.beginpath(); ctx2.arc(50, 50, 50, 0, 2 * math.pi); ctx2.fill(); result specifications specificatio...
CanvasRenderingContext2D.setTransform() - Web APIs
html <canvas width="240"></canvas> <canvas width="240"></canvas> css canvas { border: 1px solid black; } javascript const canvases = document.query
selectorall('canvas'); const ctx1 = canvases[0].getcontext('2d'); const ctx2 = canvases[1].getcontext('2d'); ctx1.settransform(1, .2, .8, 1, 0, 0); ctx1.fillrect(25, 25, 50, 50); let storedtransform = ctx1.gettransform(); console.log(storedtransform); ctx2.settransform(storedtransform); ctx2.beginpath(); ctx2.arc(50, 50, 50, 0, 2 * math.pi); ctx2.fill(); result specifications specificatio...
Clipboard API - Web APIs
accessing the clipboard instead of creating a clipboard object through instantiation, you access the system clipboard through the navigator.clipboard global: navigator.clipboard.readtext().then( cliptext => document.query
selector(".editor").innertext += cliptext); this snippet fetches the text from the clipboard and appends it to the first element found with the class editor.
Constraint validation API - Web APIs
if you wanted to instead display custom error messages, you could use javascript like the following: const nameinput = document.query
selector('input'); const form = document.query
selector('form'); nameinput.addeventlistener('input', () => { nameinput.setcustomvalidity(''); nameinput.checkvalidity(); }); nameinput.addeventlistener('invalid', () => { if(nameinput.value === '') { nameinput.setcustomvalidity('enter your username!'); } else { nameinput.setcustomvalidity('usernames can only contain upper and lowercase lette...
DOMMatrixReadOnly.scale() - Web APIs
ixreadonly(); const scaledmatrix = matrix.scale(0.5); let scaledmatrixwithorigin = matrix.scale(0.5, 25, 25); // if the browser has interpreted these parameters as scalex, scaley, scalez, the resulting matrix is 3d const browserexpectssixparamscale = !scaledmatrixwithorigin.is2d; if (browserexpectssixparamscale) { scaledmatrixwithorigin = matrix.scale(0.5, 0.5, 1, 25, 25, 0); } document.query
selector('#transformed').setattribute('transform', scaledmatrix.tostring()); document.query
selector('#transformedorigin').setattribute('transform', scaledmatrixwithorigin.tostring()); screenshotlive sample specifications specification status comment geometry interfaces module level 1the definition of 'dommatrixreadonly.scale()' in that specification.
DOMMatrixReadOnly.translate() - Web APIs
const matrix = new dommatrixreadonly().translate(25, 25); document.query
selector('#transformed').setattribute('transform', matrix.tostring()); screenshotlive sample specifications specification status comment geometry interfaces module level 1the definition of 'dommatrixreadonly.translate()' in that specification.
DOMTokenList.add() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; classes.add("d"); span.textcontent = classes; the output looks like this: you can add multiple tokens as well: span.classlist.add("d", "e", "f"); specifications specification status comment domthe definition of 'add()' in that specification.
DOMTokenList.contains() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; let result = classes.contains("c"); if (result) { span.textcontent = "the classlist contains 'c'"; } else { span.textcontent = "the classlist does not contain 'c'"; } the output looks like this: specifications specification status comment domthe definition of 'contains()' in that specification.
DOMTokenList.entries() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; let iterator = classes.entries(); for (let value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'entries() (as iterable<node>)' in that specification.
DOMTokenList.forEach() - Web APIs
html <span class="a b c"></span> javascript let span = document.query
selector("span"); let classes = span.classlist; let iterator = classes.values(); classes.foreach( function(value, key, listobj) { span.textcontent += `${value} ${key}/${this} ++ `; }, "arg" ); result polyfill this polyfill adds compatibility to all browsers supporting es5: if (window.domtokenlist && !domtokenlist.prototype.foreach) { domtokenlist.prototype.foreach = function (callback...
DOMTokenList.item() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; let item = classes.item(classes.length-1); span.textcontent = item; the output looks like this: specifications specification status comment domthe definition of 'item()' in that specification.
DOMTokenList.keys() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: var span = document.query
selector("span"); var classes = span.classlist; var iterator = classes.keys(); for(var value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'keys() (as iterable<node>)' in that specification.
DOMTokenList.length - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; let length = classes.length; span.textcontent = `classlist length = ${length}`; the output looks like this: specifications specification status comment domthe definition of 'length' in that specification.
DOMTokenList.remove() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; classes.remove("c"); span.textcontent = classes; the output looks like this: to remove multiple classes at once, you can supply multiple tokens.
DOMTokenList.replace() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; let result = classes.replace("c", "z"); console.log(result); if (result) { span.textcontent = classes; } else { span.textcontent = 'token not replaced successfully'; } the output looks like this: polyfill the following polyfill will add the replace method to the domtokenlist class.
DOMTokenList.toggle() - Web APIs
first, the html: <span class="a b">classlist is 'a b'</span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; span.addeventlistener('click', function() { let result = classes.toggle("c"); if (result) { span.textcontent = `'c' added; classlist is now "${classes}".`; } else { span.textcontent = `'c' removed; classlist is now "${classes}".`; } }) the output looks like this: specifications specification status comment ...
DOMTokenList.value - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.query
selector("span"); let classes = span.classlist; span.textcontent = classes.value; the output looks like this: specifications specification status comment domthe definition of 'value' in that specification.
DOMTokenList.values() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: var span = document.query
selector("span"); var classes = span.classlist; var iterator = classes.values(); for(var value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'values() (as iterable<node>)' in that specification.
DeprecationReportBody - Web APIs
the report details are displayed via the displayreports() fuction, which takes the observer callback's reports parameter as its parameter: function displayreports(reports) { const outputelem = document.query
selector('.output'); const list = document.createelement('ul'); outputelem.appendchild(list); for(let i = 0; i < reports.length; i++) { let listitem = document.createelement('li'); let textnode = document.createtextnode('report ' + (i + 1) + ', type: ' + reports[i].type); listitem.appendchild(textnode); let innerlist = document.createelement('ul'); listitem.appendchild(innerlist...
Detecting device orientation - Web APIs
, it's a tiny one), and the ball is in the center: .garden { position: relative; width : 200px; height: 200px; border: 5px solid #ccc; border-radius: 10px; } .ball { position: absolute; top : 90px; left : 90px; width : 20px; height: 20px; background: green; border-radius: 100%; } now, if we move our device, the ball will move accordingly: var ball = document.query
selector('.ball'); var garden = document.query
selector('.garden'); var output = document.query
selector('.output'); var maxx = garden.clientwidth - ball.clientwidth; var maxy = garden.clientheight - ball.clientheight; function handleorientation(event) { var x = event.beta; // in degree in the range [-180,180] var y = event.gamma; // in degree in the range [-90,90] output.innerhtml = "beta : " +...
Document: DOMContentLoaded event - Web APIs
-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.query
selector('.event-log-contents'); const reload = document.query
selector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent =...
Document.adoptNode() - Web APIs
example const iframe = document.query
selector('iframe'); const iframeimages = iframe.contentdocument.query
selectorall('img'); const newparent = document.getelementbyid('images'); iframeimages.foreach(function(imgel) { newparent.appendchild(document.adoptnode(imgel)); }); notes before they can be inserted into the current document, nodes from external documents should either be: cloned using document.importnode(); or adopted using d...
Document.evaluate() - Web APIs
generally, more specific xpath
selectors as in the above example usually gives a significant performance improvement, especially on very large documents.
Document: fullscreenerror event - Web APIs
examples const requestor = document.query
selector('div'); document.addeventlistener('fullscreenerror', (event) => { console.error('an error occurred changing into fullscreen'); console.log(event); }); requestor.requestfullscreen(); specifications specification status fullscreen api living standard ...
Document: gotpointercapture event - Web APIs
const para = document.query
selector('p'); document.addeventlistener('gotpointercapture', () => { console.log('i\'ve been captured!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, using the ongotpointercapture event handler property: const para = document.query
selector('p'); document.ongotpointercapture = () => { console.log('i\'ve been captured!') };...
Document.hasFocus() - Web APIs
html <p id="log">awaiting focus check.</p> <button onclick="openwindow()">open a new window</button> javascript function checkpagefocus() { let body = document.query
selector('body'); let log = document.getelementbyid('log'); if (document.hasfocus()) { log.textcontent = 'this document has the focus.'; body.style.background = '#fff'; } else { log.textcontent = 'this document does not have the focus.'; body.style.background = '#ccc'; } } function openwindow() { window.open('https://developer.mozilla.org/', 'mdn', 'width=640,height=320,left=...
Document.head - Web APIs
example <!doctype html> <head id="my-document-head"> <title>example: using document.head</title> </head> <script> var thehead = document.head; console.log(thehead.id); // "my-document-head"; console.log( thehead === document.query
selector("head") ); // true </script> notes document.head is read-only.
Document.importNode() - Web APIs
example const iframe = document.query
selector("iframe"); const oldnode = iframe.contentwindow.document.getelementbyid("mynode"); const newnode = document.importnode(oldnode, true); document.getelementbyid("container").appendchild(newnode); notes before they can be inserted into the current document, nodes from external documents should either be: cloned using document.importnode(); or adopted using document.adoptnode().
Document: lostpointercapture event - Web APIs
const para = document.query
selector('p'); document.addeventlistener('lostpointercapture', () => { console.log('i\'ve been released!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, but using the onlostpointercapture event handler property: const para = document.query
selector('p'); document.onlostpointercapture = () => { console.log('i\'ve been release...
Document: pointerlockerror event - Web APIs
bubbles yes cancelable no interface event event handler property onpointerlockerror examples using addeventlistener(): const para = document.query
selector('p'); document.addeventlistener('pointerlockerror', (event) => { console.log('error locking pointer'); }); using the onpointerlockerror event handler property: document.onpointerlockerror = (event) => { console.log('error locking pointer'); }; specifications specification status pointer lock candidate recommendation ...
Document: readystatechange event - Web APIs
-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.query
selector('.event-log-contents'); const reload = document.query
selector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent =...
Document: wheel event - Web APIs
ground: #cdf; padding: 5px; } function zoom(event) { event.preventdefault(); if (event.deltay < 0) { // zoom in scale *= event.deltay * -2; } else { // zoom out scale /= event.deltay * 2; } // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.query
selector('div'); document.onwheel = zoom; addeventlistener equivalent the event handler can also be set up using the addeventlistener() method: document.addeventlistener('wheel', zoom); specifications specification status comment ui eventsthe definition of 'wheel' in that specification.
DocumentTimeline.DocumentTimeline() - Web APIs
this bit of code would start all the cats animating 500 milliseconds into their animations: var cats = document.query
selectorall('.sharedtimelinecat'); cats = array.prototype.slice.call(cats); var sharedtimeline = new documenttimeline({ origintime: 500 }); cats.foreach(function(cat) { var catkeyframes = new keyframeeffect(cat, keyframes, timing); var catanimation = new animation(catkeyframes, sharedtimeline); catanimation.play(); }); specifications specification status comment web anim...
DocumentTimeline - Web APIs
this bit of code would start all the cats animating 500 milliseconds into their animations: const cats = document.query
selectorall('.sharedtimelinecat'); const sharedtimeline = new documenttimeline({ origintime: 500 }); for (const cat of cats) { const catkeyframes = new keyframeeffect(cat, keyframes, timing); const catanimation = new animation(catkeyframes, sharedtimeline); catanimation.play(); } specifications specification status comment web animationsthe definition of 'documenttimelin...
Element: auxclick event - Web APIs
javascript let button = document.query
selector('button'); let html = document.query
selector('html'); function random(number) { return math.floor(math.random() * number); } function randomcolor() { return `rgb(${random(255)}, ${random(255)}, ${random(255)})`; } button.onclick = function() { button.style.backgroundcolor = randomcolor(); }; button.onauxclick = function(e) { e.preventdefault(); button.style.color = randomcolor(); ...
Element: blur event - Web APIs
bubbles no cancelable no interface focusevent event handler property onblur sync / async sync composed yes examples simple example html <form id="form"> <input type="text" placeholder="text input"> <input type="password" placeholder="password"> </form> javascript const password = document.query
selector('input[type="password"]'); password.addeventlistener('focus', (event) => { event.target.style.background = 'pink'; }); password.addeventlistener('blur', (event) => { event.target.style.background = ''; }); result event delegation there are two ways of implementing event delegation for this event: by using the focusout event, or by setting the usecapture parameter of addeventlistener() ...
Element: click event - Web APIs
html <button>click</button> javascript const button = document.query
selector('button'); button.addeventlistener('click', event => { button.innerhtml = `click count: ${event.detail}`; }); result try making rapid, repeated clicks on the button to increase the click count.
Element.computedStyleMap() - Web APIs
// get the element const myelement = document.query
selector('a'); // get the <dl> we'll be populating const styleslist = document.query
selector('#regurgitation'); // retrieve all computed styles with computedstylemap() const allcomputedstyles = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of allcomputedstyles) { // properties const cssproperty = document...
Element: copy event - Web APIs
examples live example html <div class="source" contenteditable="true">try copying text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const source = document.query
selector('div.source'); source.addeventlistener('copy', (event) => { const selection = document.getselection(); event.clipboarddata.setdata('text/plain', selection.tostring().touppercase()); event.preventdefault(); }); result specifications specification status clipboard api and events working draft ...
Element: cut event - Web APIs
examples live example html <div class="source" contenteditable="true">try cutting text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const source = document.query
selector('div.source'); source.addeventlistener('cut', (event) => { const selection = document.getselection(); event.clipboarddata.setdata('text/plain', selection.tostring().touppercase()); selection.deletefromdocument(); event.preventdefault(); }); result specifications specification status clipboard api and events working draft ...
Element: dblclick event - Web APIs
javascript const card = document.query
selector('aside'); card.addeventlistener('dblclick', function (e) { card.classlist.toggle('large'); }); html <aside> <h3>my card</h3> <p>double click to resize this object.</p> </aside> css aside { background: #fe9; border-radius: 1em; display: inline-block; padding: 1em; transform: scale(.9); transform-origin: 0 0; transition: transform .6s; } .large { transform: scale(1.3); }...
Element: error event - Web APIs
css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } button { height: 2rem; margin: .5rem; } img { width: 0; height: 0; } js const log = document.query
selector('.event-log-contents'); const badimg = document.query
selector('.bad-img'); badimg.addeventlistener('error', (event) => { log.textcontent = log.textcontent + `${event.type}: loading image\n`; console.log(event) }); const imgerror = document.query
selector('#img-error'); imgerror.addeventlistener('click', () => { badimg.setattribute('src', 'i-dont-exist'); }); result specification...
Element: focus event - Web APIs
bubbles no cancelable no interface focusevent event handler property onfocus sync / async sync composed yes examples simple example html <form id="form"> <input type="text" placeholder="text input"> <input type="password" placeholder="password"> </form> javascript const password = document.query
selector('input[type="password"]'); password.addeventlistener('focus', (event) => { event.target.style.background = 'pink'; }); password.addeventlistener('blur', (event) => { event.target.style.background = ''; }); result event delegation there are two ways of implementing event delegation for this event: by using the focusin event, or by setting the usecapture parameter of addeventlistener() t...
Element: fullscreenerror event - Web APIs
examples const requestor = document.query
selector('div'); requestor.addeventlistener('fullscreenerror', (event) => { console.error('an error occurred changing into fullscreen'); console.log(event); }); requestor.requestfullscreen(); specifications specification status fullscreen api living standard ...
Element.getAttribute() - Web APIs
retrieving nonce values for security reasons, csp nonces from non-script sources, such as css
selectors, and .getattribute("nonce") calls are hidden.
Element.getBoundingClientRect() - Web APIs
<div></div> div { width: 400px; height: 200px; padding: 20px; margin: 50px auto; background: purple; } let elem = document.query
selector('div'); let rect = elem.getboundingclientrect(); for (var key in rect) { if(typeof rect[key] !== 'function') { let para = document.createelement('p'); para.textcontent = `${ key } : ${ rect[key] }`; document.body.appendchild(para); } } notice how the width/height are equal to the equal to its width/height + padding.
Element.id - Web APIs
another common case is to use an element's id as a
selector when styling the document with css.
Element: keydown event - Web APIs
<input placeholder="click here, then press down a key." size="40"> <p id="log"></p> const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.addeventlistener('keydown', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeydown equivalent input.onkeydown = logkey; specifications specification status ui events working draft ...
Element: keypress event - Web APIs
<div> <label for="sample">focus the input and type something:</label> <input type="text" name="text" id="sample"> </div> <p id="log"></p> const log = document.getelementbyid('log'); const input = document.query
selector('input'); input.addeventlistener('keypress', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeypress equivalent input.onkeypress = logkey; specifications specification status ui events working draft ...
Element: keyup event - Web APIs
<input placeholder="click here, then press and release a key." size="40"> <p id="log"></p> const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.addeventlistener('keyup', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeyup equivalent input.onkeyup = logkey; specifications specification status ui events working draft ...
Element.onfullscreenchange - Web APIs
function togglefullscreen() { let elem = document.query
selector("video"); elem.onfullscreenchange = handlefullscreenchange; if (!document.fullscreenelement) { elem.requestfullscreen().then({}).catch(err => { alert(`error attempting to enable full-screen mode: ${err.message} (${err.name})`); }); } else { document.exitfullscreen(); } } function handlefullscreenchange(event) { let elem = event.target; let isfullscreen = document.f...
Element.onfullscreenerror - Web APIs
since full-screen mode changes are only permitted in response to a user input, this causes an error to occur, which triggers the delivery of the fullscreenerror event to the error handler, let elem = document.query
selector("video")}} elem.onfullscreenerror = function ( event ) { displaywarning("unable to switch into full-screen mode."); }; //....
Element: paste event - Web APIs
examples live example html <div class="source" contenteditable="true">try copying text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const target = document.query
selector('div.target'); target.addeventlistener('paste', (event) => { let paste = (event.clipboarddata || window.clipboarddata).getdata('text'); paste = paste.touppercase(); const selection = window.getselection(); if (!selection.rangecount) return false; selection.deletefromdocument(); selection.getrangeat(0).insertnode(document.createtextnode(paste)); event.preventdefault(...
Element.requestFullscreen() - Web APIs
function togglefullscreen() { let elem = document.query
selector("video"); if (!document.fullscreenelement) { elem.requestfullscreen().catch(err => { alert(`error attempting to enable full-screen mode: ${err.message} (${err.name})`); }); } else { document.exitfullscreen(); } } if the document isn't already in full-screen mode—detected by looking to see if document.fullscreenelement has a value—we call the video's requestfullscreen...
