Search completed in 1.43 seconds.
RTCIceCandidate.candidate - Web APIs
the read-only property candi
date on the rtcicecandi
date interface returns a domstring describing the candi
date in detail.
... most of the other properties of rtcicecandi
date are actually extracted from this string.
... this property can be configured by specifying the value of the candi
date property when constructing the new candi
date object using rtcicecandi
date().
...And 11 more matches
Date.prototype.toLocaleDateString() - JavaScript
the tolocale
datestring() method returns a string with a language sensitive representation of the
date portion of this
date.
... syntax
dateobj.tolocale
datestring([locales [, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.
datetimeformat() constructor for details on these parameters and how to use them.
...And 11 more matches
RTCIceCandidate.RTCIceCandidate() - Web APIs
the rtcicecandi
date() constructor creates and returns a new rtcicecandi
date object, which can be configured to represent a single ice candi
date.
... syntax candi
date = new rtcicecandi
date([candi
dateinfo]); parameters candi
dateinfo optional an optional rtcicecandi
dateinit object providing information about the candi
date; if this is provided, the candi
date is initialized configured to represent the described candi
date.
... return value a newly-created rtcicecandi
date object, optionally configured based on the specified object based on the rtcicecandi
dateinit dictionary.
...And 10 more matches
RTCIceCandidateInit.candidate - Web APIs
the optional property candi
date in the rtcicecandi
dateinit dictionary specifies the value of the rtcicecandi
date object's candi
date property.
... value a domstring describing the properties of the candi
date, taken directly from the sdp attribute "candi
date".
... the candi
date string specifies the network connectivity information for the candi
date.
...And 9 more matches
PaymentRequestUpdateEvent.updateWith() - Web APIs
the up
datewith() method of the paymentrequestup
dateevent interface up
dates the details of an existing paymentrequest.
... syntax paymentrequestup
dateevent.up
datewith(details); parameters details a paymentdetailsup
date object specifying the changes applied to the payment request: displayitems optional an array of paymentitem objects, each describing one line item for the payment request.
...when calling up
datewith(), including error in the up
dated data causes the user agent to display the text as a general error message.
...And 5 more matches
RTCIceCandidateStats.candidateType - Web APIs
the rtcicecandi
datestats interface's candi
datetype property is a string which indicates the type of ice candi
date the object represents.
... syntax candi
datetype = rtcicecandi
datestats.candi
datetype; value a domstring whose value is one of the strings found in the rtcicecandi
datetype enumerated type:host the candi
date is a host candi
date, whose ip address as specified in the rtcicecandi
date.ip property is in fact the true address of the remote peer.
... srflx the candi
date is a server reflexive candi
date; the ip indicates an intermediary address assigned by the stun server to represent the candi
date's peer anonymously.
...And 5 more matches
Date.prototype.setDate() - JavaScript
the set
date() method sets the day of the
date object relative to the beginning of the currently set month.
... syntax
dateobj.set
date(dayvalue) parameters dayvalue an integer representing the day of the month.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the given
date (the
date object is also changed in place).
...And 5 more matches
Date.prototype.toDateString() - JavaScript
the to
datestring() method returns the
date portion of a
date object in english in the following format separated by spaces: first three letters of the week day name first three letters of the month name two digit day of the month, padded on the left a zero if necessary four digit year (at least), padded on the left with zeros if necessary e.g.
... syntax
dateobj.to
datestring() return value a string representing the
date portion of the given
date object in human readable form in english.
... description
date instances refer to a specific point in time.
...And 5 more matches
PaymentRequestUpdateEvent.PaymentRequestUpdateEvent() - Web APIs
the paymentrequestup
dateevent constructor creates a new paymentrequestup
dateevent object which enables a web page to up
date the details of a paymentrequest in response to a user action.
... actual up
dates are made by passing options to the up
datewith() method.
... syntax var paymentrequestup
dateevent = new paymentrequestup
dateevent() parameters none.
...And 3 more matches
Date.prototype.setUTCDate() - JavaScript
the setutc
date() method sets the day of the month for a specified
date according to universal time.
... syntax
dateobj.setutc
date(dayvalue) parameters dayvalue an integer from 1 to 31, representing the day of the month.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.getVarDate() - Archive of obsolete content
the getvar
date method returns a vt_
date value from a
date object.
... syntax
dateobj.getvar
date() parameters the required
dateobj reference is a
date object.
... return value returns a vt_
date value.
...And 2 more matches
RTCIceCandidateStats.localCandidateId - Web APIs
the rtcicecandi
datepairstats property localcandi
dateid is a string that uniquely identifies the local ice candi
date which was analyzed to generate the rtcicecandi
datestats used to compute the statistics for this pair of candi
dates.
... syntax localcandi
dateid = rtcicecandi
datepairstats.localcandi
dateid; value a domstring giving a unique identifier for the local rtcicecandi
date for the connection described by this rtcicecandi
datepairstats object.
... this candi
date is the source of one of the two rtcicecandi
datestats objects that were used to compute the contents of this rtcicecandi
datepairstats object.
...And 2 more matches
RTCIceCandidatePairStats.remoteCandidateId - Web APIs
the rtcicecandi
datepairstats property remotecandi
dateid is a string that uniquely identifies the remote ice candi
date which was analyzed to generate the rtcicecandi
datestats used to compute the statistics for this pair of candi
dates.
... syntax remotecandi
dateid = rtcicecandi
datepairstats.remotecandi
dateid; value a domstring uniquely identifies the remote ice candi
date—that is, the candi
date describing a configuration for the remote peer—which is represented by the remote end of these statistics.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.remotecandi
dateid' in that specification.
... candi
date recommendation initial specification.
Date.prototype.getDate() - JavaScript
the get
date() method returns the day of the month for the specified
date according to local time.
... syntax
dateobj.get
date() return value an integer number, between 1 and 31, representing the day of the month for the given
date according to local time.
... examples using get
date() the second statement below assigns the value 25 to the variable day, based on the value of the
date object xmas95.
... var xmas95 = new
date('december 25, 1995 23:15:30'); var day = xmas95.get
date(); console.log(day); // 25 specifications specification ecmascript (ecma-262)the definition of '
date.prototype.get
date' in that specification.
Date.prototype.getUTCDate() - JavaScript
the getutc
date() method returns the day (
date) of the month in the specified
date according to universal time.
... syntax
dateobj.getutc
date() return value an integer number, between 1 and 31, representing the day of the month in the given
date according to universal time.
... examples using getutc
date() the following example assigns the day portion of the current
date to the variable day.
... var today = new
date(); var day = today.getutc
date(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutc
date' in that specification.
MSCandidateWindowUpdate - Web APIs
mscandi
datewindowup
date fires after the input method editor (ime) candi
date window has been identified as needing to change size, but before any visual up
dates have rendered.
... syntax event property object.oncandi
datewindowup
date = handler; addeventlistener method object.addeventlistener("mscandi
datewindowup
date", handler, usecapture) parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... tan ime candi
date window may be identified as needing to change size for any of the following reasons: as a result of displaying new / changed alternatives or predictions web applications need only register for this event once per element (the handler will remain valid for the lifetime of the element).
Date - JavaScript
javascript
date objects represent a single moment in time in a platform-independent format.
...
date objects contain a number that represents milliseconds since 1 january 1970 utc.
... tc39 is working on temporal, a new
date/time api.
...And 69 more matches
<input type="datetime-local"> - HTML: Hypertext Markup Language
<input> elements of type
datetime-local create input controls that let the user easily enter both a
date and a time, including the year, month, and day as well as the time in hours and minutes.
... the control is intended to simply represent a local
date and time, not necessarily the user's local
date and time.
... because of the limited browser support for
datetime-local, and the variations in how the inputs work, it may currently still be best to use a framework or library to present these, or to use a custom input of your own.
...And 67 more matches
<input type="date"> - HTML: Hypertext Markup Language
<input> elements of type="
date" create input fields that let the user enter a
date, either with a textbox that vali
dates the input or a special
date picker interface.
...the time and
datetime-local input types support time and
date+time input.
... among browsers with custom interfaces for selecting
dates are chrome and opera, whose data control looks like so: the edge
date control looks like: and the firefox
date control looks like this: value a domstring representing a
date in yyyy-mm-dd format, or empty events change and input supported common attributes autocomplete, list, readonly, and step idl attributes list, value, valueas
date, valu...
...And 48 more matches
Extension Versioning, Update and Compatibility - Archive of obsolete content
if the application has a targetapplication entry but it is for an incompatible version then the application will retrieve up
dated compatibility information from the add-on's up
dateurl.
... for the maxversion it is generally permissible to use a * in place of the minor version of the application you support, for example 2.0.0.* would mean that you support any minor up
date to version 2 of the application.
... valid application versions automatic add-on up
date checking applications will periodically check for up
dates to installed add-ons by retrieving the up
dateurl.
...And 41 more matches
nsIUpdate
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable an interface that describes an object representing an available up
date to the current application - this up
date may have several available patches from which one must be selected to download and install, for example we might select a binary difference patch first and attempt to apply that, then if the application process fails fall back to downloading a complete file-replace patch.
... this object also contains information about the up
date that the front end and other application services can use to learn more about what is going on.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview nsiup
datepatch getpatchat(in unsigned long index); nsidomelement serialize(in nsidomdocument up
dates); attributes attribute type description appversion astring the application version of this up
date.
...And 40 more matches
RTCIceCandidatePairStats - Web APIs
the webrtc rtcicecandi
datepairstats dictionary reports statistics which provide insight into the quality and performance of an rtcpeerconnection while connected and configured as described by the specified pair of ice candi
dates.
... if a rtcstats-based object's type is candi
date-pair, it's an rtcicecandi
datepairstats object.
... properties rtcicecandi
datepairstats is based upon rtcstats and inherits its properties.
...And 33 more matches
Date.parse() - JavaScript
the
date.parse() method parses a string representation of a
date, and returns the number of milliseconds since january 1, 1970, 00:00:00 utc or nan if the string is unrecognized or, in some cases, contains illegal
date values (e.g.
... it is not recommended to use
date.parse as until es5, parsing of strings was entirely implementation dependent.
... there are still many differences in how different hosts parse
date strings, therefore
date strings should be manually parsed (a library can help if many different formats are to be accommo
dated).
...And 29 more matches
RTCIceCandidate - Web APIs
the rtcicecandi
date interface—part of the webrtc api—represents a candi
date internet connectivity establishment (ice) configuration which may be used to establish an rtcpeerconnection.
... an ice candi
date describes the protocols and routing needed for webrtc to be able to communicate with a remote device.
... when starting a webrtc peer connection, typically a number of candi
dates are proposed by each end of the connection, until they mutually agree upon one which describes the connection they decide will be best.
...And 24 more matches
Numbers and dates - JavaScript
« previousnext » this chapter introduces the concepts, objects and functions used to work with and perform calculations using numbers and
dates in javascript.
...
date object javascript does not have a
date data type.
... however, you can use the
date object and its methods to work with
dates and times in your applications.
...And 24 more matches
datepicker - Archive of obsolete content
« xul reference home [ examples | attributes | properties | methods | related ] a
datepicker allows the user to enter a
date.
... normal - a
datepicker with three fields for entering the year, month and
date.
... grid - a
datepicker with a calendar grid for selecting a
date.
...And 23 more matches
nsIApplicationUpdateService
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable this interface describes a global application service that handles performing background up
date checks.
... it also provides utilities for selecting and downloading up
date patches.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void adddownloadlistener(in nsirequestobserver listener); astring downloadup
date(in nsiup
date up
date, in boolean background); void pausedownload(); void removedownloadlistener(in nsirequestobserver listener); nsiup
date selectup
date([array, size_is(up
datecount)] in nsiup
date up
dates, in unsigned long up
datecount); attributes attribute type description backgroundchecker nsiup
datechecker the up
date checker being used for background up
date checking.
...And 23 more matches
Date and time formats used in HTML - HTML: Hypertext Markup Language
certain html elements use
date and/or time values.
...elements that use such formats include certain forms of the <input> element that let the user choose or specify a
date, time, or both, as well as the <ins> and <del> elements, whose
datetime attribute specifies the
date or
date and time at which the insertion or deletion of content occurred.
... for <input>, the values of type that return a value which contains a string representing a
date and/or time are:
date datetime
datetime-local month time week examples before getting into the intricacies of how
date and time strings are written and parsed in html, here are some examples that should give you a good idea what the more commonly-used
date and time string formats look like.
...And 23 more matches
Setting up an update server
the goal of this document is to provide instructions for installing a locally-served firefox up
date.
... obtaining an up
date mar up
dates are served as mar files.
...after locating the desired version, the mars will be in the up
date directory.
...And 21 more matches
RTCPeerConnection.addIceCandidate() - Web APIs
when a web site or app using rtcpeerconnection receives a new ice candi
date from the remote peer over its signaling channel, it delivers the newly-received candi
date to the browser's ice agent by calling rtcpeerconnection.addicecandi
date().
... this adds this new remote candi
date to the rtcpeerconnection's remote description, which describes the state of the remote end of the connection.
... if the candi
date parameter is missing or a value of null is given when calling addicecandi
date(), the added ice candi
date is an "end-of-candi
dates" indicator.
...And 20 more matches
Application Update - Archive of obsolete content
this article will hopefully explain how to up
date your xulrunner application using the same method that firefox, thunderbird, songbird, and chatzilla use.
... getting started you will need the following utility scripts from http://lxr.mozilla.org/mozilla/sourc...ate-packaging/ (or local source of xulrunner) common.sh make_full_up
date.sh you will need mar / mar.exe to build a complete up
date patch.
...as far as i can tell enabling the options --enable-up
dater and --enable-up
date-packaging on your configure will build you mar.
...And 19 more matches
RTCIceCandidateStats - Web APIs
the webrtc api's rtcicecandi
datestats dictionary provides statistics related to an rtcicecandi
date.
... properties rtcicecandi
datestats is based upon the rtcstats dictionary, so it includes those properties in addition to the ones below.
... address optional a string containing the address of the candi
date.
...And 19 more matches
nsIUpdatePrompt
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable this interface describes an object that can be used to show various up
date-related notifications to the user.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void checkforup
dates(); void showup
dateavailable(in nsiup
date up
date); void showup
datedownloaded(in nsiup
date up
date, [optional] in boolean background); void showup
dateerror(in nsiup
date up
date); void showup
datehistory(in nsidomwindow parent); void showup
dateinstalled(); methods checkforup
dates() presents a user interface that checks for and displays the available up
dates.
... void checkforup
dates(); parameters none.
...And 16 more matches
RTCPeerConnection: icecandidate event - Web APIs
an icecandi
date event is sent to an rtcpeerconnection when an rtcicecandi
date has been identified and added to the local peer by a call to rtcpeerconnection.setlocaldescription().
... the event handler should transmit the candi
date to the remote peer over the signaling channel so the remote peer can add it to its set of remote candi
dates.
... bubbles no cancelable no interface rtcpeerconnectioniceevent event handler property rtcpeerconnection.onicecandi
date description there are three reasons why the icecandi
date event is fired on an rtcpeerconnection.
...And 16 more matches
Date.prototype.toLocaleString() - JavaScript
the tolocalestring() method returns a string with a language sensitive representation of this
date.
... syntax
dateobj.tolocalestring([locales[, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.
datetimeformat() constructor for details on these parameters and how to use them.
...And 13 more matches
Intl.DateTimeFormat - JavaScript
the intl.
datetimeformat object is a constructor for objects that enable language-sensitive
date and time formatting.
... constructor intl.
datetimeformat() creates a new
datetimeformat object.
... static methods intl.
datetimeformat.supportedlocalesof() returns an array containing those of the provided locales that are supported without having to fall back to the runtime's default locale.
...And 13 more matches
RTCIceCandidate.relatedAddress - Web APIs
the rtcicecandi
date interface's read-only relatedaddress property is a string indicating the related address of a relay or reflexive candi
date.
... if the candi
date is a host candi
date (that is, its ip is in fact the real ip address of the remote peer), relatedaddress is null.
... the relatedaddress field's value is set when the rtcicecandi
date() constructor is used.
...And 11 more matches
RTCIceCandidate.type - Web APIs
the rtcicecandi
date interface's read-only type specifies the type of candi
date the object represents.
... the type field's value is set when the rtcicecandi
date() constructor is used.
... you can't specify the value of type in the options object, but the address is automatically extracted from the candi
date a-line, if it's formatted properly, being taken from its cand-type field.
...And 11 more matches
RTCIceCandidate.usernameFragment - Web APIs
the read-only usernamefragment property on the rtcicecandi
date interface is a string indicating the username fragment ("ufrag") that uniquely identifies a single ice interaction session.
... this value is specified when creating the rtcicecandi
date by setting the corresponding usernamefragment value in the rtcicecandi
dateinit object when creating a new candi
date with new rtcicecandi
date().
... if you instead call rtcicecandi
date() with a string parameter containing the candi
date m-line text, the value of usernamefragment is extracted from the m-line.
...And 11 more matches
Warning: Date.prototype.toLocaleFormat is deprecated - JavaScript
the javascript warning "
date.prototype.tolocaleformat is deprecated; consider using intl.
datetimeformat instead" occurs when the non-standard
date.prototype.tolocaleformat method is used.
... message warning:
date.prototype.tolocaleformat is deprecated; consider using intl.
datetimeformat instead error type warning.
... the non-standard
date.prototype.tolocaleformat method is deprecated and shouldn't be used anymore.
...And 11 more matches
nsIUpdateChecker
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable this interface describes an object that knows how to check for software up
dates.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void checkforup
dates(in nsiup
datechecklistener listener, in boolean force); void stopchecking(in unsigned short duration); constants constant value description current_check 1 constant for the stopchecking() method indicating that only the current up
date check should be stopped.
... current_session 2 constant for the stopchecking() method indicating that all up
date checks during the current session should be stopped.
...And 10 more matches
RTCIceCandidate.address - Web APIs
the rtcicecandi
date interface's read-only address property is a string providing the address of the device which is the source of the candi
date.
... the address field's value is set when the rtcicecandi
date() constructor is used.
... you can't specify the address in the options object, but the address is automatically extracted from the candi
date a-line, if it's formatted properly.
...And 10 more matches
RTCIceCandidate.protocol - Web APIs
the rtcicecandi
date interface's read-only protocol property is a string which indicates whether the candi
date uses udp or tcp as its transport protocol.
... protocol is null by default if not specified properly in the sdp, but this is an error condition and will result in a thrown exception when you call rtcpeerconnection.addicecandi
date().
... the protocol property's value is set when the rtcicecandi
date() constructor is used.
...And 10 more matches
WebGL2RenderingContext.invalidateSubFramebuffer() - Web APIs
the webgl2renderingcontext.invali
datesubframebuffer() method of the webgl 2 api invali
dates portions of the contents of attachments in a framebuffer.
... syntax void gl.invali
datesubframebuffer(target, attachments, x, y, width, height); parameters target a glenum specifying the binding point (target).
... attachments an array of glenum specifying the attachment points to invali
date.
...And 10 more matches
Intl.DateTimeFormat.prototype.formatToParts() - JavaScript
the intl.
datetimeformat.prototype.formattoparts() method allows locale-aware formatting of strings produced by
datetimeformat formatters.
... syntax
datetimeformat.formattoparts(
date) parameters
date optional the
date to format.
... return value an array of objects containing the formatted
date in parts.
...And 10 more matches
RTCIceCandidate.priority - Web APIs
the rtcicecandi
date interface's read-only priority property specifies the candi
date's priority according to the remote peer; the higher this value is, the better the remote peer considers the candi
date to be.
... as is the case with most of rtcicecandi
date's properties, the value of priority is extracted from the candi
date a-line string specified when creating the rtcicecandi
date.
... the a-line string is obtained either from the rtcicecandi
dateinit property candi
date or from an a-line string passed into rtcpeerconnection.addicecandi
date() instead of an rtcicecandi
date.
...And 9 more matches
RTCIceCandidate.relatedPort - Web APIs
the rtcicecandi
date interface's read-only relatedport property indicates the port number of reflexive or relay candi
dates.
... if the candi
date is a host candi
date (that is, its ip is in fact the real ip address of the remote peer), relatedport is null.
... the relatedport field's value is set when the rtcicecandi
date() constructor is used.
...And 9 more matches
RTCIceCandidateStats.deleted - Web APIs
the rtcicecandi
datestats dictionary's deleted property indicates whether or not the candi
date has been deleted or released.