Element: select event - Web APIs
examples selection logger <input value="try selecting some text in this element."> <p id="log"></p> function logselection(event) { const log = document.getelementbyid('log'); const selection = event.target.value.substring(event.target.selectionstart, event.target.selectionend); log.textcontent = `you selected: ${selection}`; } const input = document.query
selector('input'); input.addeventlistener('select', logselection); onselect equivalent you can also set up the event handler using the onselect property: input.onselect = logselection; specifications specification status ui eventsthe definition of 'select' in that specification.
Element.setAttribute() - Web APIs
html <button>hello world</button> javascript var b = document.query
selector("button"); b.setattribute("name", "hellobutton"); b.setattribute("disabled", ""); this demonstrates two things: the first call to setattribute() above shows changing the name attribute's value to "hellobutton".
Element.slot - Web APIs
let slottedspan = document.query
selector('my-paragraph span') console.log(slottedspan.slot); // logs 'my-text' specifications specification status comment domthe definition of 'slot' in that specification.
Element.toggleAttribute() - Web APIs
html <input value="text"> <button>toggleattribute("readonly")</button> javascript var button = document.query
selector("button"); var input = document.query
selector("input"); button.addeventlistener("click", function(){ input.toggleattribute("readonly"); }); result dom methods dealing with element's attributes: not namespace-aware, most commonly used methods namespace-aware variants (dom level 2) dom level 1 methods for dealing with attr nodes directly (seldom used) dom level 2 namespace-aware methods ...
Element: wheel event - Web APIs
flex; align-items: center; justify-content: center; } div { width: 105px; height: 105px; background: #cdf; padding: 5px; } function zoom(event) { event.preventdefault(); scale += event.deltay * -0.01; // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.query
selector('div'); el.onwheel = zoom; addeventlistener equivalent the event handler can also be set up using the addeventlistener() method: el.addeventlistener('wheel', zoom); specifications specification status comment ui eventsthe definition of 'wheel' in that specification.
Event.composed - Web APIs
pelem.textcontent = this.getattribute('text'); let shadowroot = this.attachshadow({mode: 'open'}) .appendchild(pelem); } }); we then insert one of each element into our page: <open-shadow text="i have an open shadow root"></open-shadow> <closed-shadow text="i have a closed shadow root"></closed-shadow> then include a click event listener on the <html> element: document.query
selector('html').addeventlistener('click',function(e) { console.log(e.composed); console.log(e.composedpath()); }); when you click on the <open-shadow> element and then the <closed-shadow> element, you'll notice two things.
Event.composedPath() - Web APIs
pelem.textcontent = this.getattribute('text'); let shadowroot = this.attachshadow({mode: 'open'}) .appendchild(pelem); } }); we then insert one of each element into our page: <open-shadow text="i have an open shadow root"></open-shadow> <closed-shadow text="i have a closed shadow root"></closed-shadow> then include a click event listener on the <html> element: document.query
selector('html').addeventlistener('click',function(e) { console.log(e.composed); console.log(e.composedpath()); }); when you click on the <open-shadow> element and then the <closed-shadow> element, you'll notice two things.
Event.preventDefault() - Web APIs
this example demonstrates how to prevent that from happening: javascript document.query
selector("#id-checkbox").addeventlistener("click", function(event) { document.getelementbyid("output-box").innerhtml += "sorry!
EventSource() - Web APIs
examples var evtsource = new eventsource('sse.php'); var eventlist = document.query
selector('ul'); evtsource.onmessage = function(e) { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); } note: you can find a full example on github — see simple sse demo using php.
EventSource.close() - Web APIs
examples var button = document.query
selector('button'); var evtsource = new eventsource('sse.php'); button.onclick = function() { console.log('connection closed'); evtsource.close(); } note: you can find a full example on github — see simple sse demo using php.
EventSource: message event - Web APIs
var evtsource = new eventsource('sse.php'); var eventlist = document.query
selector('ul'); evtsource.addeventlistener('message', (e) => { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); }); onmessage equivalent evtsource.onmessage = (e) => { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); }; specificat...
EventSource - Web APIs
var evtsource = new eventsource('sse.php'); var eventlist = document.query
selector('ul'); evtsource.onmessage = function(e) { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); } each received event causes our eventsource object's onmessage event handler to be run.
EventTarget.addEventListener() - Web APIs
> </div> css .outer, .middle, .inner1, .inner2 { display: block; width: 520px; padding: 15px; margin: 15px; text-decoration: none; } .outer { border: 1px solid red; color: red; } .middle { border: 1px solid green; color: green; width: 460px; } .inner1, .inner2 { border: 1px solid purple; color: purple; width: 400px; } javascript const outer = document.query
selector('.outer'); const middle = document.query
selector('.middle'); const inner1 = document.query
selector('.inner1'); const inner2 = document.query
selector('.inner2'); const capture = { capture : true }; const nonecapture = { capture : false }; const once = { once : true }; const noneonce = { once : false }; const passive = { passive : true }; const nonepassive = { passive : false }; outer...
EventTarget.removeEventListener() - Web APIs
const body = document.query
selector('body') const clicktarget = document.getelementbyid('click-target') const mouseovertarget = document.getelementbyid('mouse-over-target') let toggle = false; function makebackgroundyellow() { if (toggle) { body.style.backgroundcolor = 'white'; } else { body.style.backgroundcolor = 'yellow'; } toggle = !toggle; } clicktarget.addeventlistener('click', makebackg...
File.lastModified - Web APIs
example reading from file input <input type="file" multiple id="fileinput"> const fileinput = document.query
selector('#fileinput'); fileinput.addeventlistener('change', (event) => { // files is a filelist object (similar to nodelist) const files = event.target.files; for (let file of files) { const date = new date(file.lastmodified); console.log(`${file.name} has a last modified date of ${date}`); } }); try the results out below: dynamically created files if a file is created dynamically,...
FileList - Web APIs
<!doctype html> <html> <head> </head> <body> <!--multiple is set to allow multiple files to be selected--> <input id="myfiles" multiple type="file"> </body> <script> var pullfiles=function(){ // love the query
selector var fileinput = document.query
selector("#myfiles"); var files = fileinput.files; // cache files.length var fl = files.length; var i = 0; while ( i < fl) { // localize file var in the loop var file = files[i]; alert(file.name); i++; } } // set the input element onchange to call pullfiles document.query
selector("#myfiles").onchange=pullf...
FileReader: abort event - Web APIs
order: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.query
selector('input[type="file"]'); const preview = document.query
selector('img.preview'); const eventlog = document.query
selector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function ...
FileReader: error event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onerror examples const fileinput = document.query
selector('input[type="file"]'); const reader = new filereader(); function handleselected(e) { const selectedfile = fileinput.files[0]; if (selectedfile) { reader.addeventlistener('error', () => { console.error(`error occurred reading file: ${selectedfile.name}`); }); reader.addeventlistener('load', () => { console.error(`file: ${selectedfile.name} read successfully`); }); reader.readasdataurl(selectedfile); } ...
FileReader: load event - Web APIs
order: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.query
selector('input[type="file"]'); const preview = document.query
selector('img.preview'); const eventlog = document.query
selector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function ...
FileReader: loadend event - Web APIs
order: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.query
selector('input[type="file"]'); const preview = document.query
selector('img.preview'); const eventlog = document.query
selector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function ...
FileReader: loadstart event - Web APIs
order: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.query
selector('input[type="file"]'); const preview = document.query
selector('img.preview'); const eventlog = document.query
selector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function ...
FileReader: progress event - Web APIs
order: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.query
selector('input[type="file"]'); const preview = document.query
selector('img.preview'); const eventlog = document.query
selector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function ...
FileReader.result - Web APIs
var fileinput = document.query
selector('input[type="file"]'); function read(callback) { var file = fileinput.files.item(0); var reader = new filereader(); reader.onload = function() { callback(reader.result); } reader.readastext(file); } specifications specification status comment file apithe definition of 'result' in that specification.
FileRequest.onprogress - Web APIs
example // assuming 'request' which is a filerequest object request.onprogress = function (status) { var progress = document.query
selector('progress'); progress.value = status.loaded; progress.max = status.total; } specification not part of any current specification.
FileHandle API - Web APIs
var progress = document.query
selector('progress'); var myfile = myfilehandle.open('readonly'); // let's read a 1gb file var action = myfile.readasarraybuffer(1000000000); action.onprogress = function (event) { if (progress) { progress.value = event.loaded; progress.max = event.total; } } action.onsuccess = function () { console.log('yeah \o/ just read a 1gb file'); } action.onerror = function () { console.lo...
FormDataEvent.formData - Web APIs
examples // grab reference to form const formelem = document.query
selector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object let data = e.formdata; for (var value of data.values()) { console.log(value); } // s...
FormDataEvent - Web APIs
examples // grab reference to form const formelem = document.query
selector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object ...
GainNode.gain - Web APIs
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.query
selector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); }...
GainNode - Web APIs
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.query
selector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); }...
GlobalEventHandlers.onauxclick - Web APIs
var button = document.query
selector('button'); var html = document.query
selector('html'); function random(number) { return math.floor(math.random() * number); } button.onclick = function() { var rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; button.style.backgroundcolor = rndcol; }; button.onauxclick = function() { var rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + '...
GlobalEventHandlers.onblur - Web APIs
html <input type="text" value="click here"> javascript let input = document.query
selector('input'); input.onblur = inputblur; input.onfocus = inputfocus; function inputblur() { input.value = 'focus has been lost'; } function inputfocus() { input.value = 'focus is here'; } result try clicking in and out of the form field, and watch its contents change accordingly.
GlobalEventHandlers.onchange - Web APIs
html <input type="text" placeholder="type something here, then click outside of the field." size="50"> <p id="log"></p> javascript let input = document.query
selector('input'); let log = document.getelementbyid('log'); input.onchange = handlechange; function handlechange(e) { log.textcontent = `the field's value is ${e.target.value.length} character(s) long.`; } result specification specification status comment html living standardthe definition of 'onchange' in that specification.
GlobalEventHandlers.oncontextmenu - Web APIs
18s linear infinite; background: lightsalmon; border-radius: 42%; margin: 1em; } .paused { background-color: #ddd; } .paused .shape { animation-play-state: paused; } javascript function pause(e) { body.classlist.add('paused'); note.removeattribute('hidden'); } function play(e) { body.classlist.remove('paused'); note.setattribute('hidden', ''); } const body = document.query
selector('body'); const note = document.query
selector('.note'); window.oncontextmenu = pause; window.onpointerdown = play; result specifications specification status comment html living standardthe definition of 'oncontextmenu' in that specification.
GlobalEventHandlers.onfocus - Web APIs
html <input type="text" value="click here"> javascript let input = document.query
selector('input'); input.onblur = inputblur; input.onfocus = inputfocus; function inputblur() { input.value = 'focus has been lost'; } function inputfocus() { input.value = 'focus is here'; } result try clicking in and out of the form field, and watch its contents change accordingly.
GlobalEventHandlers.onformdata - Web APIs
examples // grab reference to form const formelem = document.query
selector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.onformdata = (e) => { console.log('formdata fired'); // get the form data from the event object let data = e.fo...
GlobalEventHandlers.oninput - Web APIs
html <input type="text" placeholder="type something here to see its length." size="50"> <p id="log"></p> javascript let input = document.query
selector('input'); let log = document.getelementbyid('log'); input.oninput = handleinput; function handleinput(e) { log.textcontent = `the field's value is ${e.target.value.length} character(s) long.`; } result specifications specification status comment html living standardthe definition of 'oninput' in that specification.
GlobalEventHandlers.onkeydown - Web APIs
html <input> <p id="log"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.onkeydown = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result specifications specification status comment html living standardthe definition of 'onkeydown' in that specification.
GlobalEventHandlers.onkeyup - Web APIs
html <input> <p id="log"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('log'); input.onkeyup = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result specifications specification status comment html living standardthe definition of 'onkeyup' in that specification.
GlobalEventHandlers.onmousedown - Web APIs
ction showview(event) { view.removeattribute('hidden'); view.style.left = event.clientx - 50 + 'px'; view.style.top = event.clienty - 50 + 'px'; event.preventdefault(); } function moveview(event) { view.style.left = event.clientx - 50 + 'px'; view.style.top = event.clienty - 50 + 'px'; } function hideview(event) { view.setattribute('hidden', ''); } const container = document.query
selector('.container'); const view = document.query
selector('.view'); container.onmousedown = showview; container.onmousemove = moveview; document.onmouseup = hideview; result specification specification status comment html living standardthe definition of 'onmousedown' in that specification.
GlobalEventHandlers.onmousemove - Web APIs
cument.body.appendchild(node); this.follow = function(event) { node.style.left = event.clientx + 20 + 'px'; node.style.top = event.clienty + 10 + 'px'; }; this.show = function(event) { node.textcontent = event.target.dataset.tooltip; node.removeattribute('hidden'); }; this.hide = function() { node.setattribute('hidden', ''); }; })(); const links = document.query
selectorall('a'); links.foreach(link => { link.onmouseover = tooltip.show; link.onmousemove = tooltip.follow; link.onmouseout = tooltip.hide; }); result draggable elements we also have an example available showing the use of the onmousemove event handler with draggable objects — view the example in action.
GlobalEventHandlers.onmouseout - Web APIs
html <p>test your mouse on me!</p> javascript const p = document.query
selector('p'); p.onmouseover = logmouseover; p.onmouseout = logmouseout; function logmouseover() { p.innerhtml = 'mouse over detected'; } function logmouseout() { p.innerhtml = 'mouse out detected'; } result specification specification status comment html living standardthe definition of 'onmouseout' in that specification.
GlobalEventHandlers.onmouseover - Web APIs
html <p>test your mouse on me!</p> javascript const p = document.query
selector('p'); p.onmouseover = logmouseover; p.onmouseout = logmouseout; function logmouseover() { p.innerhtml = 'mouse over detected'; } function logmouseout() { p.innerhtml = 'mouse out detected'; } result specifications specification status comment html living standardthe definition of 'onmouseover' in that specification.
GlobalEventHandlers.onmouseup - Web APIs
z-index: -1; width: 100px; height: 50px; padding: 10px; background: #ed9; border-radius: 10px 10px 0 0; transform: translate(-50%, -90px); transition: transform .3s; } .depressed { transform: translate(-50%, -50%); } javascript function depress() { toast.classlist.add('depressed'); } function release() { toast.classlist.remove('depressed'); } const toaster = document.query
selector('.toaster'); const toast = document.query
selector('.toast'); toaster.onmousedown = depress; document.onmouseup = release; result specification specification status comment html living standardthe definition of 'onmouseup' in that specification.
GlobalEventHandlers.onresize - Web APIs
examples window size logger <p>resize the browser window to fire the <code>resize</code> event.</p> <p>window height: <span id="height"></span></p> <p>window width: <span id="width"></span></p> const heightoutput = document.query
selector('#height'); const widthoutput = document.query
selector('#width'); function resize() { heightoutput.textcontent = window.innerheight; widthoutput.textcontent = window.innerwidth; } window.onresize = resize; specification specification status comment html living standardthe definition of 'onresize' in that specification.
GlobalEventHandlers.onscroll - Web APIs
html <textarea>1 2 3 4 5 6 7 8 9</textarea> <p id="log"></p> css textarea { width: 4rem; height: 8rem; font-size: 3rem; } javascript const textarea = document.query
selector('textarea'); const log = document.getelementbyid('log'); textarea.onscroll = logscroll; function logscroll(e) { log.textcontent = `scroll position: ${e.target.scrolltop}`; } result specifications specification status comment html living standardthe definition of 'onscroll' in that specification.
GlobalEventHandlers.onselect - Web APIs
html <textarea>try selecting some text in this element.</textarea> <p id="log"></p> javascript function logselection(event) { const log = document.getelementbyid('log'); const selection = event.target.value.substring(event.target.selectionstart, event.target.selectionend); log.textcontent = `you selected: ${selection}`; } const textarea = document.query
selector('textarea'); textarea.onselect = logselection; result specification specification status comment html living standardthe definition of 'onselect' in that specification.
GlobalEventHandlers.ontransitioncancel - Web APIs
let box = document.query
selector(".box"); box.ontransitionrun = function(event) { box.innerhtml = "zooming..."; } box.ontransitionend = function(event) { box.innerhtml = "done!"; } box.onclick = function() { box.style.display = 'none'; timeout = window.settimeout(appear, 2000); function appear() { box.style.display = 'block'; } } box.ontransitioncancel = function(event) { console.log('transitioncancel fired a...
GlobalEventHandlers.ontransitionend - Web APIs
let box = document.query
selector(".box"); box.ontransitionrun = function(event) { box.innerhtml = "zooming..."; } box.ontransitionend = function(event) { box.innerhtml = "done!"; } result the resulting content looks like this: notice what happens when you hover your mouse cursor over the box, then move it away.
GlobalEventHandlers.onwheel - Web APIs
n: transform .3s; } javascript function zoom(event) { event.preventdefault(); if (event.deltay < 0) { // zoom in scale *= event.deltay * -2; } else { // zoom out scale /= event.deltay * 2; } // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.query
selector('div'); document.onwheel = zoom; result specification specification status comment html living standardthe definition of 'onwheel' in that specification.
HTMLCanvasElement.captureStream() - Web APIs
example // find the canvas element to capture var canvaselt = document.query
selector('canvas'); // get the stream var stream = canvaselt.capturestream(25); // 25 fps // do things to the stream // e.g.
HTMLContentElement - Web APIs
the value is a comma-separated list of css
selectors that select the content to insert in place of the <content> element.
HTMLDetailsElement: toggle event - Web APIs
</details> </section> css body { display: flex; flex-direction: row-reverse; } #log { flex-shrink: 0; padding-left: 3em; } #summaries { flex-grow: 1; } javascript function logitem(e) { const item = document.query
selector(`[data-id=${e.target.id}]`); item.toggleattribute('hidden'); } const chapters = document.query
selectorall('details'); chapters.foreach((chapter) => { chapter.addeventlistener('toggle', logitem); }); result specifications specification status comment html living standardthe definition of 'toggle event' in that specification.
HTMLElement: beforeinput event - Web APIs
html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('values'); input.addeventlistener('beforeinput', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status ui eventsthe definition of 'beforeinput event' in that specification.