... syntax isdeleted = rtcicecandi
datestats.deleted; value a boolean value indicating whether or not the candi
date has been deleted or released.
... if this value is true, the candi
date described by the rtcicecandi
datestats object is no longer under consideration.
...And 9 more matches
RTCIceTransport.getSelectedCandidatePair() - Web APIs
the rtcicetransport method getselectedcandi
datepair() returns an rtcicecandi
datepair object containing the current best-choice pair of ice candi
dates describing the configuration of the endpoints of the transport.
... syntax candi
datepair = rtcicetransport.getselectedcandi
datepair(); parameters none.
... return value a rtcicecandi
datepair object describing the configurations of the currently-selected candi
date pair's two endpoints.
...And 9 more matches
Date.prototype.toLocaleTimeString() - JavaScript
the tolocaletimestring() method returns a string with a language sensitive representation of the time portion of this
date.
... syntax
dateobj.tolocaletimestring([locales[, options]]) parameters the locales and options arguments customize the behavior of the function and let applications specify the language whose formatting conventions should be used.
... see the intl.
datetimeformat() constructor for details on these parameters and how to use them.
...And 9 more matches
Date.prototype.toString() - JavaScript
the tostring() method returns a string representing the specified
date object.
... syntax
dateobj.tostring() return value a string representing the given
date.
... description
date instances inherit their tostring() method from
date.prototype, not object.prototype.
...And 9 more matches
Date.prototype.toLocaleFormat() - Archive of obsolete content
the non-standard tolocaleformat() method converts a
date to a string using the specified formatting.
... intl.
datetimeformat is an alternative to format
dates in a standards-compliant way.
... see also the newer version of
date.prototype.tolocale
datestring().
...And 8 more matches
AddonUpdateChecker
the addonup
datechecker is used to download and parse up
date information for an add-on's up
date manifest.
... if all you care about is finding the newest version for an addon then you probably want to use findup
dates() instead.
... to import the addonup
datechecker, use: components.utils.import("resource://gre/modules/addonup
datechecker.jsm"); method overview up
dateinfo getcompatibilityup
date(in up
dateinfo up
dates[], in string version, in boolean ignorecompatibility, in string appversion, in string platformversion) up
dateinfo getnewestcompatibleup
date(in up
dateinfo up
dates[], in string appversion, in string platformversion) void checkforup
dates(in string id, in string type, in string up
datekey, string url, in up
datechecklistener listener) constants constant description error_timeout the up
date check timed out.
...And 8 more matches
nsIUpdateCheckListener
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable an interface describing an object that listens to the progress of an up
date check operation.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void oncheckcomplete(in nsixmlhttprequest request, [array, size_is(up
datecount)] in nsiup
date up
dates, in unsigned long up
datecount); void onerror(in nsixmlhttprequest request, in nsiup
date up
date); void onprogress(in nsixmlhttprequest request, in unsigned long position, in unsigned long totalsize); methods oncheckcomplete() called when the up
date check is completed.
... void oncheckcomplete( in nsixmlhttprequest request, [array, size_is(up
datecount)] in nsiup
date up
dates, in unsigned long up
datecount ); parameters request the nsixmlhttprequest object handling the up
date check.
...And 8 more matches
RTCIceCandidate.port - Web APIs
the rtcicecandi
date interface's read-only port property contains the port number on the device at the address given by ip at which the candi
date's peer can be reached.
... as is the case with most of rtcicecandi
date's properties, the value of port is extracted from the candi
date a-line string specified when creating the rtcicecandi
date.
... the a-line string is obtained either from the rtcicecandi
dateinit property candi
date or from a-line string passed into the constructor upon using new rtcicecandi
date().
...And 8 more matches
RTCIceCandidateType - Web APIs
the webrtc api's rtcicecandi
datetype enumerated type provides a set of domstring values representing the types of ice candi
date that can arrive.
... these strings are taken directly from the candi
date a-line in sdp.
... values these candi
date types are listed in order of priority; the higher in the list they are, the more efficient they are.
...And 8 more matches
Date() constructor - JavaScript
creates a javascript
date instance that represents a single moment in time in a platform-independent format.
...
date objects contain a number that represents milliseconds since 1 january 1970 utc.
... syntax new
date() new
date(value) new
date(
datestring) new
date(year, monthindex [, day [, hours [, minutes [, seconds [, milliseconds]]]]]) note: the only correct way to instantiate a new
date object is by using the new operator.
...And 8 more matches
UpdateListener
an up
datelistener receives messages from an up
date check for a single add-on, though it is possible to pass the same up
datelistener to as many calls to findup
dates() as you like.
... for each individual up
date check, the following methods will be called on the listener: either oncompatibilityup
dateavailable() or onnocompatibilityup
dateavailable(), depending on whether compatibility information for the requested application version was seen.
... either onup
dateavailable() or onnoup
dateavailable(), depending on whether a newer version of the addon was found.
...And 7 more matches
nsIUpdateItem
method overview void init(in astring id, in astring version, in astring installlocationkey, in astring minappversion, in astring maxappversion, in astring name, in astring downloadurl, in astring xpihash, in astring iconurl, in astring up
dateurl, in astring up
datekey, in long type, in astring targetappid); attributes attribute type description iconurl astring the url of the icon that can be shown for this item.
... objectsource astring returns a js object source representing an nsiup
dateitem.
... up
datekey astring the public key to verify up
dates for this item.
...And 7 more matches
nsIUpdateManager
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable this interface describes a global application service that maintains a list of previously installed up
dates, as well as the currently in use up
date.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview nsiup
date getup
dateat(in long index); void saveup
dates(); attributes attribute type description activeup
date nsiup
date an nsiup
date object describing the currently in use up
date.
... this up
date is not in the history list.
...And 7 more matches
IDBCursor.update() - Web APIs
the up
date() method of the idbcursor interface returns an idbrequest object, and, in a separate thread, up
dates the value at the current position of the cursor in the object store.
... be aware that you can't call up
date() (or idbcursor.delete()) on cursors obtained from idbindex.openkeycursor().
... syntax var anidbrequest = myidbcursor.up
date(value); parameters value the new value to be stored at the current position.
...And 7 more matches
Intl.DateTimeFormat.prototype.format() - JavaScript
the intl.
datetimeformat.prototype.format() method formats a
date according to the locale and formatting options of this intl.
datetimeformat object.
... syntax
datetimeformat.format(
date) parameters
date the
date to format.
... description the format getter formats a
date into a string according to the locale and formatting options of this intl.
datetimeformat object.
...And 7 more matches
ISO8601DateUtils.jsm
the iso8601
dateutils.jsm javascript code module provides methods that make it easy to convert javascript
date objects into iso 8601 format
date strings and back.
... to use this, you first need to import the code module into your javascript scope: components.utils.import("resource://gre/modules/iso8601
dateutils.jsm"); once you've imported the module, you can then use the iso8601
dateutils object it exports.
... using the iso 8601
date utilities to convert a
date string into a
date object, simply use:
dateobj = iso8601
dateutils.parse(
datestring); to convert a
date object into a
date string:
datestring = iso8601
dateutils.create(
dateobj); method overview string create(a
date);
date parse(a
datestring); methods create creates an iso 8601 format
date string, e.g.
...And 6 more matches
PaymentDetailsUpdate - Web APIs
the paymentdetailsup
date dictionary is used to provide up
dated information to the payment user interface after it has been instantiated.
... this can be done either by calling the paymentrequestup
dateevent.up
datewith() method or by using the paymentrequest.show() method's detailspromise parameter to provide a promise that returns a paymentdetailsup
date that up
dates the payment information before the user interface is even enabled for the first time.
... properties the paymentdetailsup
date dictionary is based on the paymentdetailsbase dictionary, and inherits its properties, which are included in the list below.
...And 6 more matches
RTCIceCandidateInit - Web APIs
the webrtc api's rtcicecandi
dateinit dictionary, which contains the information needed to fundamentally describe an rtcicecandi
date.
... rtcicecandi
dateinit is used when using new rtcicecandi
date() to create a new ice candi
date object.
... it's also used as the return value from the rtcicecandi
date.tojson() method, and can be passed directly into rtcpeerconnection.addicecandi
date() to add a candi
date to the peer connection.
...And 6 more matches
RTCIceCandidatePairStats.state - Web APIs
the state property in an rtcicecandi
datepairstats object indicates the state of the check list of which the candi
date pair is a member.
... syntax state = rtcicecandi
datepairstats.state; value a domstring whose value is one of those found in the rtcstatsicecandi
datepairstate enumerated type.
... ice check lists during ice negotiation, the ice layer builds up a check list, which is a list of potential pairings of ice candi
dates.
...And 6 more matches
RTCIceTransport.getLocalCandidates() - Web APIs
the rtcicetransport method getlocalcandi
dates() returns an array of rtcicecandi
date objects, one for each of the candi
dates that have been gathered by the local device during the current ice agent session.
... the local candi
dates are placed in this list by the ice agent prior to being delivered to the local client's code in an icecandi
date event so that the client can forward the candi
dates to the remote peer.
... syntax localcandi
dates = rtcicetransport.getlocalcandi
dates(); parameters none.
...And 6 more matches
RTCIceTransport.getRemoteCandidates() - Web APIs
the rtcicetransport method getremotecandi
dates() returns an array which contains one rtcicecandi
date for each of the candi
dates that have been received from the remote peer so far during the current ice gathering session.
... each time your signaling code calls rtcpeerconnection.addicecandi
date() to add a received candi
date to the ice session, the ice agent places it in the list returned by this function.
... syntax remotecandi
dates = rtcicetransport.getremotecandi
dates(); parameters none.
...And 6 more matches
RTCPeerConnection.onicecandidate - Web APIs
the rtcpeerconnection property onicecandi
date property is an eventhandler which specifies a function to be called when the icecandi
date event occurs on an rtcpeerconnection instance.
...this lets the ice agent perform negotiation with the remote peer without the browser itself needing to know any specifics about the technology being used for signaling; simply implement this method to use whatever messaging technology you choose to send the ice candi
date to the remote peer.
... syntax rtcpeerconnection.onicecandi
date = eventhandler; value this should be set to a function which you provide that accepts as input an rtcpeerconnectioniceevent object representing the icecandi
date event.
...And 6 more matches
WebGL2RenderingContext.invalidateFramebuffer() - Web APIs
the webgl2renderingcontext.invali
dateframebuffer() method of the webgl 2 api invali
dates the contents of attachments in a framebuffer.
... syntax void gl.invali
dateframebuffer(target, attachments); parameters target a glenum specifying the binding point (target).
... attachments an array of glenum specifying the attachment points to invali
date.
...And 6 more matches
Date.UTC() - JavaScript
the
date.utc() method accepts parameters similar to the
date constructor, but treats them as utc.
... syntax since ecmascript 2017:
date.utc(year[, month[, day[, hour[, minute[, second[, millisecond]]]]]]) ecmascript 2016 and earlier: (month used to be required)
date.utc(year, month[, day[, hour[, minute[, second[, millisecond]]]]]) parameters year a full year.
... return value a number representing the number of milliseconds for the given
date since january 1, 1970, 00:00:00, utc.
...And 6 more matches
Date.prototype.getTime() - JavaScript
you can use this method to help assign a
date and time to another
date object.
... syntax
dateobj.gettime() return value a number representing the milliseconds elapsed between 1 january 1970 00:00:00 utc and the given
date.
... reduced time precision to offer protection against timing attacks and fingerprinting, the precision of new
date().gettime() might get rounded depending on browser settings.
...And 6 more matches
Date.prototype.setHours() - JavaScript
the sethours() method sets the hours for a specified
date according to local time, and returns the number of milliseconds since january 1, 1970 00:00:00 utc until the time represented by the up
dated
date instance.
... syntax
dateobj.sethours(hoursvalue[, minutesvalue[, secondsvalue[, msvalue]]]) versions prior to javascript 1.3
dateobj.sethours(hoursvalue) parameters hoursvalue ideally, an integer between 0 and 23, representing the hour.
... if a value greater than 23 is provided, the
datetime will be incremented by the extra hours.
...And 6 more matches
RTCIceCandidate.component - Web APIs
the read-only component property on the rtcicecandi
date interface is a string which indicates whether the candi
date is an rtp or an rtcp candi
date.
... if a candi
date represents both rtp and rtcp multiplexed together, it is reported as an rtp candi
date.
... syntax var component = rtcicecandi
date.component; value a domstring which is "rtp" for rtp (or rtp and rtcp multiplexed together) candi
dates or "rtcp" for rtcp candi
dates.
...And 5 more matches
RTCIceCandidate.sdpMid - Web APIs
the read-only property sdpmid on the rtcicecandi
date interface returns a domstring specifying the media stream identification tag of the media component with which the candi
date is associated.
... this id uniquely identifies a given stream for the component with which the candi
date is associated.
... this property can be configured by specifying the value of the sdpmid property when constructing the new candi
date object using rtcicecandi
date().
...And 5 more matches
RTCIceCandidate.tcpType - Web APIs
the rtcicecandi
date interface's read-only tcptype property is included on tcp candi
dates to provide additional details about the candi
date type.
... the tcptype field's value is set when the rtcicecandi
date() constructor is used.
... you can't directly set its value; instead, its value is automatically extracted from the candi
date a-line, if it's formatted properly.
...And 5 more matches
RTCIceCandidatePairStats.selected - Web APIs
the non-standard, firefox-specific rtcicecandi
datepairstats property selected indicates whether or not the candi
date pair described by the object is the one currently being used to communicate with the remote peer.
... syntax isselected = icpstats.selected; value a firefox-specific boolean value which is true if the candi
date pair described by this object is the one currently in use.
... in any other browser, you can determine the selected candi
date pair by looking for a stats object of type transport, which is an rtctransportstats object.
...And 5 more matches
RTCIceCandidateStats.priority - Web APIs
the rtcicecandi
datestats dictionary's priority property is a positive integer value indicating the priority (or desirability) of the described candi
date.
... during ice negotiation while setting up a webrtc peer connection, the priority values reported to the remote peer by a user agent are used to determine which candi
dates are considered "more desirable".
... the higher the value, the more desirable the candi
date is.
...And 5 more matches
RTCPeerConnection.canTrickleIceCandidates - Web APIs
the read-only rtcpeerconnection property cantrickleicecandi
dates returns a boolean which indicates whether or not the remote peer can accept trickled ice candi
dates.
... ice trickling is the process of continuing to send candi
dates after the initial offer or answer has already been sent to the other peer.
...that way, the offer contains all of the candi
dates.
...And 5 more matches
RTCPeerConnection: icecandidateerror event - Web APIs
the webrtc api event icecandi
dateerror is sent to an rtcpeerconnection if an error occurs while performing ice negotiations through a stun or turn server.
... bubbles no cancelable no interface rtcpeerconnectioniceerrorevent event handler property rtcpeerconnection.onicecandi
dateerror description the error object's errorcode property is one of the numeric stun error codes.
...error 701 indicates that none of the ice candi
dates were able to successfully make contact with the stun or turn server.
...And 5 more matches
Date.prototype.setFullYear() - JavaScript
the setfullyear() method sets the full year for a specified
date according to local time.
... syntax
dateobj.setfullyear(yearvalue[, monthvalue[,
datevalue]]) parameters yearvalue an integer specifying the numeric value of the year, for example, 1995.
...
datevalue optional.
...And 5 more matches
Intl.DateTimeFormat() constructor - JavaScript
the intl.
datetimeformat() constructor for objects that enable language-sensitive
date and time formatting.
... syntax new intl.
datetimeformat([locales[, options]]) parameters locales optional a string with a bcp 47 language tag, or an array of such strings.
... options optional an object with some or all of the following properties:
datestyle the
date formatting style to use when calling format().
...And 5 more matches
modDateChanged - Archive of obsolete content
summary returns whether file has been modified since a certain
date.
... method of file object syntax boolean mod
datechanged (filespecobject asourcefolder, number anold
date); parameters the mod
datechanged method has the following parameters: asourcefolder a filespecobject representing the file to be queried.
... anold
date a double representing the
date.
...And 4 more matches
nsIUpdatePatch
toolkit/mozapps/up
date/nsiup
dateservice.idlscriptable an interface that describes an object representing a patch file that can be downloaded and applied to a version of this application so that it can be up
dated.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview nsidomelement serialize(in nsidomdocument up
dates); attributes attribute type description finalurl astring the final url this patch was being downloaded from.
... selected boolean true if this patch is currently selected as the patch to be downloaded and installed for this up
date transaction.
...And 4 more matches
HTMLMediaElement: timeupdate event - Web APIs
the timeup
date event is fired when the time indicated by the currenttime attribute has been up
dated.
...user agents are encouraged to vary the frequency of the event based on the system load and the average cost of processing the event each time, so that the ui up
dates are not any more frequent than the user agent can comfortably handle while decoding the video.
... bubbles no cancelable no interface event target element default action none event handler property globaleventhandlers.ontimeup
date specification html5 media examples these examples add an event listener for the htmlmediaelement's timeup
date event, then post a message when that event handler has reacted to the event firing.
...And 4 more matches
RTCIceCandidate.foundation - Web APIs
the rtcicecandi
date interface's read-only foundation property is a string which uniquely identifies the candi
date across multiple transports.
... as such, the foundation can be used to correlate candi
dates that are present on multiple rtcicetransport objects syntax var foundation = rtcicecandi
date.foundation; value a domstring which uniquely identifies the candi
date across all rtcicetransports on which it is available.
... note: if port is null — and port is supported by the user agent — passing the candi
date to addicecandi
date() will fail, throwing an operationerror exception.
...And 4 more matches
RTCIceCandidate.sdpMLineIndex - Web APIs
the read-only sdpmlineindex property on the rtcicecandi
date interface is a zero-based index of the m-line describing the media associated with the candi
date.
... this value is specified when creating the rtcicecandi
date by setting the corresponding sdpmlineindex value in the rtcicecandi
dateinit object when creating a new candi
date with new rtcicecandi
date().
... if you instead call rtcicecandi
date() with a string parameter containing the candi
date m-line text, the value of sdpmlineindex is extracted from the m-line.
...And 4 more matches
RTCIceCandidatePair.local - Web APIs
the local property of the rtcicecandi
datepair dictionary specifies the rtcicecandi
date which describes the configuration of the local end of a viable webrtc connection.
... syntax localcandi
date = rtcicecandi
datepair.local; value an rtcicecandi
date which describes the configuration of the local end of a viable pair of ice candi
dates.
... the rtcicecandi
datepair is returned by the rtcicetransport method getselectedcandi
datepair().
...And 4 more matches
RTCIceCandidatePair.remote - Web APIs
the remote property of the rtcicecandi
datepair dictionary specifies the rtcicecandi
date describing the configuration of the remote end of a viable webrtc connection.
... syntax remotecandi
date = rtcicecandi
datepair.remote; value an rtcicecandi
date which describes the configuration of the remote end of a viable pair of ice candi
dates.
... the rtcicecandi
datepair is returned by the rtcicetransport method getselectedcandi
datepair().
...And 4 more matches
RTCIceCandidatePair - Web APIs
the rtcicecandi
datepair dictionary describes a pair of ice candi
dates which together comprise a description of a viable connection between two webrtc endpoints.
... it is used as the return value from rtcicetransport.getselectedcandi
datepair() to identify the currently-selected candi
date pair identified by the ice agent.
... properties local an rtcicecandi
date describing the configuration of the local end of the connection.
...And 4 more matches
RTCIceCandidatePairStats.availableOutgoingBitrate - Web APIs
the rtcicecandi
datepairstats property availableoutgoingbitrate returns a value indicative of the available outbound capacity of the network connection represented by the candi
date pair.
... syntax availableoutgoingbitrate = rtcicecandi
datepairstats.availableoutgoingbitrate; value a floating-point value which approximates the amount of available bandwidth for outgoing data on the network connection described by the rtcicecandi
datepair.
... the rtcicecandi
datepair described by this object has never been used.
...And 4 more matches
RTCIceCandidateStats.url - Web APIs
the rtcicecandi
datestats dictionary's url property specifies the url of the ice server from which the described candi
date was obtained.
... this property is only available for local candi
dates.
... syntax url = rtcicecandi
datestats.url; value a domstring specifying the url of the ice server from which the candi
date described by the rtcicecandi
datestats was obtained.
...And 4 more matches
RTCIceTransport.onselectedcandidatepairchange - Web APIs
the rtcicetransport interface's onselectedcandi
datepairchange event handler specifies a function to be called to handle the selectedcandi
datepairchange event, which is fired when the ice agent selects a new candi
date pair to be used for the connection.
... syntax rtcicetransport.onselectedcandi
datepairchange = candi
datepairhandler; value this propoerty should be set to reference an event handler function to be called by the ice agent when it discovers a new candi
date pair that the rtcicetransport will be using for communication with the remote peer.
... this event will occur at least once, and may occur more than once if the ice agent continues to identify candi
date pairs that will work better, more closely match the requested parameters, and so forth.
...And 4 more matches
RTCIceTransport: selectedcandidatepairchange event - Web APIs
a selectedcandi
datepairchange event is sent to an rtcicetransport when the ice agent selects a new pair of candi
dates that describe the endpoints of a viable connection.
... the pair of candi
dates is in turn described by an rtcicecandi
datepair object which contains one rtcicecandi
date representing the local end of the connection, and another representing the remote end of the connection.
... together, the candi
dates can be used to establish a connection to be used by the rtcicetransport, and, by extension, by an rtcpeerconnection.
...And 4 more matches
Date.prototype.setMonth() - JavaScript
the setmonth() method sets the month for a specified
date according to the currently set year.
... syntax
dateobj.setmonth(monthvalue[, dayvalue]) versions prior to javascript 1.3
dateobj.setmonth(monthvalue) parameters monthvalue a zero-based integer representing the month of the year offset from the start of the year.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 4 more matches
Date.prototype.toTimeString() - JavaScript
the totimestring() method returns the time portion of a
date object in human readable form in american english.
... syntax
dateobj.totimestring() return value a string representing the time portion of the given
date in human readable form in american english.
... description
date instances refer to a specific point in time.
...And 4 more matches
WebAssembly.validate() - JavaScript
the webassembly.vali
date() function vali
dates a given typed array of webassembly binary code, returning whether the bytes form a valid wasm module (true) or not (false).
... syntax webassembly.vali
date(buffersource); parameters buffersource a typed array or arraybuffer containing webassembly binary code to be vali
dated.
... examples using vali
date the following example (see the vali
date.html source code, and see it live too) fetches a .wasm module and converts it into a typed array.
...And 4 more matches
NPN_InvalidateRect - Archive of obsolete content
« gecko plugin api reference « browser side plug-in api summary invali
dates the specified portion of the plugin's drawing area, adding it to the region that needs to be redrawn when the plugin next repaints its contents.
... syntax #include <npapi.h> void npn_invali
daterect(npp instance, nprect *invalidrect); parameters the function has the following parameters: instance pointer to the plug-in instance to invali
date a portion of.
... invalidrect the area to invali
date, specified in a coordinate system that originates at the top left of the plug-in's content area.
...And 3 more matches
NPN_InvalidateRegion - Archive of obsolete content
« gecko plugin api reference « browser side plug-in api summary invali
dates the specified drawing region prior to repainting or refreshing a windowless plug-in.
... syntax #include <npapi.h> void npn_invali
dateregion(npp instance, npregion invalidregion); parameters the function has the following parameters: instance pointer to the current plug-in instance.
... invalidregion the area to invali
date, specified in a coordinate system that originates at the top left of the plug-in.
...And 3 more matches
UpdateInfo
up
dateinfo objects hold information about available versions of add-ons and are generated as a result of an up
date check performed by addonup
datechecker.
... attributes attribute type description version string the version of the up
date.
... up
dateurl string the up
dateurl that the up
date can be downloaded from.
...And 3 more matches
Animation.updatePlaybackRate() - Web APIs
the up
dateplaybackrate() method of the web animations api's animation interface sets the speed of an animation after first synchronizing its playback position.
... up
dateplaybackrate() is an asynchronous method that sets the speed of an animation after synchronizing with its current playback position, ensuring that the resulting change in speed does not produce a sharp jump.
... after calling up
dateplaybackrate() the animation's playbackrate is not immediately up
dated.
...And 3 more matches
File.lastModifiedDate - Web APIs
the file.lastmodified
date read-only property returns the last modified
date of the file.
... files without a known last modified
date returns the current
date .
... syntax var time = instanceoffile.lastmodified
date value a
date object indicating the
date and time at which the file was last modified.
...And 3 more matches
MSCandidateWindowShow - Web APIs
mscandi
datewindowshow fires immediately after the input method editor (ime) candi
date window is set to appear, but before it renders.
... syntax event property object.oncandi
datewindowshow = handler; addeventlistener method object.addeventlistener("mscandi
datewindowshow", handler, usecapture) parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... this event fires after the positioning information of the ime candi
date window has been determined.
...And 3 more matches
RTCIceCandidatePairStats.nominated - Web APIs
the rtcicecandi
datepairstats property nominated specifies whether or not the candi
date pair described by the underlying rtcicecandi
datepair has been nominated to be used as the configuration for the webrtc connection.
... syntax nominated = rtcicecandi
datepairstats.nominated; value a boolean value which is set to true by the ice layer if the controlling user agent has indicated that the candi
date pair should be used to configure the webrtc connection between the two peers.
... note: if more than one candi
date pair are nominated at the same time, the one whose priority is higher will be selected for use.
...And 3 more matches
RTCIceCandidatePairStats.priority - Web APIs
the obsolete rtcicecandi
datepairstats property priority reports the priority of the candi
date pair as an integer value.
... the higher the value, the more likely the webrtc layer is to select the candi
date pair when the time comes to establish (or re-establish) a connection between the two peers.
... syntax pairpriority = rtcicecandi
datepairstats.priority; value an integer value indicating the priority of this pair of candi
dates as compared to other pairs on the same peer connection.
...And 3 more matches
RTCIceCandidateStats.networkType - Web APIs
the rtcicecandi
datestats dictionary's networktype property specifies the type of network used by a local candi
date to communicate with a remote peer.
... note: the networktype property is only included in rtcicecandi
datestats objects for local candi
dates (that is, candi
dates generated locally and included in an sdp offer or answer that has been sent to the remote peer).
... syntax networktype = rtcicecandi
datestats.networktype; value a domstring whose value is taken from the rtcnetworktype enumerated type.
...And 3 more matches
RTCIceCandidateStats.protocol - Web APIs
the rtcicecandi
datestats dictionary's protocol property specifies the protocol the specified candi
date would use for communication with the remote peer.
... syntax protocol = rtcicecandi
datestats.protocol; value the value is one of the members of the rtciceprotocol enumerated string type: tcp the candi
date, if selected, would use tcp as the transport protocol for its data.
... the tcptype property provides additional information about the kind of tcp candi
date represented by the object.
...And 3 more matches
RTCIceCandidateStats.relayProtocol - Web APIs
the rtcicecandi
datestats dictionary's relayprotocol property specifies the protocol being used by a local ice candi
date to communicate with the turn server.
... the ice protocl being used by the candi
date otherwise can be obtained from the protocol property.
... syntax relayprotocol = rtcicecandi
datestats.relayprotocol; value a domstring identifying the protocol being used by the endpoint to communicate with the turn server.
...And 3 more matches
RTCPeerConnection.onicecandidateerror - Web APIs
the rtcpeerconnection.onicecandi
dateerror property is an eventhandler which specifies a function which is called to handle the icecandi
dateerror event when it occurs on an rtcpeerconnection instance.
... this event is fired when an error occurs during the ice candi
date gathering process.
... syntax rtcpeerconnection.onicecandi
dateerror = eventhandler; value this should be set to a function you provide which is passed a single parameter: an rtcpeerconnectioniceerrorevent object describing the icecandi
dateerror event.
...And 3 more matches
RTCStatsIceCandidatePairState - Web APIs
the rtcstatsicecandi
datepairstate enumerated type represents the set of string values which are possible for the rtcicecandi
datepairstats object's state property.
... this represents the state of this candi
date pair within the ice check list for the rtcpeerconnection.
... see ice check lists in rtcicecandi
datepairstats.state for further information about how ice check lsits work.
...And 3 more matches
RangeError: invalid date - JavaScript
the javascript exception "invalid
date" occurs when a string leading to an invalid
date has been provided to
date or
date.parse().
... message rangeerror: invalid
date (edge) rangeerror: invalid
date (firefox) rangeerror: invalid time value (chrome) rangeerror: provided
date is not in valid range (chrome) error type rangeerror what went wrong?
... a string leading to an invalid
date has been provided to
date or
date.parse().
...And 3 more matches
Date.prototype.getDay() - JavaScript
the getday() method returns the day of the week for the specified
date according to local time, where 0 represents sunday.
... for the day of the month, see
date.prototype.get
date().
... syntax
dateobj.getday() return value an integer number, between 0 and 6, corresponding to the day of the week for the given
date, according to local time: 0 for sunday, 1 for monday, 2 for tuesday, and so on.
...And 3 more matches
Date.prototype.getYear() - JavaScript
the getyear() method returns the year in the specified
date according to local time.
... syntax
dateobj.getyear() return value a number representing the year of the given
date, according to local time, minus 1900.
... var xmas = new
date('december 25, 1995 23:15:00'); var year = xmas.getyear(); // returns 95 years above 1999 the second statement assigns the value 100 to the variable year.
...And 3 more matches
Date.now() - JavaScript
the static
date.now() method returns the number of milliseconds elapsed since january 1, 1970 00:00:00 utc.
... syntax var timeinms =
date.now(); return value a number representing the milliseconds elapsed since the unix epoch.
...engines which have not been up
dated to support this method can work around the absence of this method using the following shim: if (!
date.now) {
date.now = function now() { return new
date().gettime(); }; } examples reduced time precision to offer protection against timing attacks and fingerprinting, the precision of
date.now() might get rounded depending on browser settings.
...And 3 more matches
Date.prototype.setSeconds() - JavaScript
the setseconds() method sets the seconds for a specified
date according to local time.
... syntax
dateobj.setseconds(secondsvalue[, msvalue]) versions prior to javascript 1.3
dateobj.setseconds(secondsvalue) parameters secondsvalue an integer between 0 and 59, representing the seconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.setUTCFullYear() - JavaScript
the setutcfullyear() method sets the full year for a specified
date according to universal time.
... syntax
dateobj.setutcfullyear(yearvalue[, monthvalue[, dayvalue]]) parameters yearvalue an integer specifying the numeric value of the year, for example, 1995.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.setUTCMilliseconds() - JavaScript
the setutcmilliseconds() method sets the milliseconds for a specified
date according to universal time.
... syntax
dateobj.setutcmilliseconds(millisecondsvalue) parameters millisecondsvalue a number between 0 and 999, representing the milliseconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.setUTCMonth() - JavaScript
the setutcmonth() method sets the month for a specified
date according to universal time.
... syntax
dateobj.setutcmonth(monthvalue[, dayvalue]) parameters monthvalue an integer between 0 and 11, representing the months january through december.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.setUTCSeconds() - JavaScript
the setutcseconds() method sets the seconds for a specified
date according to universal time.
... syntax
dateobj.setutcseconds(secondsvalue[, msvalue]) parameters secondsvalue an integer between 0 and 59, representing the seconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.setYear() - JavaScript
the setyear() method sets the year for a specified
date according to local time.
... syntax
dateobj.setyear(yearvalue) parameters yearvalue an integer.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 3 more matches
Date.prototype.toGMTString() - JavaScript
the togmtstring() method converts a
date to a string, using internet greenwich mean time (gmt) conventions.
... the exact format of the value returned by togmtstring() varies according to the platform and browser, in general it should represent a human readable
date string.
... syntax
dateobj.togmtstring() return value a string representing the given
date following the internet greenwich mean time (gmt) convention.
...And 3 more matches
Date.prototype.toJSON() - JavaScript
the tojson() method returns a string representation of the
date object.
... syntax
dateobj.tojson() return value a string representation of the given
date.
... description
date instances refer to a specific point in time.
...And 3 more matches
Intl.DateTimeFormat.supportedLocalesOf() - JavaScript
the intl.
datetimeformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in
date and time formatting without having to fall back to the runtime's default locale.
... syntax intl.
datetimeformat.supportedlocalesof(locales[, options]) parameters locales a string with a bcp 47 language tag, or an array of such strings.
... return value an array of strings representing a subset of the given locale tags that are supported in
date and time formatting without having to fall back to the runtime's default locale.
...And 3 more matches
Debugging update problems
checking up
date requests if you're debugging the application up
date feature in firefox or other mozilla applications, you may need to see what requests are occurring.
... you can do this using the live http headers addon to determine the url of the up
date request.
... that url might look something like: https://aus3.mozilla.org/up
date/3/firefox/12.0a1/20120106040225/darwin_x86_64-gcc3-u-i386-x86_64-shark/nightly-profiling/darwin%2010.8.0/default/default/up
date.xml?force=1 you can then request this url manually to see what's inside.
...And 2 more matches
FC_DecryptUpdate
name fc_decryptup
date - decrypt a block of a multi-part encryption operation.
... syntax ck_rv fc_decryptup
date( ck_session_handle hsession, ck_byte_ptr pencryptedpart, ck_ulong usencryptedpartlen, ck_byte_ptr ppart, ck_ulong_ptr puspartlen ); parameters hsession [in] session handle.
... description fc_decryptup
date decrypts a block of data according to the attributes of the previous call to fc_decryptinit.
...And 2 more matches
FC_DigestUpdate
name fc_digestup
date - process the next block of a multi-part digest operation.
... syntax ck_rv fc_digestup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_digestup
date starts or continues a multi-part digest operation.
...And 2 more matches
FC_EncryptUpdate
name fc_encryptup
date - encrypt a block of a multi-part encryption operation.
... syntax ck_rv fc_encryptup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pusencryptedpartlen ); parameters hsession [in] session handle.
... description fc_encryptup
date encrypts a block of data according to the attributes of the previous call to fc_encryptinit.
...And 2 more matches
FC_SignUpdate
name fc_signup
date - process the next block of a multi-part signing operation.
... syntax ck_rv fc_signup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_signup
date starts or continues a multi-part signature operation.
...And 2 more matches
FC_VerifyUpdate
name fc_verifyup
date - process the next block of a multi-part verify operation.
... syntax ck_rv fc_verifyup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong uspartlen ); parameters hsession [in] session handle.
... description fc_verifyup
date starts or continues a multi-part signature verification operation where the signature is an appendix to the data.
...And 2 more matches
JS_ObjectIsDate
this article covers features introduced in spidermonkey 1.8.5 determines if a specified object is a
date object.
... syntax bool js_objectis
date(jscontext *cx, js::handleobject obj); name type description cx jscontext * pointer to a javascript context from which to derive runtime information.
... description js_objectis
date() can be used to check if you are dealing with a
date object, or a
date object used across compartments (or windows or sites, in the browser embedding).
...And 2 more matches
nsIUpdateTimerManager
toolkit/mozapps/up
date/nsiup
datetimermanager.idlscriptable this interface provides a global application service that provides support for long-duration timers (on the order of many days, weeks, or even months).
... these timers are used to schedule up
date checks in the future, for example.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview void registertimer(in astring id, in nsitimercallback callback, in unsigned long interval); methods registertimer() presents a user interface that checks for and displays the available up
dates.
...And 2 more matches
PaymentDetailsUpdate.error - Web APIs
the paymentdetailsup
date dictionary's error property is a human-readable domstring which provides an error message to be displayed if the specified information doesn't offer any valid shipping options.
... syntax errorstring = paymentdetailsup
date.error; paymentdetailsup
date.error = errorstring; value a domstring specifying the string to display to the user if the information specified in the paymentdetailsup
date doesn't provide any valid shipping options.
... the paymentdetailsup
date object specifies no valid shipping options in its shippingoptions list.
...And 2 more matches
PaymentRequestUpdateEvent - Web APIs
the paymentrequestup
dateevent interface is used for events sent to a paymentrequest instance when changes are made to shipping-related information for a pending paymentrequest.
... constructor paymentrequestup
dateevent() secure context creates a new paymentrequestup
dateevent object.
... methods in addition to methods inherited from the parent interface, event, paymentrequestup
dateevent offers the following methods: paymentrequestup
dateevent.up
datewith() secure context if the event handler determines that information included in the payment request needs to be changed, or that new information needs to be added, it calls up
datewith() with the information that needs to be replaced or added.
...And 2 more matches
RTCIceCandidate. toJSON() - Web APIs
the rtcicecandi
date method tojson() converts the rtcicecandi
date on which it's called into json in the form of an rtcicecandi
dateinit object.
... syntax json = rtcicecandi
date.tojson(); return value an object conforming to the rtcicecandi
dateinit dictionary, whose members' values are set to the corresponding values in the rtcicecandi
date object.
... example this simple example obtains a json string representing an rtcicecandi
date found in the variable candi
date.
...And 2 more matches
RTCIceCandidateInit.sdpMLineIndex - Web APIs
the optional property sdpmlineindex in the rtcicecandi
dateinit dictionary specifies the value of the rtcicecandi
date object's sdpmlineindex property.
... value a number containing a 0-based index into the set of m-lines providing media descriptions, indicating which media source is associated with the candi
date, or null if no such association is available.
... note: attempting to add a candi
date (using addicecandi
date()) that has a value of null for either sdpmid or sdpmlineindex will throw a typeerror exception.
...And 2 more matches
RTCIceCandidateInit.sdpMid - Web APIs
the optional property sdpmid in the rtcicecandi
dateinit dictionary specifies the value of the rtcicecandi
date object's sdpmid property.
... value a domstring which uniquely identifies the source media component from which the candi
date draws data, or null if no such association exists for the candi
date.
... note: attempting to add a candi
date (using addicecandi
date()) that has a value of null for either sdpmid or sdpmlineindex will throw a typeerror exception.
...And 2 more matches
RTCIceCandidatePairStats.availableIncomingBitrate - Web APIs
the rtcicecandi
datepairstats property availableincomingbitrate returns a value indicative of the available inbound capacity of the network connection represented by the candi
date pair.
... syntax availableincomingbitrate = rtcicecandi
datepairstats.availableincomingbitrate; value a floating-point value which approximates the amount of available bandwidth for incoming data on the network connection described by the rtcicecandi
datepair.
... the value returned is calculated by adding up the available bit rate for every rtp stream using the connection described by this candi
date pair.
...And 2 more matches
RTCIceCandidatePairStats.consentExpiredTimestamp - Web APIs
the rtcicecandi
datepairstats property consentexpiredtimestamp indicates the time at which the most recent stun binding response expired.
... syntax consentexpiration = rtcicecandi
datepairstats.consentexpiredtimestamp; value a domhighrestimestamp object that indicates the time at which the stun binding that allows the two peers described by this rtcicecandi
datepair to communicate will expire (or the time at which the binding did expire, if the time has passed).
... this property's value is undefined if there have been no stun binding responses yet on the candi
date pair.
...And 2 more matches
RTCIceCandidatePairStats.packetsReceived - Web APIs
the rtcicecandi
datepairstats dictionary's packetsreceived property indicates the total number of packets of any kind that have been received on the connection described by the pair of candi
dates.
... the number of packets sent to
date on the connection can be obtained using packetssent.
... syntax packetsreceived = rtcicecandi
datepairstats.packetsreceived; value an integer value indicating the total number of packets, of any kind, which have been received on the connection described by the two candi
dates comprising this pair.
...And 2 more matches
RTCIceCandidatePairStats.packetsSent - Web APIs
the rtcicecandi
datepairstats dictionary's packetssent property indicates the total number of packets which have been sent on the connection described by the pair of candi
dates.
... the number of packets received to
date on the connection can be obtained using packetsreceived.
... syntax packetssent = rtcicecandi
datepairstats.packetssent; value an integer value indicating the total number of packets, of any kind, which have been sent on the connection described by the two candi
dates comprising this pair.
...And 2 more matches
RTCIceCandidateStats.transportId - Web APIs
the rtcicecandi
datestats dictionary's transportid property is a string that uniquely identifies the transport that produced the rtctransportstats from which information about this candi
date was taken.
... syntax transportid = rtcicecandi
datestats.transportid; value a domstring whose value uniquely identifies the transport from which any transport-related information accumulated in the rtcicecandi
datestats was taken.
... this can be used to compare candi
dates that would use the same transport, for example.