HTMLElement: gotpointercapture event - Web APIs
const para = document.query
selector('p'); para.addeventlistener('gotpointercapture', () => { console.log('i\'ve been captured!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, using the ongotpointercapture event handler property: const para = document.query
selector('p'); para.ongotpointercapture = () => { console.log('i\'ve been captured!') }; para.a...
HTMLElement: input event - Web APIs
html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.query
selector('input'); const log = document.getelementbyid('values'); input.addeventlistener('input', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'input event' in that specification.
HTMLElement: lostpointercapture event - Web APIs
const para = document.query
selector('p'); para.addeventlistener('lostpointercapture', () => { console.log('i\'ve been released!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, but using the onlostpointercapture event handler property: const para = document.query
selector('p'); para.onlostpointercapture = () => { console.log('i\'ve been released!') }; ...
HTMLElement: pointercancel event - Web APIs
examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointercancel', (event) => { console.log('pointer event cancelled'); }); using the onpointercancel event handler property: const para = document.query
selector('p'); para.onpointercancel = (event) => { console.log('pointer event cancelled'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerdown event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerdown examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerdown', (event) => { console.log('pointer down event'); }); using the onpointerdown event handler property: const para = document.query
selector('p'); para.onpointerdown = (event) => { console.log('pointer down event'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerenter event - Web APIs
bubbles no cancelable no interface pointerevent event handler property onpointerenter examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerenter', (event) => { console.log('pointer entered element'); }); using the onpointerenter event handler property: const para = document.query
selector('p'); para.onpointerenter = (event) => { console.log('pointer entered element'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerleave event - Web APIs
bubbles no cancelable no interface pointerevent event handler property onpointerleave examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerleave', (event) => { console.log('pointer left element'); }); using the onpointerleave event handler property: const para = document.query
selector('p'); para.onpointerleave = (event) => { console.log('pointer left element'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointermove event - Web APIs
examples to add a handler for pointermove events using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointermove', (event) => { console.log('pointer moved'); }); you can also use the onpointermove event handler property: const para = document.query
selector('p'); para.onpointermove = (event) => { console.log('pointer moved'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerout event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerout examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerout', (event) => { console.log('pointer moved out'); }); using the onpointerout event handler property: const para = document.query
selector('p'); para.onpointerout = (event) => { console.log('pointer moved out'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerover event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerover examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerover', (event) => { console.log('pointer moved in'); }); using the onpointerover event handler property: const para = document.query
selector('p'); para.onpointerover = (event) => { console.log('pointer moved in'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerup event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerup examples using addeventlistener(): const para = document.query
selector('p'); para.addeventlistener('pointerup', (event) => { console.log('pointer up'); }); using the onpointerup event handler property: const para = document.query
selector('p'); para.onpointerup = (event) => { console.log('pointer up'); }; specifications specification status pointer events obsolete ...
HTMLElement: transitionrun event - Web APIs
const el = document.query
selector('.transition'); const message = document.query
selector('.message'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitionend', function() { message.textcontent = 'transitionend fired'; }); the difference i...
HTMLElement: transitionstart event - Web APIs
const transition = document.query
selector('.transition'); const message = document.query
selector('.message'); transition.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); transition.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); transition.addeventlistener('transitionend', function() { message.textcontent = 'transitionend fired'; }...
HTMLFormElement: formdata event - Web APIs
general info bubbles no cancelable no interface formdataevent event handler property globaleventhandlers.onformdata examples // grab reference to form const formelem = document.query
selector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object ...
HTMLFormElement.requestSubmit() - Web APIs
let myform = document.query
selector("form"); let submitbutton = myform.query
selector("#main-submit"); if (myform.requestsubmit) { if (submitbutton) { myform.requestsubmit(submitbutton); } else { myform.requestsubmit(); } } else { myform.submit(); } specifications specification status comment html living standardthe definition of 'requestsubmit()' in that specification.
HTMLFormElement - Web APIs
usage notes obtaining a form element object to obtain an htmlformelement object, you can use a css
selector with query
selector(), or you can get a list of all of the forms in the document using its forms property.
HTMLImageElement.complete - Web APIs
let lightboxelem = document.query
selector("#lightbox"); let lightboximgelem = lightboxelem.query
selector("img"); let lightboxcontrolselem = lightboxelem.query
selector(".toolbar"); async function loadimage(url, elem) { return new promise((resolve, reject) => { elem.onload = () => resolve(elem); elem.onerror = reject; elem.src = url; }); } async function lightbox(url) { lightboxelem.style.display = "block"; await load...
HTMLImageElement.crossOrigin - Web APIs
const imageurl = "https://mdn.mozillademos.org/files/16797/clock-demo-400px.png"; const container = document.query
selector(".container"); function loadimage(url) { const image = new image(200, 200); image.addeventlistener("load", () => container.prepend(image) ); image.addeventlistener("error", () => { const errmsg = document.createelement("output"); errmsg.value = `error loading image at ${url}`; container.append(errmsg); }); image.crossorigin = "anonymous"; image.alt = ""; image.s...
HTMLImageElement.currentSrc - Web APIs
html <img src="/files/16797/clock-demo-400px.png" alt="clock" srcset="/files/16864/clock-demo-200px.png 200w, /files/16797/clock-demo-400px.png 400w" sizes="(max-width: 400px) 50%, 90%"> javascript var clockimage = document.query
selector("img"); let p = document.createelement("p"); if (!clockimage.currentsrc.endswith("200px.png")) { p.innertext = "using the 200px image."; } else { p.innertext = "using the 400px image!"; } document.body.appendchild(p); result specifications specification status comment html living standardthe definition of 'htmlimageelement.currentsrc' in that specification.
HTMLImageElement.height - Web APIs
var clockimage = document.query
selector("img"); let output = document.query
selector(".size"); const updateheight = event => { output.innertext = clockimage.height; }; window.addeventlistener("load", updateheight); window.addeventlistener("resize", updateheight); result this example may be easier to try out in its own window.
HTMLImageElement.loading - Web APIs
function addimagetolist(url) { const list = document.query
selector("div.photo-list"); let newitem = document.createelement("div"); newitem.classname = "photo-item"; let newimg = document.createelement("img"); newimg.loading = "lazy"; newimg.width = 320; newimg.height = 240; newimg.src = url; newitem.appendchild(newimg); list.appendchild(newitem); } specifications specification status comment html living standar...
HTMLImageElement.naturalHeight - Web APIs
javascript let output = document.query
selector(".output"); let image = document.query
selector("img"); window.addeventlistener("load", event => { output.innerhtml += `natural size: ${image.naturalwidth} x ` + `${image.naturalheight} pixels<br>`; output.innerhtml += `displayed size: ${image.width} x ` + `${image.height} pixels`; }); the javascript code simply dumps the natural and as-displayed ...
HTMLImageElement.naturalWidth - Web APIs
javascript let output = document.query
selector(".output"); let image = document.query
selector("img"); window.addeventlistener("load", event => { output.innerhtml += `natural size: ${image.naturalwidth} x ` + `${image.naturalheight} pixels<br>`; output.innerhtml += `displayed size: ${image.width} x ` + `${image.height} pixels`; }); the javascript code simply dumps the natural and as-displayed ...
HTMLImageElement.sizes - Web APIs
let image = document.query
selector("article img"); let break40 = document.getelementbyid("break40"); let break50 = document.getelementbyid("break50"); break40.addeventlistener("click", event => image.sizes = image.sizes.replace(/50em,/, "40em,")); break50.addeventlistener("click", event => image.sizes = image.sizes.replace(/40em,/, "50em,")); result this result may be viewed in its own window here.
HTMLImageElement.srcset - Web APIs
let box = document.query
selector(".box"); let image = box.query
selector("img"); let newelem = document.createelement("p"); newelem.innerhtml = `image: <code>${image.currentsrc}</code>`; box.appendchild(newelem); result in the displayed output below, the selected url will correspond with whether your display results in selecting the 1x or the 2x version of the image.
HTMLImageElement.width - Web APIs
var clockimage = document.query
selector("img"); let output = document.query
selector(".size"); const updatewidth = event => { output.innertext = clockimage.width; }; window.addeventlistener("load", updatewidth); window.addeventlistener("resize", updatewidth); result this example may be easier to try out in its own window.
HTMLInputElement: invalid event - Web APIs
html <form action="#"> <ul> <li><label>enter an integer between 1 and 10: <input type="number" min="1" max="10" required></label></li> <li><input type="submit" value="submit"></li> </ul> </form><p id="log"></p> javascript const input = document.query
selector('input') const log = document.getelementbyid('log') input.addeventlistener('invalid', logvalue) function logvalue(e) { log.textcontent += e.target.value } result specifications specification status comment html living standardthe definition of 'invalid event' in that specification.
HTMLInputElement: search event - Web APIs
examples // addeventlistener version const input = document.query
selector('input[type="search"]'); input.addeventlistener('search', () => { console.log("the term searched for was " + input.value); }) // onsearch version const input = document.query
selector('input[type="search"]'); input.onsearch = () => { console.log("the term searched for was " + input.value); }) specifications this event is not part of any specification.
HTMLMediaElement: abort event - Web APIs
bubbles no cancelable no interface event event handler property onabort examples const video = document.query
selector('video'); const videosrc = 'https://path/to/video.webm'; video.addeventlistener('abort', () => { console.log(`abort loading: ${videosrc}`); }); const source = document.createelement('source'); source.setattribute('src', videosrc); source.setattribute('type', 'video/webm'); video.appendchild(source); specifications specification status html living standard living standard html5 recommendation ...
HTMLMediaElement.autoplay - Web APIs
<video id="video" controls> <source src="https://player.vimeo.com/external/250688977.sd.mp4?s=d14b1f1a971dde13c79d6e436b88a6a928dfe26b&profile_id=165"> </video> *** disable autoplay (recommended) *** false is the default value document.query
selector('#video').autoplay = false; specifications specification status comment html living standardthe definition of 'htmlmediaelement.autoplay' in that specification.
HTMLMediaElement: canplay event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('canplay', (event) => { console.log('video can start, but not sure it will play through.'); }); using the oncanplay event handler property: const video = document.query
selector('video'); video.oncanplay = (event) => { console.log('video can start, but not sure it will play through.'); }; specifications specification status html livin...
HTMLMediaElement: canplaythrough event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('canplaythrough', (event) => { console.log('i think i can play through the entire ' + ' video without ever having to stop to buffer.'); }); using the oncanplaythrough event handler property: const video = document.query
selector('video'); video.oncanplaythrough = (event) => { console.log('i think i can play thru the entire ' + ' video without ev...
HTMLMediaElement.captureStream() - Web APIs
document.query
selector('.playandrecord').addeventlistener('click', function() { var playbackelement = document.getelementbyid("playback"); var capturestream = playbackelement.capturestream(); playbackelement.play(); }); see recording a media element for a longer and more intricate example and explanation.
HTMLMediaElement: durationchange event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('durationchange', (event) => { console.log('not sure why, but the duration of the video has changed.'); }); using the ondurationchange event handler property: const video = document.query
selector('video'); video.ondurationchange = (event) => { console.log('not sure why, but the duration of the video has changed.'); }; specifications specificatio...
HTMLMediaElement: ended event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('ended', (event) => { console.log('video stopped either because 1) it was over, ' + 'or 2) no further data is available.'); }); using the onended event handler property: const video = document.query
selector('video'); video.onended = (event) => { console.log('video stopped either because 1) it was over, ' + 'or 2) no further data is available.')...
HTMLMediaElement: error event - Web APIs
bubbles no cancelable no interface event event handler property onerror examples const video = document.query
selector('video'); const videosrc = 'https://path/to/video.webm'; video.addeventlistener('error', () => { console.error(`error loading: ${videosrc}`); }); video.setattribute('src', videosrc); specifications specification status html living standard living standard html5 recommendation ...
HTMLMediaElement.load() - Web APIs
var mediaelem = document.query
selector("video"); mediaelem.load(); specifications specification status comment html living standardthe definition of 'htmlmediaelement.load()' in that specification.
HTMLMediaElement: loadstart event - Web APIs
height: 5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "button log" "video log"; } button { grid-area: button; width: 10rem; margin: .5rem 0; } video { grid-area: video; } .event-log { grid-area: log; } .event-log>label { display: block; } js const loadvideo = document.query
selector('button'); const video = document.query
selector('video'); const eventlog = document.query
selector('.event-log-contents'); let source = null; function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}\n`; } video.addeventlistener('loadstart', handleevent); video.addeventlistener('progress', handleevent); video.addeventlistener('canplay', handleevent); video.ad...
HTMLMediaElement: playing event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('playing', (event) => { console.log('video is no longer paused'); }); using the onplaying event handler property: const video = document.query
selector('video'); video.onplaying = (event) => { console.log('video is no longer paused.'); }; specifications specification status html living standardthe definition of 'playing media even...
HTMLMediaElement: progress event - Web APIs
5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "button log" "video log"; } button { grid-area: button; width: 10rem; margin: .5rem 0; } video { grid-area: video; } .event-log { grid-area: log; } .event-log>label { display: block; } javascript const loadvideo = document.query
selector('button'); const video = document.query
selector('video'); const eventlog = document.query
selector('.event-log-contents'); let source = null; function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}\n`; } video.addeventlistener('loadstart', handleevent); video.addeventlistener('progress', handleevent); video.addeventlistener('canplay', handleevent); video.ad...
HTMLMediaElement: ratechange event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('ratechange', (event) => { console.log('the playback rate changed.'); }); using the onratechange event handler property: const video = document.query
selector('video'); video.onratechange = (event) => { console.log('the playback rate changed.'); }; specifications specification status html living standardthe definition of 'ratechange m...
HTMLMediaElement.seekable - Web APIs
examples var video = document.query
selector("video"); var timerangesobject = video.seekable; var timeranges = []; //go through the object and output an array for (let count = 0; count < timerangesobject.length; count ++) { timeranges.push([timerangesobject.start(count), timerangesobject.end(count)]); } specifications specification status comment html living standardthe definition of 'htmlmediaelement' in that specification.
HTMLMediaElement: seeked event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('seeked', (event) => { console.log('video found the playback position it was looking for.'); }); using the onseeked event handler property: const video = document.query
selector('video'); video.onseeked = (event) => { console.log('video found the playback position it was looking for.'); }; specifications specification status html livi...
HTMLMediaElement: seeking event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('seeking', (event) => { console.log('video is seeking a new position.'); }); using the onseeking event handler property: const video = document.query
selector('video'); video.onseeking = (event) => { console.log('video is seeking a new position.'); }; specifications specification status html living standardthe definition of 'seeking m...
HTMLMediaElement: stalled event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('stalled', (event) => { console.log('failed to fetch data, but trying.'); }); using the onstalled event handler property: const video = document.query
selector('video'); video.onstalled = (event) => { console.log('failed to fetch data, but trying.'); }; specifications specification status html living standardthe definition of 'stalled...
HTMLMediaElement: suspend event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('suspend', (event) => { console.log('data loading has been suspended.'); }); using the onsuspend event handler property: const video = document.query
selector('video'); video.onsuspend = (event) => { console.log('data loading has been suspended.'); }; specifications specification status html living standardthe definition of 'suspend m...
HTMLMediaElement.textTracks - Web APIs
var tracks = document.query
selector('video').texttracks; for (var i = 0, l = tracks.length; i < l; i++) { /* tracks.length == 10 */ if (tracks[i].language == 'en') { console.dir(tracks[i]); } } properties & methods properties length returns the number of text tracks in texttracklist object.
HTMLMediaElement: volumechange event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('volumechange', (event) => { console.log('the volume changed.'); }); using the onvolumechange event handler property: const video = document.query
selector('video'); video.onvolumechange = (event) => { console.log('the volume changed.'); }; specifications specification status html living standardthe definition of 'volumechange med...
HTMLMediaElement: waiting event - Web APIs
using addeventlistener(): const video = document.query
selector('video'); video.addeventlistener('waiting', (event) => { console.log('video is waiting for more data.'); }); using the onwaiting event handler property: const video = document.query
selector('video'); video.onwaiting = (event) => { console.log('video is waiting for more data.'); }; specifications specification status html living standardthe definition of 'waiting...
HTMLOrForeignElement.dataset - Web APIs
examples <div id="user" data-id="1234567890" data-user="johndoe" data-date-of-birth>john doe</div> const el = document.query
selector('#user'); // el.id === 'user' // el.dataset.id === '1234567890' // el.dataset.user === 'johndoe' // el.dataset.dateofbirth === '' // set the data attribute el.dataset.dateofbirth = '1960-10-03'; // result: el.dataset.dateofbirth === 1960-10-03 delete el.dataset.dateofbirth; // result: el.dataset.dateofbirth === undefined // 'somedataattr' in el.dataset === false el.dataset.somedataattr = 'myd...
HTMLSlotElement.assignedElements() - Web APIs
examples let slots = this.shadowroot.query
selector('slot'); let elements = slots.assignedelements({flatten: true}); specifications specification status comment html living standardthe definition of 'assignedelements()' in that specification.
HTMLSlotElement.assignedNodes() - Web APIs
let slots = this.shadowroot.query
selectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLSlotElement.name - Web APIs
let slots = this.shadowroot.query
selectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLSlotElement: slotchange event - Web APIs
let slots = this.shadowroot.query
selectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the <slot>s, then add a slotchange event listener to the template's second slot — which is the one which has its contents changed in the example.
HTMLSlotElement - Web APIs
let slots = this.shadowroot.query
selectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLTableElement.createCaption() - Web APIs
html <table> <tr><td>cell 1.1</td><td>cell 1.2</td><td>cell 1.3</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td><td>cell 2.3</td></tr> </table> javascript let table = document.query
selector('table'); let caption = table.createcaption(); caption.textcontent = 'this caption was created by javascript!'; result specifications specification status comment html living standardthe definition of 'htmltableelement: createcaption' in that specification.
HTMLTableElement.deleteCaption() - Web APIs
html <table> <caption>this caption will be deleted!</caption> <tr><td>cell 1.1</td><td>cell 1.2</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td></tr> </table> javascript let table = document.query
selector('table'); table.deletecaption(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletecaption' in that specification.
HTMLTableElement.deleteRow() - Web APIs
html <table> <tr><td>cell 1.1</td><td>cell 1.2</td><td>cell 1.3</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td><td>cell 2.3</td></tr> <tr><td>cell 3.1</td><td>cell 3.2</td><td>cell 3.3</td></tr> </table> javascript let table = document.query
selector('table'); // delete second row table.deleterow(1); result specifications specification status comment html living standardthe definition of 'htmltableelement: deleterow' in that specification.
HTMLTableElement.deleteTFoot() - Web APIs
html <table> <thead><th>name</th><th>score</th></thead> <tr><td>bob</td><td>541</td></tr> <tr><td>jim</td><td>225</td></tr> <tfoot><th>average</th><td>383</td></tfoot> </table> javascript let table = document.query
selector('table'); table.deletetfoot(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletetfoot' in that specification.
HTMLTableElement.deleteTHead() - Web APIs
html <table> <thead><th>name</th><th>occupation</th></thead> <tr><td>bob</td><td>plumber</td></tr> <tr><td>jim</td><td>roofer</td></tr> </table> javascript let table = document.query
selector('table'); table.deletethead(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletethead' in that specification.
HTMLTableRowElement.rowIndex - Web APIs
html <table> <thead> <tr><th>item</th> <th>price</th></tr> </thead> <tbody> <tr><td>bananas</td> <td>$2</td></tr> <tr><td>oranges</td> <td>$8</td></tr> <tr><td>top sirloin</td> <td>$20</td></tr> </tbody> <tfoot> <tr><td>total</td> <td>$30</td></tr> </tfoot> </table> javascript let rows = document.query
selectorall('tr'); rows.foreach((row) => { let z = document.createelement("td"); z.textcontent = `(row #${row.rowindex})`; row.appendchild(z); }); result ...
HTMLTemplateElement.content - Web APIs
syntax var documentfragment = templateelement.content example var templateelement = document.query
selector("#foo"); var documentfragment = templateelement.content.clonenode(true); specifications specification status comment html living standardthe definition of 'htmltemplateelement interface' in that specification.
HTMLVideoElement.msHorizontalMirror - Web APIs
example var myvideo = document.getelementbyid("videotag1"); myvideo.mshorizontalmirror = true; myvideo.play(); example #2: var flip = document.query
selector('#flip'); flip.addeventlistener('click', function() { video.mshorizontalmirror = true; }); see also htmlvideoelement microsoft api extensions ...
IDBFactory.open() - Web APIs
for a full working example, see our to-do notifications app (view example live.) var note = document.query
selector("ul"); // in the following line, you should include the prefixes // of implementations you want to test.
IDBVersionChangeEvent.newVersion - Web APIs
for a full working example, see our to-do notifications app (view example live.) var note = document.query
selector("ul"); // in the following line, you should include the prefixes of // implementations you want to test.
IDBVersionChangeEvent - Web APIs
for a full working example, see our to-do notifications app (view example live.) var note = document.query
selector("ul"); // in the following line, you should include the prefixes of implementations you want to test.
IIRFilterNode.getFrequencyResponse() - Web APIs
ay[2] = 3000; myfrequencyarray[3] = 4000; myfrequencyarray[4] = 5000; var magresponseoutput = new float32array(5); var phaseresponseoutput = new float32array(5); next we create a <ul> element in our html to contain our results, and grab a reference to it in our javascript: <p>iir filter frequency response for: </p> <ul class="freq-response-output"> </ul> var freqresponseoutput = document.query
selector('.freq-response-output'); finally, after creating our filter, we use getfrequencyresponse() to generate the response data and put it in our arrays, then loop through each data set and output them in a human-readable list at the bottom of the page: var feedforwardcoefficients = [0.1, 0.2, 0.3, 0.4, 0.5]; var feedbackcoefficients = [0.5, 0.4, 0.3, 0.2, 0.1]; var iirfilter = audioctx.createiirfil...
ImageCapture() constructor - Web APIs
navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); }) .catch(error => console.log(error)); specifications specification status comment mediastream image capturethe definition of 'imagecapture' in that specification.
ImageCapture.getPhotoCapabilities() - Web APIs
const input = document.query
selector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings()...
ImageCapture.getPhotoSettings() - Web APIs
const input = document.query
selector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings()...
ImageCapture.grabFrame() - Web APIs
var grabframebutton = document.query
selector('button#grabframe'); var canvas = document.query
selector('canvas'); grabframebutton.onclick = grabframe; function grabframe() { imagecapture.grabframe() .then(function(imagebitmap) { console.log('grabbed frame:', imagebitmap); canvas.width = imagebitmap.width; canvas.height = imagebitmap.height; canvas.getcontext('2d').drawimage(imagebitmap, 0, 0); canvas.classlist.remov...
ImageCapture.takePhoto() - Web APIs
var takephotobutton = document.query
selector('button#takephoto'); var canvas = document.query
selector('canvas'); takephotobutton.onclick = takephoto; function takephoto() { imagecapture.takephoto().then(function(blob) { console.log('took photo:', blob); img.classlist.remove('hidden'); img.src = url.createobjecturl(blob); }).catch(function(error) { console.log('takephoto() error: ', error); }); } specifications ...
InputEvent.data - Web APIs
<p>some text to copy and paste.</p> <input type="text"> <p class="result"></p> var editable = document.query
selector('input') var result = document.query
selector('.result'); editable.addeventlistener('input', (e) => { result.textcontent = "inputted text: " + e.data; }); specifications specification status comment input events level 2the definition of 'data' in that specification.
InputEvent.dataTransfer - Web APIs
<p><span style="font-weight: bold; color: blue">whoa, bold blue text!</span></p> <p><span style="font-style: italic; color: red">exciting: italic red text!</span></p> <p>boring normal text ;-(</p> <hr> <p contenteditable="true">go on, try pasting some content into this editable paragraph and see what happens!</p> <p class="result"></p> var editable = document.query
selector('p[contenteditable]'); var result = document.query
selector('.result') var datatransferobj; editable.addeventlistener('input', (e) => { result.textcontent = e.datatransfer.getdata('text/html'); }); specifications specification status comment input events level 2the definition of 'datatransfer' in that specification.
InputEvent.inputType - Web APIs
try inserting line breaks, or deleting text in different ways, or pasting different content in.</p> <hr> <ul> <li>a sample</li> <li>bulleted</li> <li>list.</li> </ul> <p>another paragraph.</p> </div> javascript const log = document.getelementbyid('log'); const editable = document.query
selector('div[contenteditable]'); editable.addeventlistener('input', loginputtype); function loginputtype(event) { log.textcontent = `input type: ${event.inputtype}`; } result try editing the text inside the <div> and see what happens.
IntersectionObserver - Web APIs
if (entries[0].intersectionratio <= 0) return; loaditems(10); console.log('loaded new items'); }); // start observing intersectionobserver.observe(document.query
selector('.scrollerfooter')); specifications specification status comment intersection observerthe definition of 'intersectionobserver' in that specification.
KeyboardEvent.charCode - Web APIs
example html <p>type anything into the input box below to log a <code>charcode</code>.</p> <input type="text" /> <p id="log"></p> javascript let input = document.query
selector('input'); let log = document.query
selector('#log'); input.addeventlistener('keypress', function(e) { log.innertext = `key pressed: ${string.fromcharcode(e.charcode)}\ncharcode: ${e.charcode}`; }); result notes in a keypress event, the unicode value of the key pressed is stored in either the keycode or charcode property, but never both.
KeyframeEffect - Web APIs
keyframeeffect.pseudoelement gets and sets the
selector of the pseudo-element being animated by this object.
Location - Web APIs
00%; width:100%; left:50%; margin-left:-50%; font-size:40%; line-height:1.5; background:black;} [title]:hover:before, :target:before {background:black; color:yellow;} [title] [title]:before {margin-top:1.5em;} [title] [title] [title]:before {margin-top:3em;} [title]:hover, :target {position:relative; z-index:1; outline:50em solid rgba(255,255,255,.8);} javascript [].foreach.call(document.query
selectorall('[title][id]'), function (node) { node.addeventlistener("click", function(e) { e.preventdefault(); e.stoppropagation(); window.location.hash = '#' + $(this).attr('id'); }); }); [].foreach.call(document.query
selectorall('[title]'), function (node) { node.addeventlistener("click", function(e) { e.preventdefault(); e.stoppropagation(); window.location.hash = ''; })...
MathMLElement - Web APIs
ndlers, element, elementcssinlinestyle, globaleventhandlers, htmlorforeignelement methods this interface has no methods, but inherits methods from: documentandelementeventhandlers, element, elementcssinlinestyle, globaleventhandlers, htmlorforeignelement examples mathml <math xmlns="http://www.w3.org/1998/math/mathml"> <msqrt> <mi>x</mi> </msqrt> </math> javascript document.query
selector('msqrt').constructor.name; // mathmlelement specifications specification status comment mathmlelement interface ...
MediaDevices - Web APIs
var video = document.query
selector('video'); var constraints = window.constraints = { audio: false, video: true }; var errorelement = document.query
selector('#errormsg'); navigator.mediadevices.getusermedia(constraints) .then(function(stream) { var videotracks = stream.getvideotracks(); console.log('got stream with constraints:', constraints); console.log('using video device: ' + videotracks[0].label); stream.onremove...
MediaElementAudioSourceNode.mediaElement - Web APIs
examples const audioctx = new window.audiocontext(); const audioelem = document.query
selector('audio'); let options = { mediaelement: audioelem } let source = new mediaelementaudiosourcenode(audioctx, options); console.log(source.mediaelement); specifications specification status comment web audio apithe definition of 'mediaelementaudiosourcenode.mediaelement' in that specification.
MediaElementAudioSourceNode - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.query
selector('audio'); var pre = document.query
selector('pre'); var myscript = document.query
selector('script'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and he...
MediaQueryList.addListener() - Web APIs
examples var para = document.query
selector('p'); var mql = window.matchmedia('(max-width: 600px)'); function screentest(e) { if (e.matches) { /* the viewport is 600 pixels wide or less */ para.textcontent = 'this is a narrow screen — less than 600px wide.'; document.body.style.backgroundcolor = 'red'; } else { /* the viewport is more than than 600 pixels wide */ para.textcontent = 'this is a wide screen — more...
MediaQueryList.media - Web APIs
javascript let mql = window.matchmedia('(max-width: 600px)'); document.query
selector(".mq-value").innertext = mql.media; the javascript code simply passes the media query to match into matchmedia() to compile it, then sets the <span>'s innertext to the value of the result's media property.
MediaQueryList - Web APIs
var para = document.query
selector('p'); var mql = window.matchmedia('(max-width: 600px)'); function screentest(e) { if (e.matches) { /* the viewport is 600 pixels wide or less */ para.textcontent = 'this is a narrow screen — less than 600px wide.'; document.body.style.backgroundcolor = 'red'; } else { /* the viewport is more than than 600 pixels wide */ para.textcontent = 'this is a wide screen — more...
MediaSession.playbackState - Web APIs
example the following example sets up event handlers, for pausing and playing: var audio = document.query
selector("#player"); audio.src = "song.mp3"; navigator.mediasession.setactionhandler('play', play); navigator.mediasession.setactionhandler('pause', pause); function play() { audio.play(); navigator.mediasession.playbackstate = "playing"; } function pause() { audio.pause(); navigator.mediasession.playbackstate = "paused"; } specifications specification status comment ...
MediaSession - Web APIs
) {}); navigator.mediasession.setactionhandler('seekbackward', function() {}); navigator.mediasession.setactionhandler('seekforward', function() {}); navigator.mediasession.setactionhandler('previoustrack', function() {}); navigator.mediasession.setactionhandler('nexttrack', function() {}); } the following example sets up event handlers for pausing and playing: var audio = document.query
selector("#player"); audio.src = "song.mp3"; navigator.mediasession.setactionhandler('play', play); navigator.mediasession.setactionhandler('pause', pause); function play() { audio.play(); navigator.mediasession.playbackstate = "playing"; } function pause() { audio.pause(); navigator.mediasession.playbackstate = "paused"; } specifications specification status comment ...
MediaSettingsRange - Web APIs
const input = document.query
selector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings()...
MediaSource.MediaSource() - Web APIs
example the following snippet is taken from a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) var video = document.query
selector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource; //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(medias...
MediaSource - Web APIs
this example was written by nick desaulniers and can be viewed live here (you can also download the source for further investigation.) var video = document.query
selector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource(); //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(medi...
active - Web APIs
var promise = navigator.mediadevices.getusermedia({ audio: true, video: true }); promise.then(function(stream) { var startbtn = document.query
selector('#startbtn'); startbtn.disabled = stream.active; };) specifications specification status comment media capture and streamsthe definition of 'active' in that specification.
MediaStream.getAudioTracks() - Web APIs
navigator.mediadevices.getusermedia({audio: true, video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; // stop the audio stream after 5 seconds settimeout(() => { const tracks = mediastream.getaudiotracks() tracks[0].stop() }, 5000) }) specifications specification status comment media capture and streamsthe definition of 'getaudiotracks()' in that specification.
MediaStream.getTracks() - Web APIs
example navigator.mediadevices.getusermedia({audio: false, video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; // stop the stream after 5 seconds settimeout(() => { const tracks = mediastream.gettracks() tracks[0].stop() }, 5000) }) specifications specification status comment media capture and streamsthe definition of 'gettracks()' in that specification.
MediaStream.getVideoTracks() - Web APIs
var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) specifications specification status comment media capture and streamsthe definition of 'getvideotracks()' in that specification.
MediaStreamAudioSourceNode - Web APIs
var pre = document.query
selector('pre'); var video = document.query
selector('video'); var myscript = document.query
selector('script'); var range = document.query
selector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audio:...
MediaStreamTrackAudioSourceNode - Web APIs
var pre = document.query
selector('pre'); var video = document.query
selector('video'); var myscript = document.query
selector('script'); var range = document.query
selector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audio:...
Using the MediaStream Recording API - Web APIs
we'll declare some variables for the record and stop buttons, and the <article> that will contain the generated audio players: const record = document.query
selector('.record'); const stop = document.query
selector('.stop'); const soundclips = document.query
selector('.sound-clips'); finally for this section, we set up the basic getusermedia structure: if (navigator.mediadevices && navigator.mediadevices.getusermedia) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app ...
Media Session API - Web APIs
the following example adds a pointerup event to an on-page play button, which is then used to kick off the media session code: playbutton.addeventlistener('pointerup', function(event) { var audio = document.query
selector('audio'); // user interacted with the page.
MessageChannel() - Web APIs
var channel = new messagechannel(); var para = document.query
selector('p'); var ifr = document.query
selector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel messa...
MessageChannel.port1 - Web APIs
var channel = new messagechannel(); var para = document.query
selector('p'); var ifr = document.query
selector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } specifications specification status ...
MessageChannel.port2 - Web APIs
var channel = new messagechannel(); var para = document.query
selector('p'); var ifr = document.query
selector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel messa...
MessageChannel - Web APIs
var channel = new messagechannel(); var output = document.query
selector('.output'); var iframe = document.query
selector('iframe'); // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for messages on port1 channel.port1.onmessage = onmessage; // transfer port2 to the iframe iframe.contentwindow.postmessage('hello from the main page!', '*', [channel.port2]); } // handle messages received on port1 function o...
MessagePort: message event - Web APIs
event handler property onmessage examples suppose a script creates a messagechannel and sends one of the ports to a different browsing context, such as another <iframe>, using code like this: const channel = new messagechannel(); const myport = channel.port1; const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const messagecontrol = document.query
selector('#message'); const channelmessagebutton = document.query
selector('#channel-message'); channelmessagebutton.addeventlistener('click', () => { myport.postmessage(messagecontrol.value); }) targetframe.postmessage('init', targetorigin, [channel.port2]); the target can receive the port and start listening for messages on it using code like this: window.addeventlistener('message', (event) => { ...
MessagePort: messageerror event - Web APIs
vent handler property onmessageerror examples suppose a script creates a messagechannel and sends one of the ports to a different browsing context, such as another <iframe>, using code like this: const channel = new messagechannel(); const myport = channel.port1; const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const messagecontrol = document.query
selector('#message'); const channelmessagebutton = document.query
selector('#channel-message'); channelmessagebutton.addeventlistener('click', () => { myport.postmessage(messagecontrol.value); }) targetframe.postmessage('init', targetorigin, [channel.port2]); the target can receive the port and start listening for messages and message errors on it using code like this: window.addeventlistener('mess...
MessagePort.onmessage - Web APIs
var channel = new messagechannel(); var para = document.query
selector('p'); var ifr = document.query
selector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel messa...
MessagePort.postMessage() - Web APIs
var channel = new messagechannel(); var para = document.query
selector('p'); var ifr = document.query
selector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel messa...
MessagePort - Web APIs
var channel = new messagechannel(); var output = document.query
selector('.output'); var iframe = document.query
selector('iframe'); // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for messages on port1 channel.port1.onmessage = onmessage; // transfer port2 to the iframe iframe.contentwindow.postmessage('hello from the main page!', '*', [channel.port2]); } // handle messages received on port1 function o...
Microsoft API extensions - Web APIs
layoutchanged msfirstpaint pinned sites apis mssitemodeevent mssitemodejumplistitemremoved msthumbnailclick other apis x-ms-aria-flowfrom x-ms-acceleratorkey x-ms-format-detection mscaching mscachingenabled mscapslockwarningoff event.msconverturl() mselementresize document.mselementsfromrect() msisstatichtml navigator.mslaunchuri() mslaunchuricallback element.msmatches
selector() msprotocols msputpropertyenabled mswriteprofilermark ...
MouseEvent.altKey - Web APIs
html <p>click anywhere to test the <code>altkey</code> property.</p> <p id="log"></p> javascript let log = document.query
selector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the alt key is pressed: ${e.altkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.altkey' in that specification.
MouseEvent.button - Web APIs
example html <button id="button" oncontextmenu="event.preventdefault();">click here with your mouse...</button> <p id="log"></p> javascript let button = document.query
selector('#button'); let log = document.query
selector('#log'); button.addeventlistener('mouseup', logmousebutton); function logmousebutton(e) { if (typeof e === 'object') { switch (e.button) { case 0: log.textcontent = 'left button clicked.'; break; case 1: log.textcontent = 'middle button clicked.'; break; case 2: log.textcontent = 'right b...
MouseEvent.buttons - Web APIs
re id="log">buttons: </pre> javascript let log = document.createtextnode('?'); // let log = new text('?'); function logbuttons(e) { log.data = `${e.buttons} (${e.type})`; // log.nodevalue= `${e.buttons} (${e.type})`; } document.addeventlistener('mouseup', logbuttons); document.addeventlistener('mousedown', logbuttons); // document.addeventlistener('mousemove', logbuttons); document.query
selector('#log').appendchild(log) result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.buttons' in that specification.
MouseEvent.clientX - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.query
selector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'clientx' in that specification.
MouseEvent.clientY - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.query
selector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'clienty' in that specification.