...And 2 more matches
WebGLRenderingContext.validateProgram() - Web APIs
the webglrenderingcontext.vali
dateprogram() method of the webgl api vali
dates a webglprogram.
... syntax void gl.vali
dateprogram(program); parameters program a webglprogram to vali
date.
... examples var program = gl.createprogram(); // attach pre-existing shaders gl.attachshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.vali
dateprogram(program); if ( !gl.getprogramparameter( program, gl.link_status) ) { var info = gl.getprograminfolog(program); throw 'could not compile webgl program.
...And 2 more matches
XRSession.updateRenderState() - Web APIs
the up
daterenderstate() method of the xrsession interface of webxr api schedules changes to be applied to the active render state prior to rendering of the next frame.
... syntax xrsession.up
daterenderstate(newstate) parameters newstate an object conforming to the xrrenderstateinit dictionary specifying the properties of the session's renderstate to up
date before rendering the next frame.
... the baselayer specified in newstate was created by an xrsession other than the one on which up
daterenderstate() was called.
...And 2 more matches
update - CSS: Cascading Style Sheets
the up
date css media feature can be used to test how frequently (if at all) the output device is able to modify the appearance of content.
... syntax the up
date feature is specified as a single keyword value chosen from the list below.
... none once it has been rendered, the layout can no longer be up
dated.
...And 2 more matches
Date.prototype[@@toPrimitive] - JavaScript
the [@@toprimitive]() method converts a
date object to a primitive value.
... syntax
date()[symbol.toprimitive](hint); return value the primitive value of the given
date object.
... description the [@@toprimitive]() method of the
date object returns a primitive value, that is either of type number or of type string.
...And 2 more matches
Date.prototype.getMonth() - JavaScript
the getmonth() method returns the month in the specified
date according to local time, as a zero-based value (where zero indicates the first month of the year).
... syntax
dateobj.getmonth() return value an integer number, between 0 and 11, representing the month in the given
date according to local time.
... examples using getmonth() the second statement below assigns the value 11 to the variable month, based on the value of the
date object xmas95.
...And 2 more matches
Date.prototype.setMilliseconds() - JavaScript
the setmilliseconds() method sets the milliseconds for a specified
date according to local time.
... syntax
dateobj.setmilliseconds(millisecondsvalue) parameters millisecondsvalue a number between 0 and 999, representing the milliseconds.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 2 more matches
Date.prototype.setMinutes() - JavaScript
the setminutes() method sets the minutes for a specified
date according to local time.
... syntax
dateobj.setminutes(minutesvalue[, secondsvalue[, msvalue]]) versions prior to javascript 1.3
dateobj.setminutes(minutesvalue) parameters minutesvalue an integer between 0 and 59, representing the minutes.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 2 more matches
Date.prototype.setTime() - JavaScript
the settime() method sets the
date object to the time represented by a number of milliseconds since january 1, 1970, 00:00:00 utc.
... syntax
dateobj.settime(timevalue) parameters timevalue an integer representing the number of milliseconds since 1 january 1970, 00:00:00 utc.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date (effectively, the value of the argument).
...And 2 more matches
Date.prototype.setUTCHours() - JavaScript
the setutchours() method sets the hour for a specified
date according to universal time, and returns the number of milliseconds since january 1, 1970 00:00:00 utc until the time represented by the up
dated
date instance.
... syntax
dateobj.setutchours(hoursvalue[, minutesvalue[, secondsvalue[, msvalue]]]) parameters hoursvalue an integer between 0 and 23, representing the hour.
... return value the number of milliseconds between january 1, 1970 00:00:00 utc and the up
dated
date.
...And 2 more matches
Date.prototype.setUTCMinutes() - JavaScript
the setutcminutes() method sets the minutes for a specified
date according to universal time.
... syntax
dateobj.setutcminutes(minutesvalue[, secondsvalue[, msvalue]]) parameters minutesvalue an integer between 0 and 59, representing the minutes.
... return value the number of milliseconds between 1 january 1970 00:00:00 utc and the up
dated
date.
...And 2 more matches
Date.prototype.valueOf() - JavaScript
the valueof() method returns the primitive value of a
date object.
... syntax
dateobj.valueof() return value the number of milliseconds between 1 january 1970 00:00:00 utc and the given
date.
... description the valueof() method returns the primitive value of a
date object as a number data type, the number of milliseconds since midnight 01 january, 1970 utc.
...And 2 more matches
modDate - Archive of obsolete content
summary returns the last modified
date of a specified file or directory.
... method of file object syntax double mod
date ( filespecobject nativefolderpath ); parameters the mod
date method has the following parameters: nativefolderpath a filespecobject representing the queried file.
... returns a double number representing the
date that the file was last modified.
... example f = getfolder("program"); filesource = getfolder(f, "myfile.txt"); err = file.mod
date(filesource); see mod
datechanged for an example of comparing the
dates of two files.
UpdateCheckListener
up
datechecklisteners are passed the results of up
date checks performed by the addonup
datechecker.
... method overview void onup
datecheckcomplete(in up
dateinfo results[]) void onup
datecheckerror(in integer status) methods onup
datecheckcomplete() called when the up
date check completed successfully.
... void onup
datecheckcomplete( in up
dateinfo results[] ) parameters results an array of up
dateinfo objects representing the available add-on versions onup
datecheckerror() called when the up
date check fails.
... void onup
datecheckerror( in integer status ) parameters status a value representing the type of failure; see the range of possible values.
FC_DecryptDigestUpdate
name fc_decryptdigestup
date - continue a multi-part decrypt and digest operation syntax ck_rv fc_decryptdigestup
date( ck_session_handle hsession, ck_byte_ptr pencryptedpart, ck_ulong ulencryptedpartlen, ck_byte_ptr ppart, ck_ulong_ptr pulpartlen ); parameters hsession [in] session handle.
... description fc_decryptdigestup
date continues a multi-part decrypt and digest operation.
...a user must log into the token (to assume the nss user role) before calling fc_decryptdigestup
date.
... return value examples see also nsc_decryptdigestup
date ...
FC_DecryptVerifyUpdate
name fc_decryptverifyup
date - continue a multi-part decrypt and verify operation syntax ck_rv fc_decryptverifyup
date( ck_session_handle hsession, ck_byte_ptr pencrypteddata, ck_ulong ulencrypteddatalen, ck_byte_ptr pdata, ck_ulong_ptr puldatalen ); parameters hsession [in] session handle.
... description fc_decryptverifyup
date continues a multi-part decryption and and signature verification operation.
...a user must log into the token (to assume the nss user role) before calling fc_decryptverifyup
date.
... return value examples see also nsc_decryptverifyup
date ...
FC_DigestEncryptUpdate
name fc_digestencryptup
date - continue a multi-part digest and encryption operation syntax ck_rv fc_digestencryptup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong ulpartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pulencryptedpartlen ); parameters hsession [in] session handle.
... description fc_digestencryptup
date continues a multi-part digest and encryption operation.
...a user must log into the token (to assume the nss user role) before calling fc_digestencryptup
date.
... return value examples see also nsc_digestencryptup
date ...
FC_SignEncryptUpdate
name fc_signencryptup
date - continue a multi-part signing and encryption operation syntax ck_rv fc_signencryptup
date( ck_session_handle hsession, ck_byte_ptr ppart, ck_ulong ulpartlen, ck_byte_ptr pencryptedpart, ck_ulong_ptr pulencryptedpartlen ); parameters hsession [in] session handle.
... description fc_signencryptup
date continues a multi-part signature and encryption operation.
...a user must log into the token (to assume the nss user role) before calling fc_signencryptup
date.
... return value examples see also nsc_signencryptup
date ...
JS_ClearDateCaches
this article covers features introduced in spidermonkey 17 clear the cache of calculated local time from each
date object.
... syntax void js_clear
datecaches(jscontext *cx); name type description cx jscontext * pointer to a javascript context from which to derive runtime information.
... description js_clear
datecaches clears the cache of calculated local time from each
date object.
... see also mxr id search for js_clear
datecaches js_new
dateobject js_new
dateobjectmsec js_objectis
date bug 285615 replaced by js::resettimezone ...
JS_NewDateObject
this article covers features introduced in spidermonkey 1.8.5 creates a new
date object instance for the given time and
date.
... syntax jsobject * js_new
dateobject(jscontext *cx, int year, int mon, int mday, int hour, int min, int sec); name type description cx jscontext * the context in which to create the new
date object.
... description creates and returns a new jsobject representing a javascript
date object, which is pre-configured using the specified values.
... see also mxr id search for js_new
dateobject js_new
dateobjectmsec js_objectis
date bug 625870 ...
JS_NewDateObjectMsec
this article covers features introduced in spidermonkey 1.8.5 creates a new
date object instance, configured to represent the
date and time indicated by the specified time in milliseconds since the unix epoch.
... syntax jsobject * js_new
dateobjectmsec(jscontext *cx, double msec); name type description cx jscontext * the context.
... description the returned jsobject is a standard javascript
date.
... see also mxr id search for js_new
dateobjectmsec js_new
dateobject js_objectis
date bug 625870 ...
nsIMsgDBViewCommandUpdater
the nsimsgdbviewcommandup
dater interface controls changes that occur as the selection changes.
... last changed in gecko 1.9 (firefox 3) inherits from: nsisupports in thunderbird this is implemented for different windows in several different places: nsmsgdbviewcommandup
dater (for the standalone message window) nsmsgdbviewcommandup
dater (for the threadpane message window) nsmsgsearchcommandup
dater (for search dialogs) method overview void up
datecommandstatus(); void displaymessagechanged(in nsimsgfolder afolder, in astring asubject, in acstring akeywords); void up
datenextmessageafterdelete(); methods up
datecommandstatus() called when the number of selected items changes.
... void up
datecommandstatus(); parameters none.
... up
datenextmessageafterdelete() allows the backend to tell the front end to re-determine which message we should select after a delete or move void up
datenextmessageafterdelete(); parameters none.
HTMLTimeElement.dateTime - Web APIs
the htmltimeelement.
datetime property is a domstring that reflects the
datetime html attribute, containing a machine-readable form of the element's
date and time value.
... the format of the string must follow one of the following html microsyntaxes: microsyntax description examples valid month string yyyy-mm 2011-11, 2013-05 valid
date string yyyy-mm-dd 1887-12-01 valid yearless
date string mm-dd 11-12 valid time string hh:mm hh:mm:ss hh:mm:ss.mmm 23:59 12:15:47 12:15:52.998 valid local
date and time string yyyy-mm-dd hh:mm yyyy-mm-dd hh:mm:ss yyyy-mm-dd hh:mm:ss.mmm yyyy-mm-ddthh:mm yyyy-mm-ddthh:mm:ss yyyy-mm-ddthh:mm:ss.mmm 2013-12-25 11:12 1972-07-25 13:43:07 1941-03-15 07:06:23.678 2013-12-25t11:12 1972-07-25t13:43:07 1941-03-15t07:06:23.678 valid time-zone offset string z +hhmm +hh:mm ...
... -hhmm -hh:mm z +0200 +04:30 -0300 -08:00 valid global
date and time string any combination of a valid local
date and time string followed by a valid time-zone offset string 2013-12-25 11:12+0200 1972-07-25 13:43:07+04:30 1941-03-15 07:06:23.678z 2013-12-25t11:12-08:00 valid week string yyyy-www 2013-w46 four or more ascii digits yyyy 2013, 0001 valid duration string pddthhmmss pddthhmms.xs pddthhmms.xxs pddthhmms.xxxs pthhmmss pthhmms.xs pthhmms.xxs pthhmms.xxxs ww dd hh mm ss p12dt7h12m13s p12dt7h12m13.3s p12dt7h12m13.45s p12dt7h12m13.455s pt7h12m13s pt7h12m13.2s pt7h12m13.56s pt7h12m13.999s 7d 5h 24m 13s syntax
datetimestrin...
...g = timeelt.
datetime; timeelt.
datetime =
datetimestring example // assumes there is <time id="t"> element in the html var t = document.getelementbyid("t"); t.
datetime = "6w 5h 34m 5s"; specifications specification status comment html living standardthe definition of 'htmltimeelement' in that specification.
PaymentDetailsUpdate.shippingAddressErrors - Web APIs
the paymentdetailsup
date dictionary's shippingaddresserrors property, if present, contains an addresserrors object whose contents provide error messages for one or more of the values in the paymentaddress specified as paymentrequest.shippingaddress.
... syntax var addresserrors = paymentdetailsup
date.shippingaddresserrors; value an addresserrors object, which contains domstrings describing errors in the properties of a paymentaddress.
... specifications specification status comment payment request apithe definition of 'paymentdetailsup
date.shippingaddresserrors' in that specification.
... candi
date recommendation initial definition.
RTCIceCandidatePairStats.bytesReceived - Web APIs
the rtcicecandi
datepairstats property bytesreceived indicates the total number of payload bytes—that is, bytes which aren't overhead such as headers or padding—that hve been received to
date on the connection described by the candi
date pair.
... syntax received = rtcicecandi
datepairstats.bytesreceived; value an integer value indicating the total number of bytes received so far on the connection described by this candi
date pair.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.bytesreceived' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.bytesSent - Web APIs
the rtcicecandi
datepairstats property bytessent indicates the total number of payload bytes—that is, bytes which aren't overhead such as headers or padding—that hve been sent so far on the connection described by the candi
date pair.
... syntax sent = rtcicecandi
datepairstats.bytessent; value an integer value indicating the total number of bytes sent so far on the connection described by this candi
date pair.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.bytessent' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.circuitBreakerTriggerCount - Web APIs
the rtcicecandi
datepairstats property circuitbreakertriggercount indicates the number of times the circuit-breaker has been triggered to indicate a connection timeout or other unexpected connection abort on this specific connection configuration.
... syntax cbtcount = rtcicecandi
datepairstats.circuitbreakertriggercount; value an integer value indicating the number of times the circuit-breaker has been triggered for the 5-tuple used by this connection.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.circuitbreakertriggercount' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.consentRequestsSent - Web APIs
the rtcicecandi
datepairstats property consentrequestssent specifies the number of consent requests that have been sent by this peer to the remote peer on the connection described by the pair of candi
dates.
... syntax consentrequestssent = rtcicecandi
datepairstats.consentrequestssent; value an integer indicating the number of consent requests this peer has sent to the other peer over the connection described by the pair of candi
dates referenced by this rtcicecandi
datepairstats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.consentrequestssent' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.currentRoundTripTime - Web APIs
the rtcicecandi
datepairstats property currentroundtriptime is a floating-point value indicating the number of seconds it takes for data to be sent by this peer to the remote peer and back over the connection described by this pair of ice candi
dates.
... syntax rtt = rtcicecandi
datepairstats.currentroundtriptime; value a floating-point value indicating the round-trip time, in seconds for the connection described by the pair of candi
dates for which this rtcicecandi
datepairstats object offers statistics.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.currentroundtriptime' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.firstRequestTimestamp - Web APIs
the rtcicecandi
datepairstats property firstrequesttimestamp specifies the time at which the first stun request was sent on the described candi
date pair.
... syntax firstrequesttimestamp = rtcicecandi
datepairstats.firstrequesttimestamp; value a domhighrestimestamp object indicating the timestamp at which the first stun request was sent on the connection described by the described pair of candi
dates.
... you can use this value in combination with lastrequesttimestamp and requestssent to compute the average interval between consecutive connectivity checks: avgcheckinterval = (candi
datepairstats.lastrequesttimestamp - candi
datepairstats.firstrequesttimestamp) / candi
datepairstats.requestssent; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.firstrequesttimestamp' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.lastPacketReceivedTimestamp - Web APIs
the rtcicecandi
datepairstats property lastpacketreceivedtimestamp indicates the time at which the connection described by the candi
date pair last received a packet.
... syntax lastpacketreceivedtimestamp = rtcicecandi
datepairstats.lastpacketreceivedtimestamp; value a domhighrestimestamp object indicating the timestamp at which the connection described by pair of candi
dates last received a packet, stun packets excluded.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.lastpacketreceivedtimestamp' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidateStats.lastPacketSentTimestamp - Web APIs
the rtcicecandi
datepairstats property lastpacketsenttimestamp indicates the time at which the connection described by the candi
date pair last sent a packet, not including stun packets.
... syntax lastpacketsenttimestamp = rtcicecandi
datepairstats.lastpacketsenttimestamp; value a domhighrestimestamp object indicating the timestamp at which the connection described by pair of candi
dates last sent a packet, stun packets excluded.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.lastpacketsenttimestamp' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.lastRequestTimestamp - Web APIs
the rtcicecandi
datepairstats property lastrequesttimestamp indicates the time at which the most recent stun request was sent on the described candi
date pair.
... syntax lastrequesttimestamp = rtcicecandi
datepairstats.lastrequesttimestamp; value a domhighrestimestamp object indicating the timestamp at which the last (most recent) stun request was sent on the connection indicated by the described pair of candi
dates.
... you can use this value in combination with firstrequesttimestamp and requestssent to compute the average interval between consecutive connectivity checks: avgcheckinterval = (candi
datepairstats.lastrequesttimestamp - candi
datepairstats.firstrequesttimestamp) / candi
datepairstats.requestssent; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.lastrequesttimestamp' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidateStats.lastResponseTimestamp - Web APIs
the rtcicecandi
datepairstats property lastresponsetimestamp indicates the time at which the last stun response was received on the described candi
date pair.
... syntax lastresponsetimestamp = rtcicecandi
datepairstats.lastresponsetimestamp; value a domhighrestimestamp object indicating the timestamp at which the most recent stun response was received on the connection defined by the described pair of candi
dates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.lastresponsetimestamp' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.requestsReceived - Web APIs
the rtcicecandi
datepairstats dictionary's requestsreceived property indicates the total number of stun connectivity check requests that have been received so far on the connection described by this pairing of candi
dates.
... syntax requestsreceived = rtcicecandi
datepairstats.requestsreceived; value an integer value which specifies the number of stun connectivity and/or consent requests that have been received to
date on the connection described by this pair of ice candi
dates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.requestsreceived' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.requestsSent - Web APIs
the rtcicecandi
datepairstats dictionary's requestssent property indicates the total number of stun connectivity check requests that have been sent so far on the connection described by this pair of candi
dates.
... syntax requestssent = rtcicecandi
datepairstats.requestssent; value an integer value which specifies the number of stun connectivity requests that have been sent to
date on the connection described by this pair of ice candi
dates.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.requestssent' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.responsesReceived - Web APIs
the responsesreceived property in the rtcicecandi
datepairstats dictionary indicates the total number of stun connectivity check responses that have been received on the connection described by this pair of candi
dates.
... syntax responsesreceived = rtcicecandi
datepairstats.responsesreceived; value an integer value which specifies the number of stun connectivity request responses that have been received on the connection described by this pair of candi
dates so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.responsesreceived' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.responsesSent - Web APIs
the rtcicecandi
datepairstats dictionary's responsessent property indicates the total number of stun connectivity check responses that have been sent so far on the connection described by this pair of candi
dates.
... syntax responsessent = rtcicecandi
datepairstats.responsessent; value an integer value indicating the number of times a repsonse has been sent to a stun connectivity check request.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.responsessent' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.retransmissionsReceived - Web APIs
the rtcicecandi
datepairstats dictionary's retransmissionsreceived property indicates the total number of stun connectivity check request retransmissions that have been received so far on the pair of candi
dates.
... syntax retransmissionsreceived = rtcicecandi
datepairstats.retransmissionsreceived; value an integer value indicating the total number of retransmitted stun connectivity check requests have been received on the connection referenced by this candi
date pair so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.retransmissionsreceived' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.retransmissionsSent - Web APIs
the rtcicecandi
datepairstats dictionary's retransmissionssent property indicates the total number of stun connectivity check request retransmissions that have been sent so far on the pair of candi
dates.
... syntax retransmissionssent = rtcicecandi
datepairstats.retransmissionssent; value an integer value indicating the total number of retransmitted stun connectivity check requests have been sent on the connection referenced by this candi
date pair so far.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.retransmissionssent' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.totalRoundTripTime - Web APIs
the rtcicecandi
datepairstats dictionary's totalroundtriptime property is the total time that has elapsed between sending stun requests and receiving the responses, for all such requests that have been made so far on the pair of candi
dates described by this rtcicecandi
datepairstats object.