MouseEvent.ctrlKey - Web APIs
html <p>click anywhere to test the <code>ctrlkey</code> property.</p> <p id="log"></p> javascript let log = document.query
selector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the ctrl key is pressed: ${e.ctrlkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.ctrlkey' in that specification.
MouseEvent.metaKey - Web APIs
html <p>click anywhere to test the <code>metakey</code> property.</p> <p id="log"></p> javascript let log = document.query
selector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the meta key is pressed: ${e.metakey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.metakey' in that specification.
MouseEvent.pageX - Web APIs
javascript var box = document.query
selector(".box"); var pagex = document.getelementbyid("x"); var pagey = document.getelementbyid("y"); function updatedisplay(event) { pagex.innertext = event.pagex; pagey.innertext = event.pagey; } box.addeventlistener("mousemove", updatedisplay, false); box.addeventlistener("mouseenter", updatedisplay, false); box.addeventlistener("mouseleave", updatedisplay, false); the javascript code uses addev...
MouseEvent.screenX - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.query
selector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result routing an event when you trap events on the window, document, or other roomy elements, you can get the coordinates of that event (e.g., a click) and route it properly, as the following...
MouseEvent.screenY - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.query
selector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'screeny' in that specification.
MouseEvent.shiftKey - Web APIs
html <p>click anywhere to test the <code>shiftkey</code> property.</p> <p id="log"></p> javascript let log = document.query
selector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the shift key is pressed: ${e.shiftkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.shiftkey' in that specification.
MutationObserver.MutationObserver() - Web APIs
const targetnode = document.query
selector("#someelement"); const observeroptions = { childlist: true, attributes: true, // omit (or set to false) to observe only changes to the parent node subtree: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); the desired subtree is located by finding an element with the id someelement.
MutationObserver.disconnect() - Web APIs
const targetnode = document.query
selector("#someelement"); const observeroptions = { childlist: true, attributes: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); /* some time later...
MutationObserver.observe() - Web APIs
// identify an element to observe const elementtoobserve = document.query
selector("#targetelementid"); // create a new instance of `mutationobserver` named `observer`, // passing it a callback function const observer = new mutationobserver(function() { console.log('callback that runs when observer is triggered'); }); // call `observe()` on that mutationobserver instance, // passing it the element to observe, and the options object observer.observe(elementtoobserve, {subt...
MutationObserver.takeRecords() - Web APIs
const targetnode = document.query
selector("#someelement"); const observeroptions = { childlist: true, attributes: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); /* ...later, when it's time to stop observing...
MutationObserverInit.attributeFilter - Web APIs
tion.type) { case "attributes": switch(mutation.attributename) { case "status": userstatuschanged(mutation.target.username, mutation.target.status); break; case "username": usernamechanged(mutation.oldvalue, mutation.target.username); break; } break; } }); } var userlistelement = document.query
selector("#userlist"); var observer = new mutationobserver(callback); observer.observe(userlistelement, { attributefilter: [ "status", "username" ], attributeoldvalue: true, subtree: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
MutationObserverInit.attributeOldValue - Web APIs
function callback(mutationlist) { mutationlist.foreach(function(mutation) { switch(mutation.type) { case "attributes": notifyuser("attribute name " + mutation.attributename + " changed to " + mutation.target[mutation.attributename] + " (was " + mutation.oldvalue + ")"); break; } }); } var targetnode = document.query
selector("#target"); var observer = new mutationobserver(callback); observer.observe(targetnode, { attributes: true, attributeoldvalue: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
MutationObserverInit.attributes - Web APIs
function callback(mutationlist) { mutationlist.foreach(function(mutation) { switch(mutation.type) { case "attributes": notifyuser("attribute name " + mutation.attributename + " changed to " + mutation.target[mutation.attributename] + " (was " + mutation.oldvalue + ")"); break; } }); } var targetnode = document.query
selector("#target"); var observer = new mutationobserver(callback); observer.observe(targetnode, { attributes: true, attributeoldvalue: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
Navigator.clipboard - Web APIs
navigator.clipboard.readtext().then( cliptext => document.query
selector(".cliptext").innertext = cliptext); this snippet replaces the contents of the element whose class is "cliptext" with the text contents of the clipboard.
Navigator.share() - Web APIs
the javascript looks like this: const sharedata = { title: 'mdn', text: 'learn web development on mdn!', url: 'https://developer.mozilla.org', } const btn = document.query
selector('button'); const resultpara = document.query
selector('.result'); // must be triggered some kind of "user activation" btn.addeventlistener('click', async () => { try { await navigator.share(sharedata) resultpara.textcontent = 'mdn shared successfully' } catch(err) { resultpara.textcontent = 'error: ' + err } }); sharing files to share files, first test for and call navigator.c...
PannerNode.distanceModel - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode.maxDistance - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode.panningModel - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode.setOrientation() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode.setPosition() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode.setVelocity() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
PannerNode - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.query
selector('.play'); var stop = document.query
selector('.stop'); var boombox = document.query
selector('.boom-box'); var listenerdata = document.query
selector('.listener-data'); var pannerdata = document.query
selector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.po...
ParentNode.replaceChildren() - Web APIs
const noselect = document.getelementbyid('no'); const yesselect = document.getelementbyid('yes'); const nobtn = document.getelementbyid('to-no'); const yesbtn = document.getelementbyid('to-yes'); yesbtn.addeventlistener('click', () => { const selectedtransferoptions = document.query
selectorall('#no option:checked'); const existingyesoptions = document.query
selectorall('#yes option'); yesselect.replacechildren(...selectedtransferoptions, ...existingyesoptions); }); nobtn.addeventlistener('click', () => { const selectedtransferoptions = document.query
selectorall('#yes option:checked'); const existingnooptions = document.query
selectorall('#no option'); noselect.replacechildr...
PasswordCredential.additionalData - Web APIs
navigator.credentials.get(options).then(function(creds) { if (creds.type == 'password') { var form = new formdata(); var csrf_token = document.query
selector('csrf_token').value; form.append('csrf_token', csrf_token); creds.additionaldata = form; fetch('https://www.example.com', { method: 'post', credentials: creds }); }; }); specifications specification status comment credential management level 1 working draft initial definition.
PhotoCapabilities - Web APIs
const input = document.query
selector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.query
selector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings()...
PushManager.getSubscription() - Web APIs
var pushbutton = document.query
selector('.js-push-button'); pushbutton.disabled = false; if (!subscription) { // we aren’t subscribed to push, so set ui // to allow the user to enable push return; } // keep your server in sync with the latest subscriptionid sendsubscriptiontoserver(subscription); showcurlcommand(subscription); // set your ui to ...
RTCIceCandidateStats.deleted - Web APIs
`; // now the statistics for this report; we intentially drop the ones we // sorted to the top above object.keys(report).foreach(statname => { if (statname !== "id" && statname !== "timestamp" && statname !== "type") { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; } }); } }); document.query
selector(".stats-box").innerhtml = statsoutput; }); }, 1000); specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatestats.deleted' in that specification.
RTCIceCandidateStats.networkType - Web APIs
`; // now the statistics for this report; we intentially drop the ones we // sorted to the top above object.keys(report).foreach(statname => { if (statname !== "id" && statname !== "timestamp" && statname !== "type") { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; } }); } }); document.query
selector(".stats-box").innerhtml = statsoutput; }); }, 1000); ...
RTCPeerConnection: iceconnectionstatechange event - Web APIs
pc.addeventlistener("iceconnectionstatechange", ev => { let stateelem = document.query
selector("#call-state"); stateelem.classname = `${pc.iceconnectionstate}-state`; }, false); this can also be written as: pc.oniceconnectionstatechange = ev => { let stateelem = document.query
selector("#call-state"); stateelem.classname = `${pc.iceconnectionstate}-state`; } specifications specification status comment webrtc 1.0: real-time communication between browsersth...
RTCRemoteOutboundRtpStreamStats.localId - Web APIs
async function networkteststop(pc) { if (pc) { let statsbox = document.query
selector(".stats-box"); let endreport = await pc.getstats(); for (let endremoteoutbound of endreport.values()) { if (endremoteoutbound.type === "remote-outbound-rtp") { let startremoteoutbound = startreport.get(endremoteoutbound.id); if (startremoteoutbound) { let startinboundstats = findreportentry(startreport, "remoteid", startremoteoutbound.id); let e...
Range() - Web APIs
html <p>first paragraph.</p> <p>second paragraph.</p> <p>third paragraph.</p> <p>fourth paragraph.</p> javascript const paragraphs = document.query
selectorall('p'); // create new range const range = new range(); // start range at second paragraph range.setstartbefore(paragraphs[1]); // end range at third paragraph range.setendafter(paragraphs[2]); // get window selection const selection = window.getselection(); // add range to window selection selection.addrange(range); result specification specification status comment ...
Range.surroundContents() - Web APIs
example html <span class="header-text">put this in a headline</span> javascript const range = document.createrange(); const newparent = document.createelement('h1'); range.selectnode(document.query
selector('.header-text')); range.surroundcontents(newparent); result specifications specification status comment domthe definition of 'range.surroundcontents()' in that specification.
Report - Web APIs
the report details are displayed via the displayreports() fuction, which takes the observer callback's reports parameter as its parameter: function displayreports(reports) { const outputelem = document.query
selector('.output'); const list = document.createelement('ul'); outputelem.appendchild(list); for(let i = 0; i < reports.length; i++) { let listitem = document.createelement('li'); let textnode = document.createtextnode('report ' + (i + 1) + ', type: ' + reports[i].type); listitem.appendchild(textnode); let innerlist = document.createelement('ul'); listitem.appendchild(innerlist...
ResizeObserver - Web APIs
the javascript looks like so: const h1elem = document.query
selector('h1'); const pelem = document.query
selector('p'); const divelem = document.query
selector('body > div'); const slider = document.query
selector('input[type="range"]'); const checkbox = document.query
selector('input[type="checkbox"]'); divelem.style.width = '600px'; slider.addeventlistener('input', () => { divelem.style.width = slider.value + 'px'; }) const resizeobserver = new resizeobserver(e...
ResizeObserverEntry.borderBoxSize - Web APIs
math.min(100, (entry.borderboxsize[0].inlinesize/10) + (entry.borderboxsize[0].blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.query
selector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
ResizeObserverEntry.contentBoxSize - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.query
selector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
ResizeObserverEntry.target - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.query
selector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
Resize Observer API - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.query
selector('div')); specifications specification status comment resize observer editor's draft initial definition.
Response.clone() - Web APIs
var image1 = document.query
selector('.img1'); var image2 = document.query
selector('.img2'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { var response2 = response.clone(); response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); image1.src = objecturl; }); response2.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob);...
Response.headers - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.headers); // returns a headers{} object response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'headers' in tha...
Response.ok - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.ok); // returns true if the response returned successfully response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition ...
Response.status - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.status); // returns 200 response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'status' in that specification.
Response.statusText - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.statustext); // returns "ok" if the response returned successfully response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe def...
Response.type - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.type); // returns basic by default response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'type' in that specif...
Response.url - Web APIs
var myimage = document.query
selector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.url); // returns /docs/web/api/response/flowers.jpg response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'url...
Response - Web APIs
const image = document.query
selector('.my-image'); fetch('flowers.jpg').then(function(response) { return response.blob(); }).then(function(blob) { const objecturl = url.createobjecturl(blob); image.src = objecturl; }); you can also use the response.response() constructor to create your own custom response object: const response = new response(); specifications specification status comment fetcht...
SVGAElement - Web APIs
var linkref = document.query
selector("a"); linkref.target = "_self"; linkref.onclick = function(){ if (linkref.target === "_blank") { console.log("blank!"); linkref.target = "_self"; } else { console.log("sorry!
SVGAnimationElement: beginEvent event - Web APIs
h="300px" height="100px"> <title>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.query
selector('svg'); let animateelem = document.query
selector('animatemotion'); let list = document.query
selector('ul'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('repeatevent', (e) => { let listitem = document.createelement('li'); let msg = ...
SVGAnimationElement: endEvent event - Web APIs
e>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <button>stop animation</button> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.query
selector('svg'); let animateelem = document.query
selector('animatemotion'); let list = document.query
selector('ul'); let btn = document.query
selector('button'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('endevent', () => { let listitem = doc...
SVGAnimationElement: repeatEvent event - Web APIs
h="300px" height="100px"> <title>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.query
selector('svg'); let animateelem = document.query
selector('animatemotion'); let list = document.query
selector('ul'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('repeatevent', (e) => { let listitem = document.createelement('li'); let msg = '...
getBBox() - Web APIs
world!</text> <text x="8" y="32" transform="translate(0 20) scale(1.25 1)">hello world again!</text> </g> <!-- shows bbox in green --> <rect id="rect_1" stroke="#00ff00" stroke-width="3" fill="none"> </rect> <!-- shows boundingclientrect in red --> <rect id="rect_2" stroke="#ff0000" stroke-width="3" fill="none"></rect> </svg> javascript var rectbbox = document.query
selector('#rect_1'); var rectboundingclientrect = document.query
selector('#rect_2'); var groupelement = document.query
selector('#group_text_1'); var bboxgroup = groupelement.getbbox(); rectbbox.setattribute('x', bboxgroup.x); rectbbox.setattribute('y', bboxgroup.y); rectbbox.setattribute('width', bboxgroup.width); rectbbox.setattribute('height', bboxgroup.height); var boundingclientrectgroup = groupelem...
ScriptProcessorNode.bufferSize - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.query
selector('script'); var mypre = document.query
selector('pre'); var playbutton = document.query
selector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(scriptn...
ScriptProcessorNode.onaudioprocess - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.query
selector('script'); var mypre = document.query
selector('pre'); var playbutton = document.query
selector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(s...
ScriptProcessorNode - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.query
selector('script'); var mypre = document.query
selector('pre'); var playbutton = document.query
selector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(scriptn...
Selection.addRange() - Web APIs
html <p>i <strong>insist</strong> that you <strong>try</strong> selecting the <strong>strong words</strong>.</p> <button>select strong words</button> javascript let button = document.query
selector('button'); button.addeventlistener('click', function () { let selection = window.getselection(); let strongs = document.getelementsbytagname('strong'); if (selection.rangecount > 0) { selection.removeallranges(); } for (let i = 0; i < strongs.length; i++) { let range = document.createrange(); range.selectnode(strongs[i]); selection.addrange(range); } }); result ...
Selection.deleteFromDocument() - Web APIs
once you do, you can remove the selected content by clicking the button below.</p> <button>delete selected text</button> javascript let button = document.query
selector('button'); button.addeventlistener('click', deleteselection); function deleteselection() { let selection = window.getselection(); selection.deletefromdocument(); } result specifications specification status comment selection apithe definition of 'selection.deletefromdocument()' in that specification.
Selection.modify() - Web APIs
">line</option> <option value="paragraph">paragraph</option> <option value="lineboundary">line boundary</option> <option value="sentenceboundary">sentence boundary</option> <option value="paragraphboundary">paragraph boundary</option> <option value="documentboundary">document boundary</option> </select> <br><br> <button>extend selection</button> javascript let select = document.query
selector('select'); let button = document.query
selector('button'); button.addeventlistener('click', modify); function modify() { let selection = window.getselection(); selection.modify('extend', 'forward', select.value); } result specifications this method is not part of any specification.
Selection.selectAllChildren() - Web APIs
example html <main> <button>select footer</button> <p>welcome to my website.</p> <p>i hope you enjoy your visit.</p> </main> <footer> <address>webmaster@example.com</address> <p>© 2019</p> </footer> javascript const button = document.query
selector('button'); const footer = document.query
selector('footer'); button.addeventlistener('click', (e) => { window.getselection().selectallchildren(footer); }); result specifications specification status comment selection apithe definition of 'selection.selectallchildren()' in that specification.
Selection.setBaseAndExtent() - Web APIs
for="aoffset">anchor offset</label> <input id="aoffset" name="aoffset" type="number" value="0"> </p> <p> <label for="foffset">focus offset</label> <input id="foffset" name="foffset" type="number" value="0"> </p> <p><button>capture selection</button></p> </div> <p><strong>output</strong>: <span class="output"></span></p> the javascript looks like so: var one = document.query
selector('.one'); var two = document.query
selector('.two'); var aoffset = document.getelementbyid('aoffset'); var foffset = document.getelementbyid('foffset'); var button = document.query
selector('button'); var output = document.query
selector('.output'); var selection; button.onclick = function() { try { selection = document.getselection(); selection.setbaseandextent(one, aoffset.value, two...
ServiceWorker.onstatechange - Web APIs
var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.query
selector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.query
selector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.query
selector('#kind').textcontent = 'active'; } if (serviceworker) { logstate(serviceworker.state); serviceworker.addeventlistener('statec...
ServiceWorker.state - Web APIs
var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.query
selector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.query
selector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.query
selector('#kind').textcontent = 'active'; } if (serviceworker) { logstate(serviceworker.state); serviceworker.addeventlistener('statec...
ServiceWorker - Web APIs
if ('serviceworker' in navigator) { navigator.serviceworker.register('service-worker.js', { scope: './' }).then(function (registration) { var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.query
selector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.query
selector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.query
selector('#kind').textcontent = 'active'; } if (serviceworker) { ...
ServiceWorkerContainer.getRegistration() - Web APIs
example navigator.serviceworker.getregistration('/app').then(function(registration) { if(registration){ document.query
selector('#status').textcontent = 'serviceworkerregistration found.'; } }); specifications specification status comment service workersthe definition of 'serviceworkercontainer: getregistration' in that specification.
ServiceWorkerContainer.getRegistrations() - Web APIs
example navigator.serviceworker.getregistrations().then(function(registrations) { document.query
selector('#status').textcontent = 'serviceworkerregistrations found.'; }); specifications specification status comment service workersthe definition of 'getregistrations()' in that specification.
Using Service Workers - Web APIs
when we come to call the imgload() function, we call it with the url to the image we want to load, as we might expect, but the rest of the code is a little different: let body = document.query
selector('body'); let myimage = new image(); imgload('mylittlevader.jpg').then((response) => { var imageurl = window.url.createobjecturl(response); myimage.src = imageurl; body.appendchild(myimage); }, (error) => { console.log(error); }); on to the end of the function call, we chain the promise then() method, which contains two functions — the first one is executed when the promise successfull...
ShadowRoot.host - Web APIs
examples let customelem = document.query
selector('my-shadow-dom-element'); let shadow = customelem.shadowroot; ...
ShadowRoot.innerHTML - Web APIs
examples let customelem = document.query
selector('my-shadow-dom-element'); let shadow = customelem.shadowroot; shadow.innerhtml = '<strong>this element should be more important!</strong>'; specifications this property is not defined by any specifications yet; see this open spec issue to specify it.