... syntax totalrtt = rtcicecandi
datepairstats.totalroundtriptime; value this floating-point value indicates the total number of seconds which have elapsed between sending out stun connectivity and consent check requests and receiving their responses, for all such requests made so far on the connection described by this candi
date pair.
... you can calculate the average round-trip time (rtt) by dividing this value by the value of the responsesreceived property: rtt = rtcicecandi
datepairstats.totalroundtriptime / rtcicecandi
datepairstats.responsesreceived; specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.totalroundtriptime' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidatePairStats.transportId - Web APIs
the transportid property uniquely identifies the rtcicetransport that was inspected to obtain the transport-related statistics contained in the rtcicecandi
datepairstats object.
... syntax transportid = rtcicecandi
datepairstats.transportid; value a domstring which uniquely identifies the rtcicetransport object from which the transport-related data was obtained for the statistics contained in this rtcicecandi
datepairstats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datepairstats.transportid' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidateStats.address - Web APIs
the address property of the rtcicecandi
datestats dictionary indicates the address of the ice candi
date.
... syntax candi
dateaddress = rtcicecandi
datestats.address; value either an ipv4 or ipv6 address or a fully-qualified domain name, which corresponds to the candi
date.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datestats.address' in that specification.
... candi
date recommendation initial specification.
RTCIceCandidateStats.port - Web APIs
the rtcicecandi
datestats dictionary's port property specifies the network port used by the candi
date.
... syntax candi
dateport = rtcicecandi
datestats.port; value an integer value indicating the network port used by the rtcicecandi
date described by the rtcicecandi
datestats object.
... specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandi
datestats.port' in that specification.
... candi
date recommendation initial specification.
RTCIceTcpCandidateType - Web APIs
the webrtc api's rtcicetcpcandi
datetype enumerated type provides a set of domstring values representing the types of tcp candi
dates.
... usage notes the rtcicetcpcandi
datetype type is used by the tcptype property of rtcicecandi
date objects.
... specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcicetcpcandi
datetype' in that specification.
... candi
date recommendation initial definition.
RTCPeerConnectionIceEvent.candidate - Web APIs
the read-only candi
date property of the rtcpeerconnectioniceevent interface returns the rtcicecandi
date associated with the event.
... syntax var candi
date = event.candi
date; value an rtcicecandi
date object representing the ice candi
date that has been received, or null to indicate that there are no further candi
dates for this negotiation session.
... example pc.onicecandi
date = function( ev ) { alert("the ice candi
date (transport address: '" + ev.candi
date.candi
date + "') has been added to this connection."); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcpeerconnectioniceevent.candi
date' in that specification.
... candi
date recommendation initial specification.
Date - HTTP
the
date general http header contains the
date and time at which the message was originated.
... note that
date is listed in the forbidden header names in the fetch spec - so this code will not send
date header: fetch('https://httpbin.org/get', { 'headers': { '
date': (new
date()).toutcstring() } }) header type general header forbidden header name yes syntax
date: <day-name>, <day> <month> <year> <hour>:<minute>:<second> gmt directives <day-name> one of "mon", "tue", "wed", "thu", "fri", "sat", or "sun" (case-sensitive).
...http
dates are always expressed in gmt, never in local time.
... examples
date: wed, 21 oct 2015 07:28:00 gmt new
date().toutcstring() // "mon, 09 mar 2020 08:13:24 gmt" specifications specification title rfc 7231, section 7.1.1.2:
date hypertext transfer protocol (http/1.1): semantics and content ...
Date.prototype.getFullYear() - JavaScript
the getfullyear() method returns the year of the specified
date according to local time.
... syntax
dateobj.getfullyear() return value a number corresponding to the year of the given
date, according to local time.
...for
dates between the years 1000 and 9999, getfullyear() returns a four-digit number, for example, 1995.
... var today = new
date(); var year = today.getfullyear(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getfullyear' in that specification.
Date.prototype.getHours() - JavaScript
the gethours() method returns the hour for the specified
date, according to local time.
... syntax
dateobj.gethours() return value an integer number, between 0 and 23, representing the hour for the given
date according to local time.
... examples using gethours() the second statement below assigns the value 23 to the variable hours, based on the value of the
date object xmas95.
... let xmas95 = new
date('december 25, 1995 23:15:30'); let hours = xmas95.gethours(); console.log(hours); // 23 specifications specification ecmascript (ecma-262)the definition of '
date.prototype.gethours' in that specification.
Date.prototype.getMinutes() - JavaScript
the getminutes() method returns the minutes in the specified
date according to local time.
... syntax
dateobj.getminutes() return value an integer number, between 0 and 59, representing the minutes in the given
date according to local time.
... examples using getminutes() the second statement below assigns the value 15 to the variable minutes, based on the value of the
date object xmas95.
... var xmas95 = new
date('december 25, 1995 23:15:30'); var minutes = xmas95.getminutes(); console.log(minutes); // 15 specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getminutes' in that specification.
Date.prototype.getSeconds() - JavaScript
the getseconds() method returns the seconds in the specified
date according to local time.
... syntax
dateobj.getseconds() return value an integer number, between 0 and 59, representing the seconds in the given
date according to local time.
... examples using getseconds() the second statement below assigns the value 30 to the variable seconds, based on the value of the
date object xmas95.
... var xmas95 = new
date('december 25, 1995 23:15:30'); var seconds = xmas95.getseconds(); console.log(seconds); // 30 specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getseconds' in that specification.
Date.prototype.getTimezoneOffset() - JavaScript
syntax
dateobj.gettimezoneoffset() return value a number representing the time-zone offset, in minutes, from the
date based on current host system settings to utc.
... current locale utc-8 utc utc+3 return value 480 0 -180 the time zone offset returned is the one that applies for the
date that it's called on.
... if the host system is configured for daylight saving, the offset will change depending on the
date and time that the
date represents and that daylight saving applies.
... examples using gettimezoneoffset() // get current timezone offset for host device let x = new
date(); let currenttimezoneoffsetinhours = x.gettimezoneoffset() / 60; // 1 // get timezone offset for international labour day (may 1) in 2016 // be careful, the
date() constructor uses 0-indexed months, so may is // represented with 4 (and not 5) let labourday = new
date(2016, 4, 1) let labourdayoffset = labourday.gettimezoneoffset() / 60; specifications specification ecmascript (ecma-262)the definition of '
date.prototype.gettimezoneoffset' in that specification.
Date.prototype.getUTCDay() - JavaScript
the getutcday() method returns the day of the week in the specified
date according to universal time, where 0 represents sunday.
... syntax
dateobj.getutcday() return value an integer number corresponding to the day of the week for the given
date, according to universal time: 0 for sunday, 1 for monday, 2 for tuesday, and so on.
... examples using getutcday() the following example assigns the weekday portion of the current
date to the variable weekday.
... var today = new
date(); var weekday = today.getutcday(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutcday' in that specification.
Date.prototype.getUTCMonth() - JavaScript
the getutcmonth() returns the month of the specified
date according to universal time, as a zero-based value (where zero indicates the first month of the year).
... syntax
dateobj.getutcmonth() return value an integer number, between 0 and 11, corresponding to the month of the given
date according to universal time.
... examples using getutcmonth() the following example assigns the month portion of the current
date to the variable month.
... var today = new
date(); var month = today.getutcmonth(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutcmonth' in that specification.
Date.prototype.toISOString() - JavaScript
syntax
dateobj.toisostring() return value a string representing the given
date in the iso 8601 format according to universal time.
...engines which have not been up
dated to support this method can work around the absence of this method using the following shim: if (!
date.prototype.toisostring) { (function() { function pad(number) { if (number < 10) { return '0' + number; } return number; }
date.prototype.toisostring = function() { return this.getutcfullyear() + '-' + pad(this.getutcmonth() + 1) + '-' + pad(this.getutc
date()) + 't' + pad(this.getutchours()) + ':' + pad(this.getutcminutes()) + ':' + pad(this.getutcseconds()) + '.' + (this.getutcmilliseconds() / 1000).tofixed(3).slice(2, 5) + 'z'; }; })(); } examples using toisostring() let today ...
...= new
date('05 october 2011 14:48 utc') console.log(today.toisostring()) // returns 2011-10-05t14:48:00.000z the above example uses parsing of a non–standard string value that may not be correctly parsed in non–mozilla browsers.
... specifications specification ecmascript (ecma-262)the definition of '
date.prototype.toisostring' in that specification.
Date.prototype.toUTCString() - JavaScript
the toutcstring() method converts a
date to a string, using the utc time zone.
... syntax
dateobj.toutcstring() return value a string representing the given
date using the utc time zone.
...the most common return value was an rfc-1123 formatted
date stamp, which is a slightly up
dated version of rfc-822
date stamps.
... examples using toutcstring() let today = new
date('wed, 14 jun 2017 00:00:00 pdt'); let utcstring = today.toutcstring(); // wed, 14 jun 2017 07:00:00 gmt specifications specification ecmascript (ecma-262)the definition of '
date.prototype.toutcstring' in that specification.
Intl.DateTimeFormat.prototype.formatRange() - JavaScript
the intl.
datetimeformat.prototype.formatrange() formats a
date range in the most concise way based on the locale and options provided when instantiating intl.
datetimeformat object.
... syntax intl.
datetimeformat.prototype.formatrange(start
date, end
date) examples basic formatrange usage this method receives two
dates and formats the
date range in the most concise way based on the locale and options provided when instantiating intl.
datetimeformat.
... let
date1 = new
date(
date.utc(2007, 0, 10, 10, 0, 0)); let
date2 = new
date(
date.utc(2007, 0, 10, 11, 0, 0)); let
date3 = new
date(
date.utc(2007, 0, 20, 10, 0, 0)); // > 'wed, 10 jan 2007 10:00:00 gmt' // > 'wed, 10 jan 2007 11:00:00 gmt' // > 'sat, 20 jan 2007 10:00:00 gmt' let fmt1 = new intl.
datetimeformat("en", { year: '2-digit', month: 'numeric', day: 'numeric', hour: 'numeric', minute: 'numeric' }); console.log(fmt1.format(
date1)); console.log(fmt1.formatrange(
date1,
date2)); console.log(fmt1.formatrange(
date1,
date3)); // > '1/10/07, 10:00 am' // > '1/10/07, 10:00 – 11:00 am' // > '1/10/07, 10:00 am – 1/20/07, 10:00 am' let fmt2 = new intl.
datetimeformat("en", { year: 'numeric', month: 'short', day: 'numeric' }); console.log(fmt2.format(
date1)); c...
...onsole.log(fmt2.formatrange(
date1,
date2)); console.log(fmt2.formatrange(
date1,
date3)); // > 'jan 10, 2007' // > 'jan 10, 2007' // > 'jan 10 – 20, 2007' specifications specification intl.
datetimeformat.formatrangethe definition of 'formatrange()' in that specification.
Intl.DateTimeFormat.prototype.formatRangeToParts() - JavaScript
the intl.
datetimeformat.prototype.formatrangetoparts() method allows locale-specific tokens representing each part of the formatted
date range produced by
datetimeformat formatters.
... syntax intl.
datetimeformat.prototype.formatrangetoparts(start
date, end
date) examples basic formatrangetoparts usage this method receives two
dates and returns an array of objects containing the locale-specific tokens representing each part of the formatted
date range.
... let
date1 = new
date(
date.utc(2007, 0, 10, 10, 0, 0)); let
date2 = new
date(
date.utc(2007, 0, 10, 11, 0, 0)); // > 'wed, 10 jan 2007 10:00:00 gmt' // > 'wed, 10 jan 2007 11:00:00 gmt' let fmt = new intl.
datetimeformat("en", { hour: 'numeric', minute: 'numeric' }); console.log(fmt.formatrange(
date1,
date2)); // > '10:00 – 11:00 am' fmt.formatrangetoparts(
date1,
date2); // return value: // [ // { type: 'hour', value: '10', source: "startrange" }, // { type: 'literal', value: ':', source: "startrange" }, // { type: 'minute', value: '00', source: "startrange" }, // { type: 'literal', value: ' – ', source: "shared" }, // { type: 'hour', value: '11', source: "endrange" }, // { type: 'literal', value: ':', source: "endrange" }, // { typ...
...e: 'minute', value: '00', source: "endrange" }, // { type: 'literal', value: ' ', source: "shared" }, // { type: 'dayperiod', value: 'am', source: "shared" } // ] specifications specification intl.
datetimeformat.formatrangethe definition of 'formatrangetoparts()' in that specification.
Intl.DateTimeFormat.prototype.resolvedOptions() - JavaScript
the intl.
datetimeformat.prototype.resolvedoptions() method returns a new object with properties reflecting the locale and
date and time formatting options computed during initialization of this
datetimeformat object.
... syntax
datetimeformat.resolvedoptions() return value a new object with properties reflecting the locale and
date and time formatting options computed during the initialization of the given
datetimeformat object.
... weekday era year month day hour minute second timezonename the values resulting from format matching between the corresponding properties in the options argument and the available combinations and representations for
date-time formatting in the selected locale.
... examples using the resolvedoptions method var germanfakeregion = new intl.
datetimeformat('de-xx', { timezone: 'utc' }); var usedoptions = germanfakeregion.resolvedoptions(); usedoptions.locale; // "de" usedoptions.calendar; // "gregory" usedoptions.numberingsystem; // "latn" usedoptions.timezone; // "utc" usedoptions.month; // "numeric" specifications specification ecmascript internationalization api (ecma-402)the definition of 'intl.
datetimeformat.prototype.resolvedoptions' in that specification.
commandupdater - Archive of obsolete content
« xul reference home commandup
dater type: boolean if true, the commandset is used for updating commands.
... typically, this is used to up
date menu commands such as undo and cut based on when an event occurs.
... for example, since the cut command is only valid when something is selected, a command up
dater might be used when the select event occurs.
datepicker.type - Archive of obsolete content
« xul reference home type type: one of the values below you can set the type attribute to one of the values below to specify the type of
datepicker to use normal a
datepicker with three fields for entering the year, month and
date.
... grid a
datepicker that displays a calendar grid where one month is shown at a time.
... popup a
datepicker with three entry fields but an additional dropdown button, which, when pressed, will display a popup calendar grid.
Date and Time
this chapter describes the
date and time functions in nspr.
... pr_msec_per_sec pr_usec_per_sec pr_nsec_per_sec pr_usec_per_msec pr_nsec_per_msec types and constants types and constants defined for nspr
dates and times are: prtime prtimeparameters prexplodedtime time parameter callback functions in some geographic locations, use of daylight saving time (dst) and the rule for determining the
dates on which dst starts and ends have changed a few times.
...two often-used callback functions of this type are provided by nspr: prtimeparamfn pr_localtimeparameters and pr_gmtparameters functions the functions that create and manipulate time and
date values are: pr_now pr_explodetime pr_implodetime pr_normalizetime ...
JS_updateMallocCounter
syntax void js_up
datemalloccounter(jscontext *cx, size_t nbytes); name type description cx jscontext * pointer to a js context to decrement the malloc counter.
... description js_up
datemalloccounter decrements malloc counter of gc and the zone of the context.
... see also mxr id search for js_up
datemalloccounter changeset 88cfae411a2a js_newruntime js_getgcparameter bug 517665 ...
AnimationEffect.updateTiming() - Web APIs
the up
datetiming() method of the animationeffect interface up
dates the specified timing properties for an animation effect.
... syntax animation.up
datetiming(timing); parameters timing an optionaleffecttiming object containing the timing properties to up
date.
... specifications specification status comment web animationsthe definition of 'animationeffect.up
datetiming()' in that specification.
Element: compositionupdate event - Web APIs
the compositionup
date event is fired when a new character is received in the context of a text composition session controlled by a text composition system such as an input method editor.
... bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.queryselector('input[type="text"]'); inputelement.addeventlistener('compositionup
date', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents" rows="8" cols="25"></texta...
...t log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.addeventlistener('compositionup
date', handleevent); inputelement.addeventlistener('compositionend', handleevent); result specifications specification status ui events working draft ...
HTMLObjectElement.willValidate - Web APIs
the willvali
date read-only property of the htmlobjectelement interface returns a boolean that indicates whether the element is a candi
date for constraint validation.
... syntax var boolean = htmlobjectelement.willvali
date; value a boolean.
... specifications specification status comment html living standardthe definition of 'willvali
date' in that specification.
MSCandidateWindowHide - Web APIs
mscandi
datewindowhide fires after the input method editor (ime) candi
date window closes and is fully hidden.
... syntax event property object.oncandi
datewindowhide = handler; addeventlistener method object.addeventlistener("mscandi
datewindowhide", handler, usecapture) nbsp; parameters pevtobj [in] type: ihtmleventobj pointer to an ihtmleventobj interface for the current event.
... the handler of this event will see that the iscandi
datewindowvisible method returns false, and no clientrect object is returned from getcandi
datewindowclientrect.
update() - Web APIs
the mediakeysession.up
date() method loads messages and licenses to the cdm, and then returns a promise .
... syntax mediakeysession.up
date(response).then(function() { ...
... specifications specification status comment encrypted media extensionsthe definition of 'up
date()' in that specification.
RTCIceCandidateInit.usernameFragment - Web APIs
the optional property usernamefragment in the rtcicecandi
dateinit dictionary specifies the value of the rtcicecandi
date object's usernamefragment property.
... specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcicecandi
dateinit.usernamefragment' in that specification.
... candi
date recommendation initial specification.
ServiceWorkerRegistration.onupdatefound - Web APIs
the onup
datefound property of the serviceworkerregistration interface is an eventlistener property called whenever an event of type statechange is fired; it is fired any time the serviceworkerregistration.installing property acquires a new service worker.
... syntax serviceworkerregistration.onup
datefound = function() { ...
... }; specifications specification status comment service workersthe definition of 'serviceworkerregistration.onup
datefound' in that specification.
ServiceWorkerRegistration.update() - Web APIs
the up
date() method of the serviceworkerregistration interface attempts to up
date the service worker.
... syntax serviceworkerregistration.up
date(); parameters none.
... example the following simple example registers a service worker example then adds an event handler to a button so you can explicitly up
date the service worker whenever desired: if ('serviceworker' in navigator) { navigator.serviceworker.register('/sw-test/sw.js', {scope: 'sw-test'}).then(function(registration) { // registration worked console.log('registration succeeded.'); button.onclick = function() { registration.up
date(); } }).catch(function(error) { // registration failed console.log('registration failed with ' + error); }); }; specifications specification status comment service workersthe definition of 'serviceworkerregistration.up
date()' in th...
Window.updateCommands() - Web APIs
summary up
dates the state of commands of the current chrome window (ui).
... syntax window.up
datecommands("scommandname") parameters scommandname is a particular string which describes what kind of up
date event this is (e.g.
... desktopmobilechromeedgefirefoxinternet exploreroperasafariandroid webviewchrome for androidfirefox for androidopera for androidsafari on iossamsung internetup
datecommands non-standardchrome no support noedge no support nofirefox full support yesie ?
<input type="datetime"> - HTML: Hypertext Markup Language
the html <input type="
datetime"> was a control for entering a
date and time (hour, minute, second, and fraction of a second) as well as a timezone.
... instead, browsers are implementing (and developers are encouraged to use) <input type="
datetime-local">.
... the format of the
date and time value used by this input type is described in format of a valid global
date and time string in
date and time formats used in html.
Date.prototype.getMilliseconds() - JavaScript
the getmilliseconds() method returns the milliseconds in the specified
date according to local time.
... syntax
dateobj.getmilliseconds() return value a number, between 0 and 999, representing the milliseconds for the given
date according to local time.
... examples using getmilliseconds() the following example assigns the milliseconds portion of the current time to the variable milliseconds: var today = new
date(); var milliseconds = today.getmilliseconds(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getmilliseconds' in that specification.
Date.prototype.getUTCFullYear() - JavaScript
the getutcfullyear() method returns the year in the specified
date according to universal time.
... syntax
dateobj.getutcfullyear() return value a number representing the year in the given
date according to universal time.
... var today = new
date(); var year = today.getutcfullyear(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutcfullyear' in that specification.
Date.prototype.getUTCHours() - JavaScript
the getutchours() method returns the hours in the specified
date according to universal time.
... syntax
dateobj.getutchours() return value an integer number, between 0 and 23, representing the hours in the given
date according to universal time.
... var today = new
date(); var hours = today.getutchours(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutchours' in that specification.
Date.prototype.getUTCMinutes() - JavaScript
the getutcminutes() method returns the minutes in the specified
date according to universal time.
... syntax
dateobj.getutcminutes() return value an integer number, between 0 and 59, representing the minutes in the given
date according to universal time.
... var today = new
date(); var minutes = today.getutcminutes(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutcminutes' in that specification.
Date.prototype.getUTCSeconds() - JavaScript
the getutcseconds() method returns the seconds in the specified
date according to universal time.
... syntax
dateobj.getutcseconds() return value an integer number, between 0 and 59, representing the seconds in the given
date according to universal time.
... var today = new
date(); var seconds = today.getutcseconds(); specifications specification ecmascript (ecma-262)the definition of '
date.prototype.getutcseconds' in that specification.
noupdate - Archive of obsolete content
the noup
date event is fired after checking for an application cache up
date, if the manifest hasn't changed.
... related events checking noup
date downloading progress cached up
dateready obsolete error ...
updateready - Archive of obsolete content
the up
dateready event is fired when the resources listed in the application cache manifest have been newly redownloaded, and the script can use swapcache() to switch to the new cache.
... related events checking noup
date downloading progress cached up
dateready obsolete error ...
date - Archive of obsolete content
« xul reference
date type: integer the currently selected
date of the month from 1 to 31.
... set this property to change the selected
date.
nsIAccelerometerUpdate
xpcom/system/nsiaccelerometer.idlnot scriptable replaced by nsidevicemotionup
date 1.0 66 introduced gecko 2.0 obsolete gecko 6.0 inherits from: nsiaccelerometer last changed in gecko 5.0 (firefox 5.0 / thunderbird 5.0 / seamonkey 2.2) this method is only used in content tabs to receive nsiacceleration data from the chrome process.
Index - Web APIs
33 addresserrors.dependentlocality api, addresserrors, error, locality, payment request, payment request api, property, read-only, reference, dependentlocality, payment an object based on addresserrors includes a dependentlocality property when the address's dependentlocality property couldn't be vali
dated.
... 34 addresserrors.languagecode api, address, addresserrors, deprecated, language, languagecode, locale, payment request, payment request api, property, reference, payment an object based on addresserrors includes a languagecode property when the address's languagecode property couldn't be vali
dated.
... 35 addresserrors.organization api, address, addresserrors, error, payment request, payment request api, property, read-only, reference, organization, payment an object based on addresserrors includes an organization property when the address's organization property couldn't be vali
dated.
...And 237 more matches
Index - Archive of obsolete content
55 request needsup
date, sdk, add-on make simple network requests.
... 64 url add-on sdk construct, vali
date, and parse urls.
... 189 html to dom code snippets, dom, guide, html, intermediate, needsup
date although you can now natively parse html using domparser and xmlhttprequest, this is a new feature that is not yet supported by all browsers in use in the wild.
...And 101 more matches
Signaling and video calling - Web APIs
to allow the server to support signaling and ice negotiation, we need to up
date the code.
...the next task is to up
date the main websocket message handler to support doing so.
... exchanging ice candi
dates two peers need to exchange ice candi
dates to negotiate the actual connection between them.
...And 47 more matches
Index
91 working with multiple versions of interfaces add-ons, extensions, xpcom in this short note we illustrate how one can up
date an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.
... 99 avoiding leaks in javascript xpcom components add-ons, developing mozilla, extensions, mozilla, needsup
date, obsolete, xpcom, xpcom:language bindings, xpconnect programmers writing and reviewing javascript code in mozilla should understand how code using xpcom in javascript can leak so that they can avoid leaks.
... 109 setting up the gecko sdk needsup
date, tutorial, xpcom this chapter provides basic setup information for the gecko software development kit (sdk) used to build the weblock component in this tutorial.
...And 38 more matches
Linear-gradient Generator - CSS: Cascading Style Sheets
this.isvalidrgbvalue(blue) === false) return; this.r = red | 0; this.g = green | 0; this.b = blue | 0; if (this.isvalidrgbvalue(alpha) === true) this.a = alpha | 0; }; color.prototype.setbyname = function setbyname(name, value) { if (name === 'r' || name === 'g' || name === 'b') { if(this.isvalidrgbvalue(value) === false) return; this[name] = value; this.up
datehsx(); } }; color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.hsvtorgb(); }; color.prototype.sethsl = function sethsl(hue, saturation, lightness) { this.hue = hue; this.saturation = saturation; this.lightness = lightness; this.hsltorgb(); }; color.prototype.sethue = function sethue(va...
...lue) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 359) return; this.hue = value; this.up
datergb(); }; color.prototype.setsaturation = function setsaturation(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.saturation = value; this.up
datergb(); }; color.prototype.setvalue = function setvalue(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.value = value; this.hsvtorgb(); }; color.prototype.setlightness = function setlightness(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.lightness = value; this.hsltorgb(); }; color.prototype.
... this.alpha = 1; this.rgbtohsv(); }; /*========== conversion methods ==========*/ color.prototype.converttohsl = function converttohsl() { if (this.format === 'hsl') return; this.setformat('hsl'); this.rgbtohsl(); }; color.prototype.converttohsv = function converttohsv() { if (this.format === 'hsv') return; this.setformat('hsv'); this.rgbtohsv(); }; /*========== up
date methods ==========*/ color.prototype.up
datergb = function up
datergb() { if (this.format === 'hsv') { this.hsvtorgb(); return; } if (this.format === 'hsl') { this.hsltorgb(); return; } }; color.prototype.up
datehsx = function up
datehsx() { if (this.format === 'hsv') { this.rgbtohsv(); return; } if (this.format === 'hsl') { this.rgbtohsl(); return; } }...
...And 38 more matches
Anatomy of a video game - Game development
these games present two images to the user; they accept their click (or touch); they interpret the input as a success, failure, pause, menu interaction, etc.; finally, they calculate an up
dated scene resulting from that input.
...this is more of a turn-based approach that doesn't demand a constant up
date every frame, only when the player reacts.
...the
date object is no longer the recognised method for timing events because it is very imprecise and can be modified by the system clock.
...And 36 more matches
RTCPeerConnection - Web APIs
nchor="middle" alignment-baseline="middle">rtcpeerconnection</text></a></svg></div> a:hover text { fill: #0095dd; pointer-events: all;} constructorrtcpeerconnection() the rtcpeerconnection() constructor returns a newly-created rtcpeerconnection, which represents a connection between the local device and a remote peer.propertiesalso inherits properties from: eventtargetcantrickleicecandi
datesthe read-only rtcpeerconnection property cantrickleicecandi
dates returns a boolean which indicates whether or not the remote peer can accept trickled ice candi
dates.connectionstate the read-only connectionstate property of the rtcpeerconnection interface indicates the current state of the peer connection by returning one of the string values specified by the enum rtcpeerconnectionstate.currentlo...
...also included is a list of any ice candi
dates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.currentremotedescription read only the read-only property rtcpeerconnection.currentremotedescription returns an rtcsessiondescription object describing the remote end of the connection as it was most recently successfully negotiated since the last time the rtcpeerconnection finished negotiating and connec...
...also included is a list of any ice candi
dates that may already have been generated by the ice agent since the offer or answer represented by the description was first instantiated.getdefaulticeservers() the getdefaulticeservers() method of the rtcpeerconnection interface returns an array of objects based on the rtciceserver dictionary, which indicates what, if any, ice servers the browser will use by default if none are provided to the rtcpeerconnection in its rtcconfiguration.
...And 36 more matches
Color picker tool - CSS: Cascading Style Sheets
this.isvalidrgbvalue(blue) === false) return; this.r = red | 0; this.g = green | 0; this.b = blue | 0; if (this.isvalidrgbvalue(alpha) === true) this.a = alpha | 0; }; color.prototype.setbyname = function setbyname(name, value) { if (name === 'r' || name === 'g' || name === 'b') { if(this.isvalidrgbvalue(value) === false) return; this[name] = value; this.up
datehsx(); } }; color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.hsvtorgb(); }; color.prototype.sethsl = function sethsl(hue, saturation, lightness) { this.hue = hue; this.saturation = saturation; this.lightness = lightness; this.hsltorgb(); }; color.prototype.sethue = function sethue(va...
...lue) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 359) return; this.hue = value; this.up
datergb(); }; color.prototype.setsaturation = function setsaturation(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.saturation = value; this.up
datergb(); }; color.prototype.setvalue = function setvalue(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.value = value; this.hsvtorgb(); }; color.prototype.setlightness = function setlightness(value) { if (typeof(value) !== 'number' || isnan(value) === true || value < 0 || value > 100) return; this.lightness = value; this.hsltorgb(); }; color.prototype.
... this.alpha = 1; this.rgbtohsv(); }; /*========== conversion methods ==========*/ color.prototype.converttohsl = function converttohsl() { if (this.format === 'hsl') return; this.setformat('hsl'); this.rgbtohsl(); }; color.prototype.converttohsv = function converttohsv() { if (this.format === 'hsv') return; this.setformat('hsv'); this.rgbtohsv(); }; /*========== up
date methods ==========*/ color.prototype.up
datergb = function up
datergb() { if (this.format === 'hsv') { this.hsvtorgb(); return; } if (this.format === 'hsl') { this.hsltorgb(); return; } }; color.prototype.up
datehsx = function up
datehsx() { if (this.format === 'hsv') { this.rgbtohsv(); return; } if (this.format === 'hsl') { this.rgbtohsl(); return; } }...
...And 32 more matches
Index
there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candi
date issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...as a result, when searching for a trust path from (a) to a trusted anchor (root) certificate (z), the set of candi
date issuer certificates might have different issuer names (referring to the second or higher issuer level).
...create a context handle while providing all the parameters required for the operation, then call an “up
date” function multiple times to pass subsets of the input to nss.
...And 30 more matches
Componentizing our Svelte app - Learn web development
we'll componentize our app, then add more functionality to allow users to up
date existing components.
...you'll notice that when you click on the filter buttons, they are selected and the style up
dates appropriately.
... we will just declare the onclick prop assigning a dummy handler to prevent errors, like this: export let onclick = (clicked) => {} and we'll declare the following reactive statement — $: onclick(filter) — to call the onclick handler whenever the filter variable is up
dated.
...And 29 more matches
<input>: The Input (Form Input) element - HTML: Hypertext Markup Language
<input type="color" name="color"/> html5
date a control for entering a
date (year, month, and day, with no time).
... opens a
date picker or numeric wheels for year, month, day when active in supporting browsers.
... <input type="
date" name="
date"/> html5
datetime-local a control for entering a
date and time, with no time zone.
...And 29 more matches
Advanced Svelte: Reactivity, lifecycle, accessibility - Learn web development
up
date your existing checkalltodos() function to the following: const checkalltodos = (completed) => { todos.foreach(t => t.completed = completed) console.log('todos', todos) } go back to your browser, open your devtools console, and click check all/uncheck all a few times.
... you'll notice that the array is successfully up
dated every time you press the button (the todo objects' completed properties are toggled between true and false), but svelte is not aware of that.
... many web frameworks use the virtual dom technique to up
date the page.
...And 26 more matches
Working with Svelte stores - Learn web development
remember that we can access top-level variables from the markup, and whenever they are modified the dom will up
date accordingly.
...in the callback function we just assign the value we receive to the local variable, which will trigger the up
date of the component's dom.
...there we assign a new value to a local variable, and thanks to svelte reactivity all our markup and reactive dependencies are up
dated accordingly.
...And 25 more matches
Dynamic behavior in Svelte: working with variables and props - Learn web development
observe how the numbers in the message are up
dated appropriately.
...this would allow us to save them to a web service or local storage and later retrieve them for up
date.
...up
date src/app.svelte as follows: <script> import todos from './components/todos.svelte' let todos = [ { id: 1, name: 'create a svelte starter app', completed: true }, { id: 2, name: 'create your first component', completed: true }, { id: 3, name: 'complete the rest of the tutorial', completed: false } ] </script> <todos todos={todos} /> when the attribute and the variable...
...And 25 more matches
TypeScript support in Svelte - Learn web development
just take into account that the svelte community is constantly improving svelte typescript support, so you should run npm up
date regularly to take advantage of the latest changes.
...you'll also have to up
date any corresponding import statements (don't include the .ts in your import statements; typescript chose to omit the extensions).
...for example, if you start adding an ms property to the alert component call, typescript will infer from the default value that the ms property should be a number: and if you pass something that is not a number it will complain about it: the application template has a vali
date script configured that runs svelte-check against your code.
...And 24 more matches
Application cache implementation overview
when the url in the manifest attribute of the html tag is identical to the manifest url the channel's nsiapplicationcache object belongs to and, the channel's loadedfromapplicationcache flag is set, the document is associated with that nsiapplicationcache object and an up
date attempt for the manifest is scheduled after the document completely loads.
...updating an existing cache or first download of an offline cache the process of updating or first caching is invoked asynchronously from nscontentsink::processofflinemanifest() using nsofflinecacheup
dateservice.
... the implementation of offline cache up
date is in /uriloader/prefetch.
...And 23 more matches
Background Tasks API - Web APIs
this code draws any pending up
dates to the document currently being displayed, runs any javascript code the page needs to run, accepts events from input devices, and dispatches those events to the elements that should receive them.
... in addition, the event loop handles interactions with the operating system, up
dates to the browser's own user interface, and so forth.
... because event handling and screen up
dates are two of the most obvious ways users notice performance issues, it's important for your code to be a good citizen of the web and help to prevent stalls in the execution of the event loop.
...And 23 more matches
WebRTC connectivity - Web APIs
after setlocaldescription(), the caller asks stun servers to generate the ice candi
dates the caller uses the signaling server to transmit the offer to the intended receiver of the call.
... the pendinglocaldescription contains not just the offer or answer under consideration, but any local ice candi
dates which have already been gathered since the offer or answer was created.
... similarly, pendingremotedescription includes any remote ice candi
dates which have been provided by calls to rtcpeerconnection.addicecandi
date().
...And 23 more matches
Setting up your own test automation environment - Learn web development
objective: to show how to set up a selenium testing environment locally and run tests with it, and how to integrate it with tools like lamb
datest, sauce labs, and browserstack.
...we are going to choose selenium's official selenium-webdriver, as the documentation seems fairly up-to-
date and it is well-maintained.
...you should make sure that everything is up-to-
date.
...And 22 more matches
Box-shadow generator - CSS: Cascading Style Sheets
true : false; this.topic = topic; this.node = node; var pointer = document.createelement('div'); pointer.classname = 'ui-slider-pointer'; node.appendchild(pointer); this.pointer = pointer; setmousetracking(node, up
dateslider.bind(this)); sliders[topic] = this; setvalue(topic, this.value); } var setbuttoncomponent = function setbuttoncomponent(node) { var type = node.getattribute('data-type'); var topic = node.getattribute('data-topic'); if (type === "sub") { node.textcontent = '-'; node.addeventlistener("click", function() { decrement(topic); }); } if (type === "add") { node.te...
...slider.step; setvalue(slider.topic, slider.value) notify.call(slider); } }; var decrement = function decrement(topic) { var slider = sliders[topic]; if (slider === null || slider === undefined) return; if (slider.value - slider.step >= slider.min) { slider.value -= slider.step; setvalue(topic, slider.value) notify.call(slider); } } // this = slider object var up
dateslider = function up
dateslider(e) { var node = this.node; var pos = e.pagex - node.offsetleft; var width = node.clientwidth; var delta = this.max - this.min; var offset = this.pointer.clientwidth + 4; // border width * 2 if (pos < 0) pos = 0; if (pos > width) pos = width; var value = pos * delta / width | 0; var precision = value % this.step; value = value - precision + this.
...g = green | 0; if (blue != undefined) this.b = blue | 0; if (alpha != undefined) this.a = alpha | 0; } /** * hsv/hsb (hue, saturation, value / brightness) * @param hue 0-360 * @param saturation 0-100 * @param value 0-100 */ color.prototype.sethsv = function sethsv(hue, saturation, value) { this.hue = hue; this.saturation = saturation; this.value = value; this.up
datergb(); } color.prototype.up
datergb = function up
datergb() { var sat = this.saturation / 100; var value = this.value / 100; var c = sat * value; var h = this.hue / 60; var x = c * (1 - math.abs(h % 2 - 1)); var m = value - c; var precision = 255; c = (c + m) * precision; x = (x + m) * precision; m = m * precision; if (h >= 0 && h < 1) { this.setrgba(c, x, m); return; } ...
...And 22 more matches
Install Manifests - Archive of obsolete content
it contains metadata identifying the add-on, providing information about who created it, where more information can be found about it, which versions of what applications it is compatible with, how it should be up
dated, and so on.
... note: extensions compatible with firefox 3.5 should specify a maxversion of 3.5.*, so that they are automatically compatible with security and stability up
dates.
... for firefox/thunderbird 1.0, the format must conform to the rules specified in extension versioning, up
date and compatibility.
...And 21 more matches
WAI-ARIA basics - Learn web development
previous overview: accessibility next following on from the previous article, sometimes making complex ui controls that involve unsemantic html and dynamic javascript-up
dated content can be difficult.
... as another example, apps started to feature complex controls like
date pickers for choosing
dates, sliders for choosing values, etc.
... html5 provides special input types to render such controls: <input type="
date"> <input type="range"> these are not well-supported across browsers, and it is also difficult to style them, making them not very useful for integrating with website designs.
...And 21 more matches
Package management basics - Learn web development
previous overview: understanding client-side tools next in this article we'll look at package managers in some detail to understand how we can use them in our own projects — to install project tool dependencies, keep them up-to-
date, and more.
... a simple example of a useful dependency that your project might need is some code to calculate relative
dates as human-readable text.
... a project dependency can be an entire javascript library or framework — such as react or vue — or a very small utility like our human-readable
date library, or it can be a command line tool such as prettier or eslint, which we talked about in previous articles.
...And 21 more matches
Index - Archive of obsolete content
67 commandup
dater xul attributes, xul reference no summary!
... 85
datepicker.type xul attributes, xul reference no summary!
... 86
datepicker.value xul attributes, xul reference no summary!
...And 20 more matches
React interactivity: Events and state - Learn web development
your <form /> component call should be up
dated as follows: <form addtask={addtask} /> finally, you can use this prop inside the handlesubmit() function in your <form /> component!
... up
date it as follows: function handlesubmit(e) { e.preventdefault(); props.addtask("say hello!"); } clicking on the "add" button in your browser will prove that the addtask() callback function works, but it'd be nice if we could get the alert to show us what we're typing in our input field!
...now that we're dealing with user input and data up
dates, however, we need something more.
...And 20 more matches
nsINavBookmarksService
to use this service, use: var navbookmarksservice = components.classes["@mozilla.org/browser/nav-bookmarks-service;1"] .getservice(components.interfaces.nsinavbookmarksservice); method overview void addobserver(in nsinavbookmarkobserver observer, in boolean ownsweak); void beginup
datebatch(); obsolete since gecko 1.9 void changebookmarkuri(in long long aitemid, in nsiuri anewuri); long long createdynamiccontainer(in long long aparentfolder, in autf8string aname, in astring acontractid, in long aindex); note: renamed from createcontainer in gecko 1.9 obsolete since gecko 13.0 long long createfolder(in long long aparentfolder, in autf8string name, in l...
...ong index); void endup
datebatch(); obsolete since gecko 1.9 void exportbookmarkshtml(in nsifile file); obsolete since gecko 1.9 nsiuri getbookmarkedurifor(in nsiuri auri); void getbookmarkfolderstarray(in nsiuri auri, in print64array aresult); native code only!
...er); obsolete since gecko 2.0 long long getfolderidforitem(in long long aitemid); boolean getfolderreadonly(in long long aitemid); astring getfoldertitle(in print64 folder); obsolete since gecko 1.9 nsiuri getfolderuri(in print64 folder); obsolete since gecko 1.9 long long getidforitemat(in long long aparentid, in long aindex); prtime getitem
dateadded(in long long aitemid); astring getitemguid(in long long aitemid); obsolete since gecko 14.0 long long getitemidforguid(in astring aguid); obsolete since gecko 14.0 long getitemindex(in long long aitemid); prtime getitemlastmodified(in long long aitemid); autf8string getitemtitle(in long long aitemid); unsigned short getitemtype(in lo...
...And 20 more matches
Python binding for NSS
release information release 1.0.1 release
date 2017-02-28 scm tag pynss_release_1_0_1 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_1/src/ change log add tls 1.3 cipher suites ssl_cipher_info.py now attempts to enable tls 1.3 fix build issue in setup.py.