ShadowRoot.mode - Web APIs
examples let customelem = document.query
selector('my-shadow-dom-element'); let shadow = customelem.shadowroot; // another way to check whether the shadow root is open; it will return null if not if(shadow) { // if it is open, close it to stop people stealing our secrets!
Slottable: assignedSlot - Web APIs
let slottedspan = document.query
selector('my-paragraph span') console.log(slottedspan.assignedslot); // logs '<slot name="my-text">' specifications specification status comment domthe definition of 'assignedslot' in that specification.
SourceBuffer - Web APIs
this example was written by nick desaulniers and can be viewed live here (you can also download the source for further investigation.) var video = document.query
selector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource(); //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(medi...
SpeechRecognition.abort() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.query
selector('.output'); var bg = document.query
selector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specificati...
SpeechRecognition.start() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.query
selector('.output'); var bg = document.query
selector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specificati...
SpeechRecognition.stop() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.query
selector('.output'); var bg = document.query
selector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specificati...
SpeechRecognition - Web APIs
tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; recognition.continuous = false; recognition.lang = 'en-us'; recognition.interimresults = false; recognition.maxalternatives = 1; var diagnostic = document.query
selector('.output'); var bg = document.query
selector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } recognition.onresult = function(event) { var color = event.results[0][0].transcript; diagnostic.textcontent = 'result received: ' + color; bg.style.backgroundcolor = color; } specifications specification status...
SpeechSynthesis - Web APIs
var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('.txt'); var voiceselect = document.query
selector('select'); var pitch = document.query
selector('#pitch'); var pitchvalue = document.query
selector('.pitch-value'); var rate = document.query
selector('#rate'); var ratevalue = document.query
selector('.rate-value'); var voices = []; function populatevoicelist() { voices = synth.getvoices(); for(i...
SpeechSynthesisErrorEvent.error - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisErrorEvent - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.lang - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onboundary - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onend - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onerror - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onmark - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onpause - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onresume - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.onstart - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.pitch - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.rate - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.text - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.voice - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance.volume - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); var voices = synth.getvoices(); ...
SpeechSynthesisUtterance - Web APIs
var synth = window.speechsynthesis; var voices = synth.getvoices(); var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); for(var i = 0; i < voices.length; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; option.value = i; voiceselect.appendchild(option); } inputform.onsubmit = function(event) { event.preventdefault(); var ...
StereoPannerNode.pan - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.query
selector('audio'); var pancontrol = document.query
selector('.panning-control'); var panvalue = document.query
selector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler function...
StereoPannerNode - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.query
selector('audio'); var pancontrol = document.query
selector('.panning-control'); var panvalue = document.query
selector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler function...
StylePropertyMapReadOnly.get() - Web APIs
// get the element const myelement = document.query
selector('a'); // get the <dl> we'll be populating const styleslist = document.query
selector('#regurgitation'); // retrieve all computed styles with computedstylemap() const stylemap = myelement.computedstylemap(); // array of properties we're interested in const ofinterest = ['font-weight', 'border-left-color', 'color', '--colour']; // iterate thru our properties of interest for ( let i = 0; i < ofin...
StylePropertyMapReadOnly - Web APIs
// get the element const myelement = document.query
selector('p'); // get the <dl> we'll be populating const styleslist = document.query
selector('#output'); // retrieve all computed styles with computedstylemap() const stylepropertymap = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of stylepropertymap) { // properties const cssproperty = document.createel...
SubmitEvent() - Web APIs
const form = document.query
selector("form"); const formtrigger = form.query
selector("button.submit"); const submitevent = new submitevent("submit", { submitter: formtrigger }); form.dispatchevent(submitevent); this is a somewhat contrived example, as you can do nearly all of this much more easily, but this gives you deep control over the process that can be useful.
SubmitEvent.submitter - Web APIs
let form = document.query
selector("form"); form.addeventlistener("submit", (event) => { let submitter = event.submitter; let handler = submitter.id; if (handler) { processorder(form, handler); } else { showalertmessage("an unknown or unaccepted payment type was selected.
SubmitEvent - Web APIs
let form = document.query
selector("form"); form.addeventlistener("submit", (event) => { let submitter = event.submitter; let handler = submitter.id; if (handler) { processorder(form, handler); } else { showalertmessage("an unknown or unaccepted payment type was selected.
Text.splitText() - Web APIs
html <p>foobar</p> javascript const p = document.query
selector('p'); // get contents of <p> as a text node const foobar = p.firstchild; // split 'foobar' into two text nodes, 'foo' and 'bar', // and save 'bar' as a const const bar = foobar.splittext(3); // create a <u> element containing ' new content ' const u = document.createelement('u'); u.appendchild(document.createtextnode(' new content ')); // add <u> before 'bar' p.insertbefore(u, bar); // the r...
TextEncoder.prototype.encode() - Web APIs
examples <p class="source">this is a sample paragraph.</p> <p class="result">encoded result: </p> const sourcepara = document.query
selector('.source'); const resultpara = document.query
selector('.result'); const string = sourcepara.textcontent; const textencoder = new textencoder(); let encoded = textencoder.encode(string); resultpara.textcontent += encoded; specifications specification status comment encodingthe definition of 'textencoder.prototype.encode()' in that specification.
TextEncoder.prototype.encodeInto() - Web APIs
u8array.subarray(position|0) : u8array); if (stats.written < u8array.length) u8array[stats.written] = 0; // append null if room return stats; } examples <p class="source">this is a sample paragraph.</p> <p class="result"></p> const sourcepara = document.query
selector('.source'); const resultpara = document.query
selector('.result'); const string = sourcepara.textcontent; const textencoder = new textencoder(); const utf8 = new uint8array(string.length); let encodedresults = textencoder.encodeinto(string, utf8); resultpara.textcontent += 'bytes read: ' + encodedresults.read + ' | bytes written: ' + encodedresults.written + ...
TextTrack.mode - Web APIs
window.addeventlistener("load", event => { let trackelem = document.query
selector("track"); let track = trackelem.track; track.mode = "showing"; for (let index=0; index < track.cues.length; index++) { let cue = track.cues[index]; cue.pauseonexit = true; }; }); specifications specification status comment html living standardthe definition of 'mode' in that specification.
TextTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const mediaelement = document.query
selector('video, audio'); mediaelement.texttracks.addeventlistener('addtrack', (event) => { console.log(`text track: ${event.track.label} added`); }); using the onaddtrack event handler property: const mediaelement = document.query
selector('video, audio'); mediaelement.texttracks.onaddtrack = (event) => { console.log(`text track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
TextTrackList: change event - Web APIs
bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const mediaelement = document.query
selectorall('video, audio')[0]; mediaelement.texttracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); using the onchange event handler property: const mediaelement = document.query
selector('video, audio'); mediaelement.texttracks.onchange = (event) => { console.log(`'${event.type}' event fired`); }; specifications specification status html living standardthe definition of 'change' in that specification.
TextTrackList.onaddtrack - Web APIs
document.query
selector("video").texttracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'texttracklist: onaddtrack' in that specification.
TextTrackList.onremovetrack - Web APIs
document.query
selectorall("video, audio")[0].texttracks.onremovetrack = function(event) { mytrackcount = document.query
selectorall("video, audio")[0].texttracks.length; }; the current number of text tracks remaining in the media element is obtained from texttracklist property length.
TextTrackList: removeTrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const mediaelement = document.query
selector('video, audio'); mediaelement.texttracks.addeventlistener('removetrack', (event) => { console.log(`text track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const mediaelement = document.query
selector('video, audio'); mediaelement.texttracks.onremovetrack = (event) => { console.log(`text track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specification.
TextTrackList - Web APIs
var texttracks = document.query
selector("video").texttracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
TrackEvent - Web APIs
var videoelem = document.query
selector("video"); videoelem.videotracks.addeventlistener("addtrack", handletrackevent, false); videoelem.videotracks.addeventlistener("removetrack", handletrackevent, false); videoelem.audiotracks.addeventlistener("addtrack", handletrackevent, false); videoelem.audiotracks.addeventlistener("removetrack", handletrackevent, false); videoelem.texttracks.addeventlistener("addtrack", handletrackevent, false)...
VRStageParameters - Web APIs
examples var info = document.query
selector('p'); var vrdisplay; navigator.getvrdisplays().then(function(displays) { vrdisplay = displays[0]; var stageparams = vrdisplay.stageparameters; // stageparams is a vrstageparameters object if(stageparams === null) { info.textcontent = 'your vr hardware does not support room-scale experiences.' } else { info.innerhtml = '<strong>display stage parameters</strong>' ...
VTTCue - Web APIs
example html <video controls src="https://udn.realityripple.com/samples/c6/f8a3489533.webm"></video> css video { width: 320px; height: 180px; } javascript let video = document.query
selector('video'); video.addeventlistener('loadedmetadata', () => { const track = video.addtexttrack("captions", "简体中文subtitles", "zh_cn"); track.mode = "showing"; const cuecn = new vttcue(0, 2.500, '字幕会在0至2.5秒间显示'); track.addcue(cuecn); const cueen = new vttcue(2.6, 4, 'subtitles will display between 2.6 and 4 seconds'); track.addcue(cueen); }); result chrome...
VideoTrack - Web APIs
usage notes to get a videotrack for a given media element, use the element's videotracks property, which returns a videotracklist object from which you can get the individual tracks contained in the media: var el = document.query
selector("video"); var tracks = el.videotracks; you can then access the media's individual tracks using either array syntax or functions such as foreach().
VideoTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.videotracks.addeventlistener('addtrack', (event) => { console.log(`video track: ${event.track.label} added`); }); using the onaddtrack event handler property: const videoelement = document.query
selector('video'); videoelement.videotracks.onaddtrack = (event) => { console.log(`video track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
VideoTrackList.onaddtrack - Web APIs
document.query
selector("video").videotracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'videotracklist: onaddtrack' in that specification.
VideoTrackList.onchange - Web APIs
var tracklist = document.query
selector("video").videotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackselectedbutton(track.id, track.selected); }); }; the updatetrackselectedbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's selected flag to determ...
VideoTrackList.onremovetrack - Web APIs
document.query
selector("my-video").videotracks.onremovetrack = function(event) { mytrackcount = document.query
selector("my-video").videotracks.length; }; the current number of video tracks remaining in the media element is obtained from videotracklist property length.
VideoTrackList: removetrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const videoelement = document.query
selector('video'); videoelement.videotracks.addeventlistener('removetrack', (event) => { console.log(`video track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const videoelement = document.query
selector('video'); videoelement.videotracks.onremovetrack = (event) => { console.log(`video track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specification.
VideoTrackList - Web APIs
var videotracks = document.query
selector("video").videotracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
WebGLRenderingContext.makeXRCompatible() - Web APIs
javascript the code that handles starting up graphics, switching to vr mode, and so forth looks like this: const outputcanvas = document.query
selector(".output-canvas"); const gl = outputcanvas.getcontext("webgl"); let xrsession = null; let usingxr = false; let currentscene = "scene1"; let glstartbutton; let xrstartbutton; window.addeventlistener("load", (event) => { loadsceneresources(currentscene); glstartbutton.addeventlistener("click", handlestartbuttonclick); xrstartbutton.addeventlistener("click", handlestartbuttonclick); }); out...
WebGLRenderingContext - Web APIs
firstcanvas = document.getelementsbytagname("canvas")[0], secondcanvas = document.getelementsbytagname("canvas")[1]; firstcanvas.width = firstcanvas.clientwidth; firstcanvas.height = firstcanvas.clientheight; [firstcanvas, secondcanvas].foreach(function(canvas) { var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.query
selector("p").innerhtml = "failed to get webgl context.
Basic scissoring - Web APIs
ser does not seem to support html5 canvas.</canvas> body { text-align : center; } canvas { display : block; width : 280px; height : 210px; margin : auto; padding : 0; border : none; background-color : black; } window.addeventlistener("load", function setupwebgl (evt) { "use strict" window.removeeventlistener(evt.type, setupwebgl, false); var paragraph = document.query
selector("p"); var canvas = document.query
selector("canvas"); // the following two lines set the size (in css pixels) of // the drawing buffer to be identical to the size of the // canvas html element, as determined by css.
Boilerplate 1 - Web APIs
r does not seem to support html5 canvas.</canvas> css body { text-align : center; } canvas { display : block; width : 280px; height : 210px; margin : auto; padding : 0; border : none; background-color : black; } button { display : block; font-size : inherit; margin : auto; padding : 0.6em; } javascript function getrenderingcontext() { var canvas = document.query
selector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.query
selector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.dr...
Canvas size and WebGL - Web APIs
firstcanvas = document.getelementsbytagname("canvas")[0], secondcanvas = document.getelementsbytagname("canvas")[1]; firstcanvas.width = firstcanvas.clientwidth; firstcanvas.height = firstcanvas.clientheight; [firstcanvas, secondcanvas].foreach(function(canvas) { var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.query
selector("p").innerhtml = "failed to get webgl context.
Clearing by clicking - Web APIs
var canvas = document.query
selector("#canvas-view"); var button = document.query
selector("#color-switcher"); canvas.addeventlistener("click", switchcolor, false); button.addeventlistener("click", switchcolor, false); // a variable to hold the webglrenderingcontext.
Clearing with colors - Web APIs
var paragraph = document.query
selector("p"), canvas = document.query
selector("canvas"); // getting the webgl rendering context.
Detect WebGL - Web APIs
window.addeventlistener("load", function() { var paragraph = document.query
selector("p"), button = document.query
selector("button"); // adding click event handler to button.
Simple color animation - Web APIs
var button = document.query
selector("#animation-onoff"); var verb = document.query
selector("strong"); function startanimation(evt) { button.removeeventlistener(evt.type, startanimation, false); button.addeventlistener("click", stopanimation, false); verb.innerhtml="stop"; // setup animation loop by redrawing every second.
Getting started with WebGL - Web APIs
// // start here // function main() { const canvas = document.query
selector("#glcanvas"); // initialize the gl context const gl = canvas.getcontext("webgl"); // only continue if webgl is available and working if (gl === null) { alert("unable to initialize webgl.
Establishing a connection: The WebRTC perfect negotiation pattern - Web APIs
const constraints = { audio: true, video: true }; const config = { iceservers: [{ urls: "stun:stun.mystunserver.tld" }] }; const selfvideo = document.query
selector("video.selfview"); const remotevideo = document.query
selector("video.remoteview"); const signaler = new signalingchannel(); const pc = new rtcpeerconnection(config); this code also gets the <video> elements using the classes "selfview" and "remoteview"; these will contain, respectively, the local user's self-view and the view of the incoming stream from the remote peer.
Signaling and video calling - Web APIs
function handleuserlistmsg(msg) { var i; var listelem = document.query
selector(".userlistbox"); while (listelem.firstchild) { listelem.removechild(listelem.firstchild); } msg.users.foreach(function(username) { var item = document.createelement("li"); item.appendchild(document.createtextnode(username)); item.addeventlistener("click", invite, false); listelem.appendchild(item); }); } after getting a reference to the <ul> which contains the list...
Using DTMF with WebRTC - Web APIs
window.addeventlistener("load", function() { logelement = document.query
selector(".log"); dialbutton = document.query
selector("#dial"); dialbutton.addeventlistener("click", connectanddial, false); }); starting the connection process when the dial button is clicked, connectanddial() is called.
WebRTC Statistics API - Web APIs
err); } function getconnectionstats() { mypeerconnection.getstats(null).then(stats => { var statsoutput = ""; stats.foreach(report => { if (report.type === "inbound-rtp" && report.kind === "video") { object.keys(report).foreach(statname => { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; }); } }); document.query
selector(".stats-box").innerhtml = statsoutput; }); } when the promise returned by getstats() is fulfilled, the resolution handler receives as input an rtcstatsreport object containing the statistics information.
Writing a WebSocket server in C# - Web APIs
> <style> textarea { vertical-align: bottom; } #output { overflow: auto; } #output > p { overflow-wrap: break-word; } #output span { color: blue; } #output span.error { color: red; } </style> <h2>websocket test</h2> <textarea cols=60 rows=6></textarea> <button>send</button> <div id=output></div> <script> // http://www.websocket.org/echo.html var button = document.query
selector("button"), output = document.query
selector("#output"), textarea = document.query
selector("textarea"), // wsuri = "ws://echo.websocket.org/", wsuri = "ws://127.0.0.1/", websocket = new websocket(wsuri); button.addeventlistener("click", onclickbutton); websocket.onopen = function (e) { writetoscreen("connected"); dosend("websocket ro...
Starting up and shutting down a WebXR session - Web APIs
in basic form, code to do this final setup might look something like this: async function runsession(session) { let worlddata; session.addeventlistener("end", onsessionend); let canvas = document.query
selector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); // set up webgl data and such worlddata = loadglprograms(session, "worlddata.xml"); if (!worlddata) { return null; } // finish configuring webgl worlddata.session.updaterenderstate({ baselayer: new xrwebgllayer(worlddata.session, gl) }); // start rendering the scene referencespace = await worldda...
Controlling multiple parameters with ConstantSourceNode - Web APIs
function setup() { context = new (window.audiocontext || window.webkitaudiocontext)(); playbutton = document.query
selector("#playbutton"); volumecontrol = document.query
selector("#volumecontrol"); playbutton.addeventlistener("click", toggleplay, false); volumecontrol.addeventlistener("input", changevolume, false); gainnode1 = context.creategain(); gainnode1.gain.value = 0.5; gainnode2 = context.creategain(); gainnode3 = context.creategain(); gainnode2.gain.value = gainnode1.gain.value; gainnode3.
Using IIR filters - Web APIs
// create a canvas element and append it to our dom const canvascontainer = document.query
selector('.filter-graph'); const canvasel = document.createelement('canvas'); canvascontainer.appendchild(canvasel); // set 2d context and set dimesions const canvasctx = canvasel.getcontext('2d'); const width = canvascontainer.offsetwidth; const height = canvascontainer.offsetheight; canvasel.width = width; canvasel.height = height; // set background fill canvasctx.fillstyle = 'white'; canvasctx.fillre...
Web audio spatialization basics - Web APIs
finally, we'll set some bounds so our boombox doesn't move too far in any direction: const movecontrols = document.query
selector('#move-controls').query
selectorall('button'); const boombox = document.query
selector('.boombox-body'); // the values for our css transforms let transform = { xaxis: 0, yaxis: 0, zaxis: 0.8, rotatex: 0, rotatey: 0 } // set our bounds const topbound = -posy; const bottombound = posy; const rightbound = posx; const leftbound = -posx; const innerbound = 0.1; const outerbound = 1...