...`pip wheel -w dist .` the following constants were added: ssl.tls_aes_128_gcm_sha256 ssl.tls_aes_256_gcm_sha384 ssl.tls_chacha20_poly1305_sha256 release 1.0.0 release
date 2016-09-01 scm tag pynss_release_1_0_0 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_0/src/ change log official 1.0.0 release, only minor tweaks from the 1.0.0beta1 release.
... the following constants were added: ssl.tls_ecdhe_rsa_with_chacha20_poly1305_sha256 ssl.tls_ecdhe_ecdsa_with_chacha20_poly1305_sha256 ssl.tls_dhe_rsa_with_chacha20_poly1305_sha256 ssl.tls_ecdhe_psk_with_chacha20_poly1305_sha256 ssl.tls_dhe_psk_with_chacha20_poly1305_sha256 release 1.0.0beta1 release
date 2016-02-16 scm tag pynss_release_1_0_0beta1 source download https://ftp.mozilla.org/pub/mozilla.org/security/python-nss/releases/pynss_release_1_0_0beta1/src/ change log the primary enhancement in this version is support for python3.
...And 19 more matches
Drawing and Event Handling - Plugins
npn_invali
daterect: invali
date an area in a windowless plug-in before repainting or refreshing.
... npn_invali
dateregion: invali
date a region in a windowless plug-in before repainting or refreshing.
...the browser sets up the port for the plug-in before passing the plug-in an up
date event in two ways: the browser calls setorigin(npport->portx, npport->porty).
...And 18 more matches
AddressErrors - Web APIs
addresserrors is the type of the object returned by shippingaddresserrors in the paymentdetailsup
date passed into paymentrequestup
dateevent.up
datewith() by the shippingaddresschange event handler if a change to the address resulted in a validation error occurring.
... properties addressline a domstring which, if present, indicates that the addressline property of the paymentaddress could not be vali
dated.
... city a domstring which, if present, indicates that the city property of the paymentaddress could not be vali
dated.
...And 18 more matches
Introduction to SSL - Archive of obsolete content
the client and the server use the session keys to encrypt and decrypt the data they send to each other and to vali
date its integrity.
...the public key in the client's certificate can correctly vali
date the digital signature only if the corresponding private key was used.
... otherwise, the server cannot vali
date the digital signature and the session is terminated.
...And 17 more matches
IME handling guide
ecompositionup
date this is dispatched by textcomposition when an ecompoitionchange will change the composition string.
... this represents a dom compositionup
date event.
... mranges representing dom event ecompositionstart selected string before starting composition textcomposition nullptr compositionstart ecompositionup
date new composition string textcomposition nullptr compositionup
date ecompositionend commit string textcomposition nullptr compositionend ecompositionchange new composition string widget (or textcomposition) must not be nullptr text ecompositioncommitasis n/a (must be empty) nobody nullptr none ecompositioncommit c...
...And 17 more matches
<input type="month"> - HTML: Hypertext Markup Language
clicking the down arrow on the right hand side brings up a
date picker that lets you select the month and year.
...the format of the month string used by this input type is described in format of a valid local month string in
date and time formats used in html.
... you can set a default value for the input control by including a month and year inside the value attribute, like so: <label for="bday-month">what month were you born in?</label> <input id="bday-month" type="month" name="bday-month" value="2017-06"> one thing to note is that the displayed
date format differs from the actual value; most user agents display the month and year in a locale-appropriate form, based on the set locale of the user's operating system, whereas the
date value is always formatted yyyy-mm.
...And 17 more matches
CSS3 - Archive of obsolete content
css fonts module level 3 candi
date recommendation since september 20th, 2018 amends the css2.1 font matching algorithm to be closer to what is really implemented.
... stable modules a few css modules are already fairly stable and have reached one of the three recommendation level of the csswg: candi
date recommendation, proposed recommendation or recommendation.
... these can be used without prefix and are pretty stable, though a few features can still be dropped at the candi
date recommendation stage.
...And 16 more matches
XForms Input Element - Archive of obsolete content
(xhtml/xul)
datepicker - used to represent data of type xsd:
date (xhtml/xul) calendar - used to represent data of type xsd:
date when appearance attribute also has the value 'full' (xhtml/xul) month list - used to represent data of type xsd:gmonth (xhtml only) days list - used to represent data of type xsd:gday (xhtml only) number field - used to represent data of numeric type (fx 3.0 only, xul only) more detail ...
...analogous widgets are <xhtml:input type="text"/> and <xul:textbox/> specific handling of attributes incremental - if "true", the bound instance node will be up
dated on each character typed by the user.
... if "false", or the incremental attribute is omitted on this element then the bound instance node will be up
dated when the control loses the focus.
...And 16 more matches
RTCConfiguration - Web APIs
properties bundlepolicy optional specifies how to handle negotiation of candi
dates when the remote peer is not compatible with the sdp bundle standard.
... icecandi
datepoolsize optional an unsigned 16-bit integer value which specifies the size of the prefetched ice candi
date pool.
... the default value is 0 (meaning no candi
date prefetching will occur).
...And 16 more matches
Using DTMF with WebRTC - Web APIs
each time a tone is sent, the rtcpeerconnection receives a tonechange event with a tone property specifying which tone finished playing, which is an opportunity to up
date interface elements, for example.
... function connectanddial() { callerpc = new rtcpeerconnection(); hasaddtrack = (callerpc.addtrack !== undefined); callerpc.onicecandi
date = handlecallericeevent; callerpc.onnegotiationneeded = handlecallernegotiationneeded; callerpc.oniceconnectionstatechange = handlecallericeconnectionstatechange; callerpc.onsignalingstatechange = handlecallersignalingstatechangeevent; callerpc.onicegatheringstatechange = handlecallergatheringstatechangeevent; receiverpc = new rtcpeerconnection(); receiverpc.onicecandi
date = handlerec...
... then a second rtcpeerconnection, this one representing the receiving end of the call, is created and stored in receiverpc; its onicecandi
date event handler is set up too.
...And 16 more matches
Updating Commands - Archive of obsolete content
« previousnext » in this section, we will look at how to up
date commands.
...the only other thing you need to do is ensure that the enabled status of the paste command, and therefore the button, is up
dated at the right time, which is described below.
... command up
daters a command up
dater is a feature of the commandset element which allows it to up
date commands when certain events happen.
...And 15 more matches
Theme changes in Firefox 2 - Archive of obsolete content
this article covers the changes that need to be made to up
date a firefox theme to work properly in firefox 2.
... browser changes requiring theme up
dates there are a number of changed and deleted files in the browser that may require you to make changes to your theme.
... the table lists both the changed xul file and the theme's corresponding css file that you might need to up
date.
...And 15 more matches
Advanced text formatting - Learn web development
{ margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); const code = textarea.value; const userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); const htmlsolution = '<dl>\n <dt>bacon</dt>\n <dd>the glue that binds the world together.</dd>\n <dt>eggs</dt>\n <dd>the glue that binds the cake together.</dd>\n <dt>coffee</dt>\n <dd>the drink that gets the world running in the morning.</dd>\n <dd>a light brown color.</dd>\n</dl>'; const solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function inse...
...nst caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // up
date the saved usercode every time the user up
dates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } up
datecode(); }; quotatio...
...And 15 more matches
NSS functions
up
dated - function has new arguments such as new flag or addition to structure.
... ssl_getclientauthdatahook mxr 3.2 and later ssl_getmaxservercachelocks mxr 3.4 and later ssl_getsessionid mxr 3.2 and later ssl_getstatistics mxr 3.2 and later ssl_handshakecallback mxr 3.2 and later ssl_importfd mxr 3.2 and later ssl_inheritmpserversidcache mxr 3.2 and later ssl_invali
datesession mxr 3.2 and later ssl_localcertificate mxr 3.4 and later ssl_optionget mxr 3.2 and later ssl_optiongetdefault mxr 3.2 and later ssl_optionset mxr 3.2 and later ssl_optionsetdefault mxr 3.2 and later ssl_peercertificate mxr 3.2 and later ssl_preencryptedfiletostream mxr 3.2 and lat...
...up
dated 3.8 with new options.
...And 15 more matches
Checking when a deadline is due - Web APIs
in this article we look at a complex example involving checking the current time and
date against a deadline stored via indexeddb.
... the main complication here is checking the stored deadline info (month, hour, day, etc.) against the current time and
date taken from a
date object.
... the main example application we will be referring to in this article is to-do list notifications, a simple to-do list application that stores task titles and deadline times and
dates via indexeddb, and then provides users with notifications when deadline
dates are reached, via the notification, and vibration apis.
...And 15 more matches
Establishing a connection: The WebRTC perfect negotiation pattern - Web APIs
because webrtc doesn't man
date a specific transport mechanism for signaling during the negotiation of a new peer connection, it's highly flexible.
... handling incoming ice candi
dates next, we need to handle the rtcpeerconnection event icecandi
date, which is how the local ice layer passes candi
dates to us for delivery to the remote peer over the signaling channel.
... pc.onicecandi
date = ({candi
date}) => signaler.send({candi
date}); this simply takes the candi
date member of this ice event and passes it through to the signaling channel's send() method to be sent over the signaling server to the remote peer.
...And 15 more matches
ARIA live regions - Accessibility
using javascript, it is possible to dynamically change parts of a page without requiring the entire page to reload — for instance, to up
date a list of search results on the fly, or to display a discreet alert or notification which does not require user interaction.
... simple live regions dynamic content which up
dates without a page reload is generally either a region or a widget.
... aria-live: the aria-live=politeness_setting is used to set the priority with which screen reader should treat up
dates to live regions - the possible settings are: off, polite or assertive.
...And 15 more matches
JXON - Archive of obsolete content
|*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ function parsetext (svalue) { if (/^\s*$/.test(svalue)) { return null; } if (/^(?:true|false)$/i.test(svalue)) { return svalue.tolowercase() === "true"; } if (isfinite(svalue)) { return parsefloat(svalue); } if (isfinite(
date.parse(svalue))) { return new
date(svalue); } return svalue; } function jxontree (oxmlparent) { var nattrlen = 0, nlength = 0, scollectedtxt = ""; if (oxmlparent.haschildnodes()) { for (var onode, sprop, vcontent, nitem = 0; nitem < oxmlparent.childnodes.length; nitem++) { onode = oxmlparent.childnodes.item(nitem); if ((onode.nodetype - 1 | 1) === 3) { scollectedtxt += onode...
... }], "purchased": { "keyvalue": null }, "keyvalue": null, "keyattributes": { "description": "large" } }], "keyvalue": null, "keyattributes": { "gender": "men's" } }, { "item_number": { "keyvalue": "rrx9856" }, "discount_until": { "keyvalue": new
date(1995, 11, 25) }, "price": { "keyvalue": 42.5 }, "size": { "color_swatch": { "keyvalue": "black", "keyattributes": { "image": "black_cardigan.jpg" } }, "keyvalue": null, "keyattributes": { "description": "medium" } }, "keyvalue": null, "key...
...|*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ function parsetext (svalue) { if (/^\s*$/.test(svalue)) { return null; } if (/^(?:true|false)$/i.test(svalue)) { return svalue.tolowercase() === "true"; } if (isfinite(svalue)) { return parsefloat(svalue); } if (isfinite(
date.parse(svalue))) { return new
date(svalue); } return svalue; } function jxontree (oxmlparent) { if (oxmlparent.haschildnodes()) { var scollectedtxt = ""; for (var onode, sprop, vcontent, nitem = 0; nitem < oxmlparent.childnodes.length; nitem++) { onode = oxmlparent.childnodes.item(nitem); if ((onode.nodetype - 1 | 1) === 3) { scollectedtxt += onode.nodetype === 3 ?
...And 14 more matches
HTML text fundamentals - Learn web development
.a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); var htmlsolution = '<h1>my short story</h1>\n<p>i am a statistician and my name is trish.</p>\n<p>my legs are made of cardboard and i am married to a fish.</p>'; var solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.va...
...lue).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // up
date the saved usercode every time the user up
dates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } up
datecode(); }; why do we need semantics?
...And 14 more matches
AddonManager
autoup
datedefault boolean whether add-ons should auto-up
date by default (overrideable per add-on).
... corresponds to the extensions.autoup
datedefault preference.
... state_checking an install that is checking for up
dated information.
...And 14 more matches
Border-image generator - CSS: Cascading Style Sheets
ect'; while (node.firstelementchild !== null) { option = node.firstelementchild; option_value = option.getattribute('data-value'); if (option_value === null) option.setattribute('data-value', uval); list.appendchild(node.firstelementchild); uval++; } node.appendchild(select); node.appendchild(list); select.onclick = this.toggle.bind(this); list.onclick = this.up
datevalue.bind(this); document.addeventlistener('click', clickout); this.state = 0; this.time = 0; this.dropmenu = list; this.select = select; this.toggle(false); this.value = {}; this.topic = topic; if (label) select.textcontent = label; else this.setnodevalue(list.children[selected]); dropdowns[topic] = this; }; dropdown.prototype.toggle = function toggle(state) { ...
... if (active) active.toggle(false); active = this; } if (this.state === 0) this.dropmenu.setattribute('data-hidden', 'true'); else this.dropmenu.removeattribute('data-hidden'); }; var clickout = function clickout(e) { if (active.state === 0 || e.target === active.dropmenu || e.target === active.select) return; active.toggle(false); }; dropdown.prototype.up
datevalue = function up
datevalue(e) { if (
date.now() - this.time < 500) return; if (e.target.classname !== "ui-dropdown-list") { this.setnodevalue(e.target); this.toggle(false); } this.time =
date.now(); }; dropdown.prototype.setnodevalue = function setnodevalue(node) { this.value['name'] = node.textcontent; this.value['value'] = node.getattribute('data-value'); this.sele...
...nager.setvalue('slice-fill', prop['fill']); dropdownmanager.setvalue('image-repeat-x', prop['repeat'][0]); dropdownmanager.setvalue('image-repeat-y', prop['repeat'][1]); inputslidermanager.setvalue('preview-width', prop['size'][0]); inputslidermanager.setvalue('preview-height', prop['size'][1]); inputslidermanager.setvalue('preview-area-height', prop['preview_area']); }; var up
date = function up
date() { scale = math.min(300, (30000 / this.width) | 0); setscale(scale); inputslidermanager.setvalue('scale', scale, false); subject.style.backgroundimage = 'url("' + this.src + '")'; preview.style.borderimagesource = 'url("' + this.src + '")'; guidelines['slice-top'].setmax(this.height); guidelines['slice-right'].setmax(this.width); guidelines['slice-bot...
...And 14 more matches
HTTP caching - HTTP
cache-control: no-store cache but revali
date a cache will send the request to the origin server for validation before releasing a cached copy.
... cache-control: max-age=31536000 validation when using the "must-revali
date" directive, the cache must verify the status of the stale resources before using it and expired ones should not be used.
... cache-control: must-revali
date the pragma header pragma is a http/1.0 header, it is not specified for http responses and is therefore not a reliable replacement for the general http/1.1 cache-control header, although it does behave the same as cache-control: no-cache, if the cache-control header field is omitted in a request.
...And 14 more matches
CustomizableUI.jsm
if consumers make a change to the placements in an area, customizableui will up
date the actual nodes in each area instance for them.
...this is often when the window has opened, but in the case of add-ons, could fire when the node has just been registered with customizableui after an add-on up
date or disable/enable sequence.
...ode(atoolbar, aexistingchildren); void registermenupanel(apanel); void unregisterarea(aareaid, adestroyplacements); void addwidgettoarea(awidgetid, aareaid, [optional] aposition); void removewidgetfromarea(awidgetid); void movewidgetwithinarea(awidgetid, aposition); void ensurewidgetplacedinwindow(awidgetid, awindow); void beginbatchup
date(); void endbatchup
date(aforcedirty); widgetgroupwrapper createwidget(awidgetspecification); void destroywidget(awidgetid); widgetgroupwrapper getwidget(awidgetid); array getunusedwidgets(awindow); array getwidgetidsinarea(aareaid); array getwidgetsinarea(aareaid); string getareatype(aareaid); domelement getcustomizet...
...And 13 more matches
OS.File for the main thread
promise<uint8array> read(in string path, [optional] in object options); promise<void> remove(in string path, [optional] in object options); promise<void> removeemptydir(in string path, [optional] in object options); promise<void> removedir(in string path, [optional] in object options); promise<void> setcurrentdirectory(in string path); promise<void> set
dates(in string path, in
date|number access
date, in
date|number modification
date); promise<void> setpermissions(in string path, in object options ); promise<file.info> stat(in string path, [optional] in object options); promise<void> unixsymlink(in string targetpath, in string createpath); promise<void> writeatomic(in string path, in arrayview data, in object optio...
... file.close(); this example is from stackoverflow: os.file check last modified
date before os.read os.file.openunique() creates and opens a file with a unique name.
... os.file.set
dates() set the last access and modification
date of the file.
...And 13 more matches
RTCIceTransportState - Web APIs
the transport state indicates which stage of the candi
date gathering process is currently underway.
... values "new" the rtcicetransport is currently gathering local candi
dates, or is waiting for the remote device to begin to transmit the remote candi
dates, or both.
... in this state, checking of candi
dates to look for those which might be acceptable has not yet begun.
...And 13 more matches
Event reference
compositionup
date a character is added to a passage of text being composed.
... durationchange the duration attribute has been up
dated.
... timeup
date the time indicated by the currenttime attribute has been up
dated.
...And 13 more matches
Using the application cache - HTML: Hypertext Markup Language
the browser then checks to see if the cache manifest has been up
dated on the server.
... if the cache manifest has been up
dated, the browser downloads a new version of the manifest and the resources listed in the manifest.
... if the currently-cached copy of the manifest is up-to-
date, the browser sends a noup
date event to the applicationcache object, and the up
date process is complete.
...And 13 more matches
Microsummary XML grammar reference - Archive of obsolete content
<up
date> (optional) specifies how frequently firefox should up
date the microsummaries.
...the <up
date> element the optional <up
date> element specifies how frequently firefox should up
date microsummaries generated by the generator.
... the element can be used to specify both an absolute up
date interval and a series of conditional intervals based on the content of the page being summarized.
...And 12 more matches
Client-side form validation - Learn web development
using built-in form validation one of the most significant features of html5 form controls is the ability to vali
date most user data without relying on javascript.
...up
date your html to add a pattern attribute like this: <form> <label for="choose">would you prefer a banana or a cherry?</label> <input id="choose" name="i_like" required pattern="[bb]anana|[cc]herry"> <button>submit</button> </form> input:invalid { border: 2px dashed red; } input:valid { border: 2px solid black; } this gives us the following up
date — try it out: note: you can fin...
... note: some <input> element types don't need a pattern attribute to be vali
dated against a regular expression.
...And 12 more matches
Making decisions in your code — conditionals - Learn web development
for example, we could up
date our weather forecast application to show a further set of choices depending on what the temperature is: if (choice === 'sunny') { if (temperature < 86) { para.textcontent = 'it is ' + temperature + ' degrees outside — nice and sunny.
... <label for="theme">select theme: </label> <select id="theme"> <option value="white">white</option> <option value="black">black</option> </select> <h1>this is my website</h1> const select = document.queryselector('select'); const html = document.queryselector('html'); document.body.style.padding = '10px'; function up
date(bgcolor, textcolor) { html.style.backgroundcolor = bgcolor; html.style.color = textcolor; } select.onchange = function() { ( select.value === 'black' ) ?
... up
date('black','white') : up
date('white','black'); } here we've got a <select> element to choose a theme (black or white), plus a simple <h1> to display a website title.
...And 12 more matches
Introduction to automated testing - Learn web development
in this article, we look at what is available, how to use task runners, and how to use the basics of commercial browser test automation apps such as lamb
datest, sauce labs, browserstack, and testingbot.
...commercial cross-browser testing apps like lamb
datest, sauce labs, browserstack, and testingbot are based on selenium, but allow you to access their set up remotely using a simple interface, saving you the hassle of setting up your own testing system.
...it is possible to set up a task runner to access a service like sauce labs, or lamb
datest via an api, run cross browser tests, and return results.
...And 12 more matches
Creating localizable web applications
cheatsheet don't hardcode english text, formats (numbers,
dates, addresses, etc.), word order or sentence structure.