Using the Web Storage API - Web APIs
on the events page (see events.js) the only javascript is as follows: window.addeventlistener('storage', function(e) { document.query
selector('.my-key').textcontent = e.key; document.query
selector('.my-old').textcontent = e.oldvalue; document.query
selector('.my-new').textcontent = e.newvalue; document.query
selector('.my-url').textcontent = e.url; document.query
selector('.my-storage').textcontent = json.stringify(e.storagearea); }); here we add an event listener to the window object that fires when the storage object associated...
Window.devicePixelRatio - Web APIs
let pixelratiobox = document.query
selector(".pixel-ratio"); let mqstring = `(resolution: ${window.devicepixelratio}dppx)`; const updatepixelratio = () => { let pr = window.devicepixelratio; let prstring = (pr * 100).tofixed(0); pixelratiobox.innertext = `${prstring}% (${pr.tofixed(2)})`; } updatepixelratio(); matchmedia(mqstring).addlistener(updatepixelratio); the string mqstring is set up to be the media query itself.
Window: error event - Web APIs
css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } button { height: 2rem; margin: .5rem; } img { width: 0; height: 0; } js const log = document.query
selector('.event-log-contents'); window.addeventlistener('error', (event) => { log.textcontent = log.textcontent + `${event.type}: ${event.message}\n`; console.log(event) }); const scripterror = document.query
selector('#script-error'); scripterror.addeventlistener('click', () => { const badcode = 'const s;'; eval(badcode); }); result specifications specification status ...
Window: load event - Web APIs
g-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.query
selector('.event-log-contents'); const reload = document.query
selector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent =...
Window.matchMedia() - Web APIs
javascript let mql = window.matchmedia('(max-width: 600px)'); document.query
selector(".mq-value").innertext = mql.matches; the javascript code simply passes the media query to match into matchmedia() to compile it, then sets the <span>'s innertext to the value of the results' matches property, so that it indicates whether or not the document matches the media query at the moment the page was loaded.
Window: message event - Web APIs
bubbles no cancelable no interface messageevent event handler property onmessage examples suppose a script sends a message to a different browsing context, such as another <iframe>, using code like this: const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const windowmessagebutton = document.query
selector('#window-message'); windowmessagebutton.addeventlistener('click', () => { targetframe.postmessage('hello there', targetorigin); }); the receiver can listen for the message using addeventlistener() with code like this: window.addeventlistener('message', (event) => { console.log(`received message: ${event.data}`); }); alternatively the listener could use the onmessage event handler prop...
Window: resize event - Web APIs
<p>resize the browser window to fire the <code>resize</code> event.</p> <p>window height: <span id="height"></span></p> <p>window width: <span id="width"></span></p> const heightoutput = document.query
selector('#height'); const widthoutput = document.query
selector('#width'); function reportwindowsize() { heightoutput.textcontent = window.innerheight; widthoutput.textcontent = window.innerwidth; } window.onresize = reportwindowsize; addeventlistener equivalent you could set up the event handler using the addeventlistener() method: window.addeventlistener('resize', reportwindowsize); specific...
Window.speechSynthesis - Web APIs
var synth = window.speechsynthesis; var inputform = document.query
selector('form'); var inputtxt = document.query
selector('input'); var voiceselect = document.query
selector('select'); function populatevoicelist() { voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- de...
Worker - Web APIs
example the following code snippet creates a worker object using the worker() constructor, then uses the worker object: var myworker = new worker('/worker.js'); var first = document.query
selector('input#number1'); var second = document.query
selector('input#number2'); first.onchange = function() { myworker.postmessage([first.value, second.value]); console.log('message posted to worker'); } for a full example, see ourbasic dedicated worker example (run dedicated worker).
WritableStream.WritableStream() - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStream.getWriter() - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStream - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStreamDefaultWriter.WritableStreamDefaultWriter() - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStreamDefaultWriter.close() - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStreamDefaultWriter.write() - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) .t...
WritableStreamDefaultWriter - Web APIs
const list = document.query
selector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }...
XMLHttpRequest: abort event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XMLHttpRequest: error event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XMLHttpRequest: load event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XMLHttpRequest: loadend event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XMLHttpRequest: loadstart event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XMLHttpRequest: progress event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.query
selector('.xhr.success'); const xhrbuttonerror = document.query
selector('.xhr.error'); const xhrbuttonabort = document.query
selector('.xhr.abort'); const log = document.query
selector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.addev...
XPathEvaluator.createExpression() - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator.createexpression()' in that specification.
XPathEvaluator.evaluate() - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var evaluator = new xpathevaluator(); var result = evaluator.evaluate("//div", document, null, xpathresult.ordered_node_snapshot_type); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator.evaluate()' in that specification.
XPathEvaluator - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator' in that specification.
XPathExpression.evaluate() - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathexpression.evaluate()' in that specification.
XPathExpression - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression(xpath); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathexpression' in that specification.
XPathResult.booleanValue - Web APIs
html <div>xpath example</div> <p>text is 'xpath example': <output></output></p> javascript var xpath = "//div/text() = 'xpath example'"; var result = document.evaluate(xpath, document, null, xpathresult.boolean_type, null); document.query
selector("output").textcontent = result.booleanvalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.booleanvalue' in that specification.
XPathResult.invalidIteratorState - Web APIs
html <div>xpath example</div> <p>iterator state: <output></output></p> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); // invalidates the iterator state document.query
selector("div").remove(); document.query
selector("output").textcontent = result.invaliditeratorstate ?
XPathResult.iterateNext() - Web APIs
html <div>xpath example</div> <div>tag names of the matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); var node = null; var tagnames = []; while(node = result.iteratenext()) { tagnames.push(node.localname); } document.query
selector("output").textcontent = tagnames.join(", "); result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.iteratenext()' in that specification.
XPathResult.numberValue - Web APIs
html <div>xpath example</div> <div>number of <div>s: <output></output></div> javascript var xpath = "count(//div)"; var result = document.evaluate(xpath, document, null, xpathresult.number_type, null); document.query
selector("output").textcontent = result.numbervalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.numbervalue' in that specification.
XPathResult.resultType - Web APIs
html <div>xpath example</div> <div>is xpath result a node set: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); document.query
selector("output").textcontent = result.resulttype >= xpathresult.unordered_node_iterator_type && result.resulttype <= xpathresult.first_ordered_node_type; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.resulttype' in that specification.
XPathResult.singleNodeValue - Web APIs
html <div>xpath example</div> <div>tag name of the element having the text content 'xpath example': <output></output></div> javascript var xpath = "//*[text()='xpath example']"; var result = document.evaluate(xpath, document, null, xpathresult.first_ordered_node_type, null); document.query
selector("output").textcontent = result.singlenodevalue.localname; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.singlenodevalue' in that specification.
XPathResult.snapshotItem() - Web APIs
html <div>xpath example</div> <div>tag names of the matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.ordered_node_snapshot_type, null); var node = null; var tagnames = []; for(var i = 0; i < result.snapshotlength; i++) { var node = result.snapshotitem(i); tagnames.push(node.localname); } document.query
selector("output").textcontent = tagnames.join(", "); result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.snapshotitem()' in that specification.
XPathResult.snapshotLength - Web APIs
html <div>xpath example</div> <div>number of matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.ordered_node_snapshot_type, null); document.query
selector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.snapshotlength' in that specification.
XPathResult.stringValue - Web APIs
html <div>xpath example</div> <div>text content of the <div> above: <output></output></div> javascript var xpath = "//div/text()"; var result = document.evaluate(xpath, document, null, xpathresult.string_type, null); document.query
selector("output").textcontent = result.stringvalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.stringvalue' in that specification.
XRRenderState.baseLayer - Web APIs
examples you can set the xrwebgllayer used for rendering by calling updaterenderstate(), like this: let canvas = document.query
selector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); setnewwebgllayer(); function setnewwebgllayer(gl) { if (!gl) { /* webgl not available */ return; } xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl); }); }; here, the canvas obtained in the first line is the canvas into which webgl is going to draw.
Using the link role - Accessibility
-href="https://mozilla.org" tabindex="0" id="link1" role="link" class="link"> fake accessible link created using a span </span> <p><a href="https://mozilla.org" target="_blank">actual real link</a></p> css span[role="link"] { color: blue; text-decoration: underline; cursor: pointer; } span[role="link"]:focus { outline: 1px dotted black; } javascript const spanelem = document.query
selector('span'); //handles clicks and keydowns on the link function navigatelink(e) { if (e.type === 'click' || e.key === 'enter') { let ref = e.target != null ?
Using the slider role - Accessibility
<label for="fader">volume</label> <input type="range" id="fader" min="1" max="100" value="50" step="1" aria-valuemin="1" aria-valuemax="100" aria-valuenow="50" oninput="outputupdate(value)"> <output for="fader" id="volume">50</output> the following code snippet allows you to return the output as it is updated by user input: function outputupdate(vol) { document.query
selector('#volume').value = vol; } example 2: text values sometimes, a slider is used to choose a value that is not, semantically, a number.
x-ms-aria-flowfrom - Accessibility
syntax x-ms-aria-flowfrom="elementid"; value the x-ms-aria-flowfrom property value uses an id
selector to define which previous element the reading order will flow from.
ARIA: alert role - Accessibility
<button type="button" onclick="triggeralert">trigger alert</button> <p class="alert">the alert will trigger when the button is pressed.</p> function triggeralert() { var alertel = document.query
selector('.alert'); alertel.addattribute("role", "alert"); } accessibility concerns the alert role should read out content that has changed, or bring the user's attention to it immediately, so it should not be used for static content or used regularly.
:placeholder-shown - CSS: Cascading Style Sheets
input type="number" pattern="[0-9]{8}" title="8 digit id" id="sid" class="studentid" placeholder="8 digit id"/> </p> <input type="submit"/> </form> css input { background-color: #e8e8e8; color: black; } input.studentid:placeholder-shown { background-color: yellow; color: red; font-style: italic; } result specifications specification status comment
selectors level 4the definition of ':placeholder-shown' in that specification.
@document - CSS: Cascading Style Sheets
@document is currently only supported in firefox; if you wanted to replicate using such functionality in your own non-firefox browser, you could try using this polyfill by @an-error94, which uses a combination of a user script, data-* attributes, and attribute
selectors.
Coordinate systems - CSS: Cascading Style Sheets
let inner = document.query
selector(".inner"); let log = document.query
selector(".log"); function setcoords(e, type) { let idx = type + "x"; let idy = type + "y"; document.getelementbyid(idx).innertext = e[idx]; document.getelementbyid(idy).innertext = e[idy]; } a reference to the <div> inside the inner box which contains the paragraphs that will show the coordinate information is fetched into log.
animation - CSS: Cascading Style Sheets
ransform: scalex(0); } to { transform: scalex(1); } } .a1 { animation: 3s ease-in 1s 2 reverse both paused slidein; } .a2 { animation: 3s linear 1s slidein; } .a3 { animation: 3s slidein; } .animation { background: #3f87a6; width: 100%; height: calc(100% - 1.5em); transform-origin: left center; } window.addeventlistener('load', function () { var animation = array.from(document.query
selectorall('.animation')); var button = array.from(document.query
selectorall('button')); function togglebutton (btn, type) { btn.classlist.remove('play', 'pause', 'restart'); btn.classlist.add(type); btn.title = type.touppercase(type); } function playpause (i) { var btn = button[i]; var anim = animation[i]; if (btn.classlist.contains('play')) { anim.style.anim...
<blend-mode> - CSS: Cascading Style Sheets
<option>hue</option> <option>saturation</option> <option>color</option> <option>luminosity</option> </select> css div { width: 300px; height: 300px; background: url(https://media.prod.mdn.mozit.cloud/attachments/2020/07/29/17350/3b4892b7e820122ac6dd7678891d4507/firefox.png) no-repeat center, linear-gradient(to bottom, blue, orange); } javascript const selectelem = document.query
selector('select'); const divelem = document.query
selector('div'); selectelem.addeventlistener('change', () => { divelem.style.backgroundblendmode = selectelem.value; }); result specifications specification status comment compositing and blending level 1the definition of '<blend-mode>' in that specification.
border-image-slice - CSS: Cascading Style Sheets
6/bb98f533ef.png); border-image-slice: 30; border-image-repeat: round; } li { display: flex; place-content: center; } javascript const widthslider = document.getelementbyid('width'); const sliceslider = document.getelementbyid('slice'); const widthoutput = document.getelementbyid('width-output'); const sliceoutput = document.getelementbyid('slice-output'); const divelem = document.query
selector('div > div'); widthslider.addeventlistener('input', () => { const newvalue = widthslider.value + 'px'; divelem.style.borderwidth = newvalue; widthoutput.textcontent = newvalue; }) sliceslider.addeventlistener('input', () => { const newvalue = sliceslider.value; divelem.style.borderimageslice = newvalue; sliceoutput.textcontent = newvalue; }) result specifications speci...
<color> - CSS: Cascading Style Sheets
html <div></div> <hr> <label for="color">enter a valid color value:</label> <input type="text" id="color"> css div { width: 100%; height: 200px; } javascript const inputelem = document.query
selector('input'); const divelem = document.query
selector('div'); function validtextcolor(stringtotest) { if (stringtotest === "") { return false; } if (stringtotest === "inherit") { return false; } if (stringtotest === "transparent") { return false; } const image = document.createelement("img"); image.style.color = "rgb(0, 0, 0)"; image.style.color = stringtotest; if (image.style.color !=...
display - CSS: Cascading Style Sheets
<option>list-item</option> </select> </div> css html { font-family: helvetica, arial, sans-serif; letter-spacing: 1px; padding-top: 10px; } article { background-color: red; } article span { background-color: black; color: white; margin: 1px; } article, span { padding: 10px; border-radius: 7px; } article, div { margin: 20px; } javascript const articles = document.query
selectorall('.container'); const select = document.query
selector('select'); function updatedisplay() { articles.foreach((article) => { article.style.display = select.value; }); } select.addeventlistener('change', updatedisplay); updatedisplay(); result note: you can find more examples in the pages for each separate display data type, linked above.
<easing-function> - CSS: Cascading Style Sheets
background-image: radial-gradient(circle at 10px 10px, rgba(25,255,255,0.8),rgba(25,255,255,0.4)); border-radius: 50%; top: 25px; animation: 1.5s infinite alternate; } @keyframes move-right { from { left: 10%; } to { left: 90%; } } li { display: flex; align-items: center; justify-content: center; margin-bottom: 20px; } javascript const selectelem = document.query
selector('select'); const startbtn = document.query
selector('button'); const divelem = document.query
selector('div > div'); startbtn.addeventlistener('click', () => { if(startbtn.textcontent === 'start animation') { divelem.style.animationname = 'move-right'; startbtn.textcontent = 'stop animation'; divelem.style.animationtimingfunction = selectelem.value; } else { divelem.style.anima...
<filter-function> - CSS: Cascading Style Sheets
und: url(https://media.prod.mdn.mozit.cloud/attachments/2020/07/29/17350/3b4892b7e820122ac6dd7678891d4507/firefox.png) no-repeat center; } li { display: flex; align-items: center; justify-content: center; margin-bottom: 20px; } input { width: 60% } output { width: 5%; text-align: center; } select { width: 40%; margin-left: 2px; } javascript const selectelem = document.query
selector('select'); const divelem = document.query
selector('div'); const slider = document.query
selector('input'); const output = document.query
selector('output'); const curvalue = document.query
selector('p code'); selectelem.addeventlistener('change', () => { setslider(selectelem.value); setdiv(selectelem.value); }); slider.addeventlistener('input', () => { setdiv(selectelem.value); }); function...
font-style - CSS: Cascading Style Sheets
x-height: 150px; overflow: scroll; } .sample { font: 2rem 'amstelvaralpha', sans-serif; } html, body { max-height: 100vh; max-width: 100vw; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let slantlabel = document.query
selector('label[for="slant"]'); let slantinput = document.query
selector('#slant'); let sampletext = document.query
selector('.sample'); function update() { let slant = `oblique ${slantinput.value}deg`; slantlabel.textcontent = `font-style: ${slant};`; sampletext.style.fontstyle = slant; } slantinput.addeventlistener('input', update); update(); accessibility concerns large sections of text set ...
font-weight - CSS: Cascading Style Sheets
y: auto; } .sample { text-transform: uppercase; font: 1.5rem 'mutatorsans', sans-serif; } html, body { max-height: 100vh; max-width: 100vw; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let weightlabel = document.query
selector('label[for="weight"]'); let weightinput = document.query
selector('#weight'); let sampletext = document.query
selector('.sample'); function update() { weightlabel.textcontent = `font-weight: ${weightinput.value};`; sampletext.style.fontweight = weightinput.value; } weightinput.addeventlistener('input', update); update(); accessibility concerns people experiencing low vision conditions ma...
<length> - CSS: Cascading Style Sheets
5); background-color: orange; display: flex; align-items: center; margin-top: 10px; } .result code { position: absolute; margin-left: 20px; } .results { margin-top: 10px; } .input-container { position: absolute; display: flex; justify-content: flex-start; align-items: center; height: 50px; } label { margin: 0 10px 0 20px; } javascript const inputdiv = document.query
selector('.inner'); const inputelem = document.query
selector('input'); const resultsdiv = document.query
selector('.results'); inputelem.addeventlistener('change', () => { inputdiv.style.width = inputelem.value; const result = document.createelement('div'); result.classname = 'result'; result.style.width = inputelem.value; result.innerhtml = `<code>width: ${inputelem.value}</code>`; resultsdi...
paint() - CSS: Cascading Style Sheets
li { --boxcolor: hsla(55, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 2px); } li:nth-of-type(3n) { --boxcolor: hsla(155, 90%, 60%, 1.0); background-image: paint(hollowhighlights, filled, 3px); } li:nth-of-type(3n+1) { --boxcolor: hsla(255, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 1px); } we've included a custom property in the
selector block defining a boxcolor.
<transform-function> - CSS: Cascading Style Sheets
sform: rotatey(90deg) translatez(50px); } .left { background: rgba(0,0,210,.7); transform: rotatey(-90deg) translatez(50px); } .top { background: rgba(210,210,0,.7); transform: rotatex(90deg) translatez(50px); } .bottom { background: rgba(210,0,210,.7); transform: rotatex(-90deg) translatez(50px); } .select-form { margin-top: 50px; } javascript const selectelem = document.query
selector('select'); const example = document.query
selector('#example-element'); selectelem.addeventlistener('change', () => { if(selectelem.value === 'choose a function') { return; } else { example.style.transform = `rotate3d(1, 1, 1, 30deg) ${selectelem.value}`; settimeout(function() { example.style.transform = 'rotate3d(1, 1, 1, 30deg)'; }, 2000) } }) result specificatio...
Used value - CSS: Cascading Style Sheets
">..</p> <div id="width-inherit"> <p>explicit width: inherit.</p> <p class="show-used-width">..</p> </div> </div> </div> css #no-width { width: auto; } #width-50 { width: 50%; } #width-inherit { width: inherit; } /* make results easier to see */ div { border: 1px solid red; padding: 8px; } javascript function updateusedwidth(id) { var div = document.query
selector(`#${id}`); var par = div.query
selector('.show-used-width'); var wid = window.getcomputedstyle(div)["width"]; par.textcontent = `used width: ${wid}.`; } function updateallusedwidths() { updateusedwidth("no-width"); updateusedwidth("width-50"); updateusedwidth("width-inherit"); } updateallusedwidths(); window.addeventlistener('resize', updateallusedwidths); result difference from...
white-space - CSS: Cascading Style Sheets
est laborum.</p> </div> .box { width: 300px; padding: 16px; border-radius: 10px; } #css-code { background-color: rgb(220, 220, 220); font-size: 16px; font-family: monospace; } #css-code select { font-family: inherit; } #results { background-color: rgb(230, 230, 230); overflow-x: scroll; height: 400px; white-space: normal; font-size: 14px; } var select = document.query
selector("#css-code select"); var results = document.query
selector("#results p"); select.addeventlistener("change", function(e) { results.setattribute("style", "white-space: "+e.target.value); }) <p> lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
CSS: Cascading Style Sheets
this module looks at the cascade and inheritance, all the
selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
Overview of events and handlers - Developer guides
"eventprototype" : "objectprototype"; alert("we got a click event at " + ev.timestamp + " with an argument object derived from: " + objkind ); }; and second register our function with the the button object, either on the scripting side using the dom (document object model) representation of the html page: var buttondomelement = document.query
selector('#buttonone'); buttondomelement.addeventlistener('click', example_click_handler); or within the html page by adding the function as the value of the 'onclick' attribute, although this second approach is usually only used in very simple web pages.
Constraint validation - Developer guides
:required and :optional css pseudo-classes the :required and :optional pseudo-classes allow writing
selectors that match form elements that have the required attribute, or that don't have it.
HTML5 Parser - Developer guides
the dom methods and css
selectors behave case-sensitively, so you need to write your dom calls and css
selectors using the canonical case, which is camelcase for various parts of svg such as viewbox.
<audio>: The Embed Audio element - HTML: Hypertext Markup Language
for example, to detect when audio tracks are added to or removed from an <audio> element, you can use code like this: var elem = document.query
selector("audio"); elem.audiotracklist.onaddtrack = function(event) { trackeditor.addtrack(event.track); }; elem.audiotracklist.onremovetrack = function(event) { trackeditor.removetrack(event.track); }; this code watches for audio tracks to be added to and removed from the element, and calls a hypothetical function on a track editor to register and remove the track from the editor's list of availa...
<canvas>: The Graphics Canvas element - HTML: Hypertext Markup Language
</canvas> javascript then in the javascript code, call htmlcanvaselement.getcontext() to get a drawing context and start drawing onto the canvas: const canvas = document.query
selector('canvas'); const ctx = canvas.getcontext('2d'); ctx.fillstyle = 'green'; ctx.fillrect(10, 10, 100, 100); result accessibility concerns alternative content the <canvas> element on its own is just a bitmap and does not provide information about any drawn objects.
<dialog>: The Dialog element - HTML: Hypertext Markup Language
<button value="cancel">cancel</button> <button id="confirmbtn" value="default">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <output aria-live="polite"></output> javascript var updatebutton = document.getelementbyid('updatedetails'); var favdialog = document.getelementbyid('favdialog'); var outputbox = document.query
selector('output'); var selectel = document.query
selector('select'); var confirmbtn = document.getelementbyid('confirmbtn'); // "update details" button opens the <dialog> modally updatebutton.addeventlistener('click', function onopen() { if (typeof favdialog.showmodal === "function") { favdialog.showmodal(); } else { alert("the <dialog> api is not supported by this browser"); } }); // "favo...
<input type="radio"> - HTML: Hypertext Markup Language
one</label> <input type="radio" id="contactchoice3" name="contact" value="mail"> <label for="contactchoice3">mail</label> </div> <div> <button type="submit">submit</button> </div> </form> <pre id="log"> </pre> then we add some javascript to set up an event listener on the submit event, which is sent when the user clicks the "submit" button: var form = document.query
selector("form"); var log = document.query
selector("#log"); form.addeventlistener("submit", function(event) { var data = new formdata(form); var output = ""; for (const entry of data) { output = output + entry[0] + "=" + entry[1] + "\r"; }; log.innertext = output; event.preventdefault(); }, false); try this example out and see how there's never more than one result for the contact group.
<input type="tel"> - HTML: Hypertext Markup Language
var selectelem = document.query
selector("select"); var inputelems = document.query
selectorall("input"); selectelem.onchange = function() { for(var i = 0; i < inputelems.length; i++) { inputelems[i].value = ""; } if(selectelem.value === "us") { inputelems[2].parentnode.style.display = "inline"; inputelems[0].placeholder = "area code"; inputelems[0].pattern = "[0-9]{3}"; inputelems[1].placeholder = "first pa...
<link>: The External Resource Link element - HTML: Hypertext Markup Language
"screen and (min-width: 600px)"> <link href="highres.css" rel="stylesheet" media="screen and (min-resolution: 300dpi)"> stylesheet load events you can determine when a style sheet has been loaded by watching for a load event to fire on it; similarly, you can detect if an error has occurred while processing a style sheet by watching for an error event: <script> var mystylesheet = document.query
selector('#my-stylesheet'); mystylesheet.onload = function() { // do something interesting; the sheet has been loaded } mystylesheet.onerror = function() { console.log("an error occurred loading the stylesheet!"); } </script> <link rel="stylesheet" href="mystylesheet.css" id="my-stylesheet"> note: the load event fires once the stylesheet and all of its imported content has been loaded and parsed...
<p>: The Paragraph element - HTML: Hypertext Markup Language
switch back!">use pilcrow for paragraphs</button> </p> css p { margin: 0; text-indent: 3ch; } p.pilcrow { text-indent: 0; display: inline; } p.pilcrow + p.pilcrow::before { content: " ¶ "; } javascript document.query
selector('button').addeventlistener('click', function (event) { document.query
selectorall('p').foreach(function (paragraph) { paragraph.classlist.toggle('pilcrow'); }); var newbuttontext = event.target.dataset.toggletext; var oldtext = event.target.innertext; event.target.innertext = newbuttontext; event.target.dataset.toggletext = oldtext; }); result accessibility concerns breaking u...
<shadow>: The obsolete Shadow Root element - HTML: Hypertext Markup Language
--> <div> <!-- this heading will not be displayed --> <h4>my original heading</h4> </div> <script> // get the <div> above with its content var origcontent = document.query
selector('div'); // create the first shadow root var shadowroot1 = origcontent.createshadowroot(); // create the second shadow root var shadowroot2 = origcontent.createshadowroot(); // insert something into the older shadow root shadowroot1.innerhtml = '<p>older shadow root inserted by <shadow></p>'; // insert into younger shadow root, including <shadow>.
<video>: The Video Embed element - HTML: Hypertext Markup Language
for example, to detect when audio tracks are added to or removed from a <video> element, you can use code like this: var elem = document.query
selector("video"); elem.audiotracklist.onaddtrack = function(event) { trackeditor.addtrack(event.track); }; elem.audiotracklist.onremovetrack = function(event) { trackeditor.removetrack(event.track); }; this code watches for audio tracks to be added to and removed from the element, and calls a hypothetical function on a track editor to register and remove the track from the editor's list of availa...
class - HTML: Hypertext Markup Language
classes allow css and javascript to select and access specific elements via the class
selectors or functions like the dom method document.getelementsbyclassname.
Preloading content with rel="preload" - HTML: Hypertext Markup Language
ample</title> <link rel="preload" href="bg-image-narrow.png" as="image" media="(max-width: 600px)"> <link rel="preload" href="bg-image-wide.png" as="image" media="(min-width: 601px)"> <link rel="stylesheet" href="main.css"> </head> <body> <header> <h1>my site</h1> </header> <script> var mediaquerylist = window.matchmedia("(max-width: 600px)"); var header = document.query
selector('header'); if (mediaquerylist.matches) { header.style.backgroundimage = 'url(bg-image-narrow.png)'; } else { header.style.backgroundimage = 'url(bg-image-wide.png)'; } </script> </body> we include media attributes on our <link> elements so that a narrow image is preloaded if the user has a narrow viewport, and a wider image is loaded if they have a wide viewport.
CSP: style-src - HTTP
import url("https://not-example.com/styles/print.css") print; </style> as well as styles loaded using the link header: link: <https://not-example.com/styles/stylesheet.css>;rel=stylesheet inline style attributes are also blocked: <div style="display:none">foo</div> as well as styles that are applied in javascript by setting the style attribute directly, or by setting csstext: document.query
selector('div').setattribute('style', 'display:none;'); document.query
selector('div').style.csstext = 'display:none;'; however, styles properties that are set directly on the element's style property will not be blocked, allowing users to safely manipulate styles via javascript: document.query
selector('div').style.display = 'none'; these types of manipulations can be prevented by disallowing javascript...
JavaScript modules - JavaScript
over in main.js we've grabbed a reference to each button using a document.query
selector() call, for example: let squarebtn = document.query
selector('.square'); we then attach an event listener to each button so that when pressed, the relevant module is dynamically loaded and used to draw the shape: squarebtn.addeventlistener('click', () => { import('./modules/square.js').then((module) => { let square1 = new module.square(mycanvas.ctx, mycanvas.listid, 50, 50, 100, 'blue'); ...
TypeError: Reduce of empty array with no initial value - JavaScript
similarly, the same issue can happen if there is a typo in a
selector, or an unexpected number of elements in a list: var names = document.getelementsbyclassname("names"); var name_list = array.prototype.reduce.call(names, (acc, name) => acc + ", " + name); valid cases these problems can be solved in two different ways.
Set - JavaScript
, "some text", {"a": 1, "b": 2}, {"a": 1, "b": 2} // (key and value are the same here) for (let [key, value] of myset.entries()) console.log(key) // convert set object to an array object, with array.from let myarr = array.from(myset) // [1, "some text", {"a": 1, "b": 2}, {"a": 1, "b": 2}] // the following will also work if run in an html document myset.add(document.body) myset.has(document.query
selector('body')) // true // converting between set and array myset2 = new set([1, 2, 3, 4]) myset2.size // 4 [...myset2] // [1, 2, 3, 4] // intersect can be simulated via let intersection = new set([...set1].filter(x => set2.has(x))) // difference can be simulated via let difference = new set([...set1].filter(x => !set2.has(x))) // iterate set entries with foreac...
SharedArrayBuffer - JavaScript
examples creating a new sharedarraybuffer var sab = new sharedarraybuffer(1024); slicing the sharedarraybuffer sab.slice(); // sharedarraybuffer { bytelength: 1024 } sab.slice(2); // sharedarraybuffer { bytelength: 1022 } sab.slice(-2); // sharedarraybuffer { bytelength: 2 } sab.slice(0, 1); // sharedarraybuffer { bytelength: 1 } using it in a webgl buffer const canvas = document.query
selector('canvas'); const gl = canvas.getcontext('webgl'); const buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, sab, gl.static_draw); specifications specification ecmascript (ecma-262)the definition of 'sharedarraybuffer' in that specification.
for...of - JavaScript
nt of arguments) { console.log(argument); } })(1, 2, 3); // 1 // 2 // 3 iterating over a dom collection iterating over dom collections like nodelist: the following example adds a read class to paragraphs that are direct descendants of an article: // note: this will only work in platforms that have // implemented nodelist.prototype[symbol.iterator] const articleparagraphs = document.query
selectorall('article > p'); for (const paragraph of articleparagraphs) { paragraph.classlist.add('read'); } closing iterators in for...of loops, abrupt iteration termination can be caused by break, throw or return.
import - JavaScript
const main = document.query
selector("main"); for (const link of document.query
selectorall("nav > a")) { link.addeventlistener("click", e => { e.preventdefault(); import('/modules/my-module.js') .then(module => { module.loadpageinto(main); }) .catch(err => { main.textcontent = err.message; }); }); } specifications specification ecmascript (ecma-262)the defi...
Add to Home screen - Progressive web apps (PWAs)
first of all, we declare a deferredprompt variable (which we'll explain later on), get a reference to our install button, and set it to display: none initially: let deferredprompt; const addbtn = document.query
selector('.add-button'); addbtn.style.display = 'none'; we hide the button initially because the pwa will not be available for install until it follows the a2hs criteria.
Progressive loading - Progressive web apps (PWAs)
loading via javascript the app.js file processes the data-src attributes like so: let imagestoload = document.query
selectorall('img[data-src]'); const loadimages = (image) => { image.setattribute('src', image.getattribute('data-src')); image.onload = () => { image.removeattribute('data-src'); }; }; the imagestoload variable contains references to all the images, while the loadimages function moves the path from data-src to src.
Mobile first - Progressive web apps (PWAs)
when they are not supported, the <html> tag looks like this: <html class=" js no-rgba no-multiplebgs"> when these are present, we can serve alternative styling rules to provide sensible fallbacks using descendant
selectors — see the following in my code.
baseFrequency - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'basefrequency' in that specification.
numOctaves - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence basefrequency="0.05" numoctaves="3" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'numoctaves' in that specification.
restart - SVG: Scalable Vector Graphics
dur="5s" repeatcount="1" restart="always" /> </rect> <rect x="120" y="30" width="100" height="100"> <animate attributetype="xml" attributename="y" from="30" to="100" dur="5s" repeatcount="1" restart="whennotactive"/> </rect> <a id="restart"><text y="20">restart animation</text></a> </svg> document.getelementbyid("restart").addeventlistener("click", evt => { document.query
selectorall("animate").foreach(element => { element.beginelement(); }); }); usage notes value always | whennotactive | never default value always animatable no always this value indicates that the animation can be restarted at any time.
result - SVG: Scalable Vector Graphics
phology>, <feoffset>, <fespecularlighting>, <fetile>, and <feturbulence> html, body, svg { height: 100%; } <svg viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> usage notes value <filter-primitive-reference> default value none animatable yes <filter-primitive-reference> this value is a <custom-ident> and defines the name for the filter primitive.
seed - SVG: Scalable Vector Graphics
notes value <number> default value 0 animatable yes example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence basefrequency="0.05" seed="1000" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'seed' in that specification.
visibility - SVG: Scalable Vector Graphics
="m16.59 8.59l12 13.17 7.41 8.59 6 10l6 6 6-6z" /> <path d="m12 8l-6 6 1.41 1.41l12 10.83l4.59 4.58l18 14z" class="invisible" /> <path d="m0 0h24v24h0z" fill="none" /> </svg> <span> click me </span> </button> css svg { display: inline !important; } span { vertical-align: 50%; } button { line-height: 1em; } .invisible { visibility: hidden; } javascript document.query
selector("button").addeventlistener("click", function (evt) { this.query
selector("svg > path:nth-of-type(1)").classlist.toggle("invisible"); this.query
selector("svg > path:nth-of-type(2)").classlist.toggle("invisible"); }); specifications specification status comment css level 2 (revision 1)the definition of 'visibility' in that specification.
SVG Attribute reference - SVG: Scalable Vector Graphics
to transform transform-origin type u u1 u2 underline-position underline-thickness unicode unicode-bidi unicode-range units-per-em v v-alphabetic v-hanging v-ideographic v-mathematical values vector-effect version vert-adv-y vert-origin-x vert-origin-y viewbox viewtarget visibility w width widths word-spacing writing-mode x x x-height x1 x2 xchannel
selector xlink:actuate xlink:arcrole xlink:href xlink:role xlink:show xlink:title xlink:type xml:base xml:lang xml:space y y y1 y2 ychannel
selector z z zoomandpan svg attributes by category generic attributes core attributes id, lang, tabindex, xml:base, xml:lang, xml:space style attributes class, style conditional processing attributes externalresourcesrequired, required...
<a> - SVG: Scalable Vector Graphics
see warning below */ svg|a:link, svg|a:visited { cursor: pointer; } svg|a text, text svg|a { fill: blue; /* even for text, svg uses fill over color */ text-decoration: underline; } svg|a:hover, svg|a:active { outline: dotted 1px blue; } since this element shares its tag name with html's <a> element, selecting a with css or query
selector may apply to the wrong kind of element.
<feTurbulence> - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannel
selector="r" ychannel
selector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of '<feturbulence>' in that specification.
<script> - SVG: Scalable Vector Graphics
0/svg"> <script> // <![cdata[ window.addeventlistener('domcontentloaded', () => { function getcolor () { const r = math.round(math.random() * 255).tostring(16).padstart(2,'0') const g = math.round(math.random() * 255).tostring(16).padstart(2,'0') const b = math.round(math.random() * 255).tostring(16).padstart(2,'0') return `#${r}${g}${b}` } document.query
selector('circle').addeventlistener('click', (e) => { e.target.style.fill = getcolor() }) }) // ]]> </script> <circle cx="5" cy="5" r="4" /> </svg> attributes crossorigin this attribute defines cors settings as define for the html <script> element.
SVG and CSS - SVG: Scalable Vector Graphics
this behavior is standardized, though only a few browsers support the :hover pseudo-class and other more complex css
selectors on elements referenced via <use> elements, at the moment.
Securing your site - Web security
privacy and the :visited
selector this article discusses changes made to the getcomputedstyle() method that eliminates the ability for malicious sites to figure out the user's browsing history.
Types of attacks - Web security
ammatically trigger a <form> submit (perhaps in an invisible <iframe>) when the page is loaded: <form action="https://bank.example.com/withdraw" method="post"> <input type="hidden" name="account" value="bob"> <input type="hidden" name="amount" value="1000000"> <input type="hidden" name="for" value="mallory"> </form> <script>window.addeventlistener('domcontentloaded', (e) => { document.query
selector('form').submit(); }</script> there are a few techniques that should be used to prevent this from happening: get endpoints should be idempotent—actions that enact a change and do not simply retrieve data should require sending a post (or other http method) request.