... text messages don't hardcode english content allow localizers to localize english content, such as: text messages, number formats,
date formats, word order and sentence structure.
... localize the
date format localizing the
date format is as easy as localizing any other string.
...And 12 more matches
<tr>: The Table Row element - HTML: Hypertext Markup Language
<table> <tr> <th>name</th> <th>id</th> <th>member since</th> <th>balance</th> </tr> <tr> <td>margaret nguyen</td> <td>427311</td> <td><time
datetime="2010-06-03">june 3, 2010</time></td> <td>0.00</td> </tr> <tr> <td>edvard galinski</td> <td>533175</td> <td><time
datetime="2011-01-13">january 13, 2011</time></td> <td>37.00</td> </tr> <tr> <td>hoshi nakamura</td> <td>601942</td> <td><time
datetime="2012-07-23">july 23, 2012</time></td> <td>15.00</td> </tr> </table> css this simple css just add...
... table { border: 1px solid black; } th, td { border: 1px solid black; } result row and column spanning now, let's introduce another column that shows the
date the user's membership ended, along with a super-heading above the "joined" and "canceled"
dates called "membership
dates".
... result let's actually look at the output first this time: notice how the heading area here is actually two rows, one with "name", "id", "membership
dates", and "balance" headings, and the other with "joined" and "canceled", which are sub-headings below "membership
dates".
...And 12 more matches
Inner-browsing extending the browser navigation paradigm - Archive of obsolete content
the first one looks like a traditional dhtml ticker application and uses hidden iframes and javascript to provide up
dates inside the webpage's ticker headlines section.
...in this model, when a request goes to the web server, the current page is up
dated rather than replaced.
...good candi
dates for inner-browsing include a spell check application, in which the text entered in a web page is checked as it is typed; a webmail application that uses the inner-browsing model to display the separate messages and message lists in an integrated way, much like a client mail app; and a stock ticker that spools the information across the web page.
...And 11 more matches
Using XPInstall to Install Plugins - Archive of obsolete content
for those familiar with netscape communicator 4.x's smartup
date technology, this will be a familiar idea.
... a brief history of netscape installer technologies this section is relevant if you are familiar with netscape communicator 4.x's smartup
date installer technology.
...netscape communicator 4.x uses the notion of smartup
date to install software, particularly plugins and java applets to be run locally.
...And 11 more matches
calICalendarView - Archive of obsolete content
for instance, when the show
date method of the the calendar-multiday-view (an implementation of this interface) will sometimes show an entire week of
dates, and sometimes show only the single
date passed in.
... interface code [scriptable, uuid(3e567ccb-2ecf-4f59-b7ca-bf42b0fbf24a)] interface calicalendarview : nsisupports { attribute calicalendar displaycalender; attribute calicalendarviewcontroller controller; void show
date(in cali
datetime a
date); void set
daterange(in cali
datetime astart
date, in cali
datetime aend
date); readonly attribute cali
datetime start
date; readonly attribute cali
datetime end
date; readonly attribute boolean supportsdisjoint
dates; readonly attribute boolean hasdisjoint
dates; void set
datelist(in unsigned long acount, [array,size_is(acount)] in cali
datetime a
dates); void get
datelist...
...(out unsigned long acount, [array,size_is(acount),retval] out cali
datetime a
dates); attribute caliitembase selecteditem; attribute cali
datetime selectedday; attributes displaycalendar the displaycalendar is an implementation of the calicalendar interface.
...And 11 more matches
The HTML5 input types - Learn web development
by default, the number input type only vali
dates if the number is an integer.
... to actually display the current value, and up
date it as it changed, you must use javascript, but this is relatively easy to do: const price = document.queryselector('#price'); const output = document.queryselector('.price-output'); output.textcontent = price.value; price.addeventlistener('input', function() { output.textcontent = price.value; }); here we store references to the range input and the output in two variables.
...finally, an event listener is set to ensure that whenever the range slider is moved, the output's textcontent is up
dated to the new value.
...And 11 more matches
Fetching data from the server - Learn web development
previous overview: client-side web apis next another very common task in modern websites and applications is retrieving individual data items from the server to up
date sections of a webpage without having to load an entire new page.
... prerequisites: javascript basics (see first steps, building blocks, javascript objects), the basics of client-side apis objective: to learn how to fetch data from the server and use it to up
date the contents of a web page.
... the trouble with this model is that whenever you want to up
date any part of the page, for example, to display a new set of products or load a new page, you've got to load the entire page again.
...And 11 more matches
Mozilla Development Strategies
warning: the content of this article may be out of
date.
... it has not been up
dated for usage of mercurial (instead of cvs).
... make sure documentation gets up
dated if the bug you're fixing is likely to require an up
date to developer documentation once it's fixed, be sure to add the dev-doc-needed keyword to the bug (or ask someone to do it, if you don't have editbugs privileges on bugzilla).
...And 11 more matches
Enc Dec MAC Using Key Wrap CertReq PKCS10 CSR
0s - certificate signing request \n\n", "-r <csr>"); fprintf(stderr, "%-30s - generate a self-signed cert [optional]\n\n", "-x"); fprintf(stderr, "%-30s - to enable ascii [optional]\n\n", "-a"); fprintf(stderr, "%-30s - to save certificate to header file as sig verification [optional]\n\n", "-v"); exit(-1); } /* * vali
date the options used for generate csr command */ static void vali
dategeneratecsrcommand(const char *progname, const char *dbdir, certname *subject, const char *subjectstr, const char *certreqfilename) { prbool validationfailed = pr_false; if (!subject) { pr_fprintf...
...reqfilename) { pr_fprintf(pr_stderr, "%s -g -d %s -s %s -r: certificate request file name not found\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, "-g -d <dbdirpath> -s <subject> -r <csr> \n"); exit(-1); } } /* * vali
date the options used for add cert to db command */ static void vali
dateaddcerttodbcommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *truststr, const char *certfilename, const char *certreqfilename, ...
...intf(stderr, "\nusage: %s %s \n\n", progname, " -a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> \n"); fprintf(stderr, " or\n"); fprintf(stderr, "\nusage: %s %s \n\n", progname, "-a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> -r <csr> -u <issuernickname> -m <serialnumber> [-x <\"\">] \n"); exit(-1); } } /* * vali
date the options used for save cert to header command */ static void vali
datesavecerttoheadercommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *headerfilename) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -s...
...And 11 more matches
sample2
- certificate issuer nickname\n\n", "-u <issuernickname>"); fprintf(stderr, "%-30s - certificate signing request \n\n", "-r <csr>"); fprintf(stderr, "%-30s - generate a self-signed cert [optional]\n\n", "-x"); fprintf(stderr, "%-30s - to enable ascii [optional]\n\n", "-a"); fprintf(stderr, "%-30s - to save certificate to header file as sig verification [optional]\n\n", "-v"); exit(-1); } /* * vali
date the options used for generate csr command */ static void vali
dategeneratecsrcommand(const char *progname, const char *dbdir, certname *subject, const char *subjectstr, const char *certreqfilename) { prbool validationfailed = pr_false; if (!subject) { pr_fprintf(pr_stderr, "%s -g -d %s -s: improperly formatted name: \"%s\"\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (!certre...
...qfilename) { pr_fprintf(pr_stderr, "%s -g -d %s -s %s -r: certificate request file name not found\n", progname, dbdir, subjectstr); validationfailed = pr_true; } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, "-g -d <dbdirpath> -s <subject> -r <csr> \n"); exit(-1); } } /* * vali
date the options used for add cert to db command */ static void vali
dateaddcerttodbcommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *truststr, const char *certfilename, const char *certreqfilename, const char *issuernamestr, const char *serialnumberstr, prbool selfsign) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -a -d %s -n : nick name is missing\n", progname, dbdir); validationfailed = pr_true; } if (!truststr) { pr_f...
... issuernamestr); validationfailed = pr_true; } } if (validationfailed) { fprintf(stderr, "\nusage: %s %s \n\n", progname, " -a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> \n"); fprintf(stderr, " or\n"); fprintf(stderr, "\nusage: %s %s \n\n", progname, "-a -d <dbdirpath> -n <nickname> -t <trust> -c <cert> -r <csr> -u <issuernickname> -m <serialnumber> [-x <\"\">] \n"); exit(-1); } } /* * vali
date the options used for save cert to header command */ static void vali
datesavecerttoheadercommand(const char *progname, const char *dbdir, const char *nicknamestr, const char *headerfilename) { prbool validationfailed = pr_false; if (!nicknamestr) { pr_fprintf(pr_stderr, "%s -s -d %s -n : nick name is missing\n", progname, dbdir); validationfailed = pr_true; } if (!headerfilename) { pr_fprintf(pr_s...
...And 11 more matches
nsIDOMWindowUtils
olean dispatchdomeventviapresshell(in nsidomnode atarget, in nsidomevent aevent, in boolean atrusted); nsidomelement elementfrompoint(in float ax, in float ay, in boolean aignorerootscrollframe, in boolean aflushlayout); void entermodalstate(); nsidomelement findelementwithviewid(in nsviewid aid); void focus(in nsidomelement aelement); void forceup
datenativemenuat(in astring indexstring); void garbagecollect([optional] in nsicyclecollectorlistener alistener); short getcursortype(); astring getdocumentmetadata(in astring aname); nsidomwindow getouterwindowwithid(in unsigned long long aouterwindowid); long getpccountscriptcount(); astring getpccountscriptsummary(in long ascript); ...
..., in astring apropertyname); boolean isinmodalstate(); void leavemodalstate(); void loadsheet(in nsiuri sheeturi, in unsigned long type); nsidomnodelist nodesfromrect(in float ax, in float ay, in float atopsize, in float arightsize, in float abottomsize, in float aleftsize, in boolean aignorerootscrollframe, in boolean aflushlayout); void processup
dates(); obsolete since gecko 13.0 void purgepccounts(); unsigned long redraw([optional] in unsigned long acount); void renderdocument(in nsconstrect arect, in pruint32 aflags, in nscolor abackgroundcolor, in gfxcontext athebescontext); native code only!
... forceup
datenativemenuat() see nsiwidget.forceup
datenativemenuat().
...And 11 more matches
JavaScript Daemons Management - Archive of obsolete content
verse, bforce); }; daemon.prototype.reclose = function (bforce) { /* warning: this method requires the daemon.prototype.makesteps() and daemon.prototype.close() methods */ return this.close(this.isatend() !== this.backw, bforce || false); }; /* others */ daemon.prototype.restart = function () { this.stop(); this.start(); }; daemon.prototype.loopuntil = function (v
date) { if (!isfinite(this.length)) { return; } var ntime = v
date.constructor ===
date ?
... v
date.gettime() : isnan(v
date) ?
...
date.parse(v
date) : v
date; if (isfinite(ntime) && ntime >
date.now()) { this.reversals = math.floor((ntime -
date.now() - (this.backw ?
...And 10 more matches
Introduction to Public-Key Cryptography - Archive of obsolete content
nonrepudiation prevents the sender of information from claiming at a later
date that the information was never sent.
...certificate authorities (cas) are entities that vali
date identities and issue certificates.
...the methods used to vali
date an identity vary depending on the policies of a given ca-just as the methods to vali
date other forms of identification vary depending on who is issuing the id and the purpose for which it will be used.
...And 10 more matches
Getting started with HTML - Learn web development
see your changes up
date live in the output area.
...a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); var htmlsolution = '<em>this is my text.</em>'; var solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length)...
...And 10 more matches
Useful string methods - Learn web development
to actually up
date the value of the browsertype variable in a real program, you'd have to set the variable value to be the result of the operation; it doesn't just up
date the substring value automatically.
...sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function up
datecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
... textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');' + '\nlist.innerhtml = \'\';' + '\nlet greetings = [\'happy birthday!\',' + '\n \'merry christmas my love\',' + '\n \'a happy christmas to all the family\',' + '\n \'you\\\'re all i want for christmas\',' + '\n \'get well soon\'];' + '\n' + '\nfor (let i = 0; i < greetings.length; i++) {' + '\n let input = greetings[i];' + '\n if (greetings[i].indexof(\'christmas\') !== -1) {' + '\n let result = input;' + '\n let listitem = document.createelement(\'li\');' + '\n listitem.textcontent = result;' + '\n list.appendchild(listitem);' + '\n }' + '\n}'; let s...
...And 10 more matches
nsINavBookmarkObserver
1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 21.0 (firefox 21.0 / thunderbird 21.0 / seamonkey 2.18) method overview void onbeforeitemremoved(in long long aitemid, in unsigned short aitemtype, in long long aparentid, in acstring aguid, in acstring aparentguid); obsolete since gecko 21.0 void onbeginup
datebatch(); void onendup
datebatch(); void onfolderadded(in print64 folder, in print64 parent, in print32 index); obsolete since gecko 1.9 void onfolderchanged(in print64 folder, in acstring property); obsolete since gecko 1.9 void onfoldermoved(in print64 folder, in print64 oldparent, in print32 oldindex, in print64 newparent, in print32 newindex); obsolete since g...
...ecko 1.9 void onfolderremoved(in print64 folder, in print64 parent, in print32 index); obsolete since gecko 1.9 void onitemadded(in long long aitemid, in long long aparentid, in long aindex, in unsigned short aitemtype, in nsiuri auri, in autf8string atitle, in prtime a
dateadded, in acstring aguid, in acstring aparentguid); void onitemchanged(in long long aitemid, in acstring aproperty, in boolean aisannotationproperty, in autf8string anewvalue, in prtime alastmodified, in unsigned short aitemtype, in long long aparentid, in acstring aguid, in acstring aparentguid); void onitemmoved(in long long aitemid, in long long aoldparentid, in long aoldindex, in long long anewparentid, in long anewindex, in unsigned short aitemtype, in acstring aguid, in acstring aold...
... onbeginup
datebatch() this method notifies this observer that a batch transaction has started.
...And 10 more matches
nsINavHistoryResultObserver
toolkit/components/places/nsinavhistoryservice.idlscriptable lets clients observe changes to a result as the result up
dates itself according to bookmark and history system events.
...ntainerclosed(in nsinavhistorycontainerresultnode acontainernode); deprecated since gecko 2.0 obsolete since gecko 11.0 void containeropened(in nsinavhistorycontainerresultnode acontainernode); deprecated since gecko 2.0 obsolete since gecko 11.0 void containerstatechanged(in nsinavhistorycontainerresultnode acontainernode, in unsigned long aoldstate, in unsigned long anewstate); void invali
datecontainer(in nsinavhistorycontainerresultnode acontainernode); void nodeannotationchanged(in nsinavhistoryresultnode anode, in autf8string aannoname); void node
dateaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodehistorydetailschanged(in nsinavhistoryresultnode anode, in prtime anewvisit
date, in unsigned long anewaccesscount); void nodeiconchanged(in nsinavhist...
...the observer can then pause up
dates or events until the batch is completed, so that it won't handle the large number of up
dates that are about to be notified.
...And 10 more matches
Timing element visibility with the Intersection Observer API - Web APIs
function handlevisibilitychange() { if (document.hidden) { if (!previouslyvisibleads) { previouslyvisibleads = visibleads; visibleads = []; previouslyvisibleads.foreach(function(adbox) { up
dateadtimer(adbox); adbox.dataset.lastviewstarted = 0; }); } } else { previouslyvisibleads.foreach(function(adbox) { adbox.dataset.lastviewstarted = performance.now(); }); visibleads = previouslyvisibleads; previouslyvisibleads = null; } } since the event itself doesn't state whether the document has switched from visible to invisible or vice-versa, the doc...
...then, for each of the ads that are being suspended, we call our up
dateadtimer() function, which handles updating the ad's total visible time counter, then we set their dataset.lastviewstarted property to 0, which indicates that the tab's timer isn't running.
...now the ads are all restarted, and configured to know that they became visible at the current time, so that they will not add up the duration of time the page was tabbed away the next time they're up
dated.
...And 10 more matches
RTCIceTransport - Web APIs
role read only returns a domstring whose value is one of the members of the rtcicerole enumerated type: "controlling" or "controlled"; this indicates whether the ice agent is the one that makes the final decision as to the candi
date pair to use or not.
...the value of state can be used to determine whether the ice agent has made an initial connection using a viable candi
date pair ("connected"), made its final selection of candi
date pairs ("completed"), or in an error state ("failed"), among other states.
... getlocalcandi
dates() returns an array of rtcicecandi
date objects, each describing one of the ice candi
dates that have been gathered so far for the local device.
...And 10 more matches
Request.cache - Web APIs
otherwise the resource will be downloaded from the server and the cache will be up
dated.
... if there is no match, the browser will make a normal request, and will up
date the cache with the downloaded resource.
... no-store — the browser fetches the resource from the remote server without first looking in the cache, and will not up
date the cache with the downloaded resource.
...And 10 more matches
Using CSS transitions - CSS: Cascading Style Sheets
-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration: 0.5s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...ebkit-transition-property: width height background-color font-size left top -webkit-transform transform color; -webkit-transition-duration: 1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 1s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...ebkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 2s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height...
...And 10 more matches
HTTP conditional requests - HTTP
such requests can be useful to vali
date the content of a cache, and sparing a useless control, to verify the integrity of a document, like when resuming a download, or when preventing to lose up
dates when uploading or modifying a document on the server.
...such values are called validators, and are of two kinds: the
date of last modification of the document, the last-modified
date.
...this is even if they are minor differences; like different ads, or a footer with a different
date.
...And 10 more matches
HTTP Index - HTTP
rudp — the reliable up
date of udp — is a suitable alternative.
... 7 evolution of http guide, http, needsup
date, needsup
date(http/3) http (hypertext transfer protocol) is the underlying protocol of the world wide web.
...such requests can be useful to vali
date the content of a cache, and sparing a useless control, to verify the integrity of a document, like when resuming a download, or when preventing to lose up
dates when uploading or modifying a document on the server.
...And 10 more matches
jpm - Archive of obsolete content
supporting up
dates for self-hosted add-ons this feature is only supported from jpm 1.0.3 onwards.
... when you make up
dates to your add-on to add features or fix bugs, you'll want any previously installed versions of the add-on to up
date themselves to the new version.
...the way this works is: you run jpm sign anytime you need to create a new version you host the signed add-on xpi and up
date it when you need to you host an "up
date manifest", which, among other things, contains a url pointing to the xpi your add-on tells firefox where it can find the up
date manifest to do this, include two extra keys in package.json: up
dateurl: this url is included in the install manifest of the xpi file that jpm xpi builds.
...And 9 more matches
Adding a new todo form: Vue events, methods, and models - Learn web development
however, we can't up
date our list of items without manually changing our code!
...up
date your template as follows: <template> <form> <label for="new-todo-input"> what needs to be done?
...go back to app.vue and add the following import statement just below the previous one, inside your <script> element: import todoform from './components/todoform'; you also need to register the new component in your app component — up
date the components property of the component object so that it looks like this: components: { todoitem, todoform } finally for this section, render your todoform component inside your app by adding the <to-do-form /> element inside your app's <template>, like so: <template> <div id="app"> <h1>my to-do list</h1> <to-do-form></to-do-form> <ul> <li v-for="item in todo...
...And 9 more matches
nsIDOMOfflineResourceList
last changed in gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) inherits from: nsisupports method overview void mozadd(in domstring uri); boolean mozhasitem(in domstring uri); domstring mozitem(in unsigned long index); void mozremove(in domstring uri); void swapcache(); void up
date(); attributes attribute type description mozitems nsidomofflineresourcelist the list of dynamically-managed entries in the offline resource list.
... onchecking nsidomeventlistener an event listener to be called when fetching the application cache manifest and checking for up
dates.
... onnoup
date nsidomeventlistener an event listener to be called when there is no up
date to download.
...And 9 more matches
nsINavHistoryResultViewer
method overview void containerclosed(in nsinavhistorycontainerresultnode acontainernode); void containeropened(in nsinavhistorycontainerresultnode acontainernode); void invali
datecontainer(in nsinavhistorycontainerresultnode acontainernode); void nodeannotationchanged(in nsinavhistoryresultnode anode, in autf8string aannoname); void node
dateaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodelastaddedchanged(in nsinavhistoryresultnode anode, in prtime anewvalue); void nodehistorydetailschanged(in nsinavhistor...
...yresultnode anode, in prtime anewvisit
date, in unsigned long anewaccesscount); void nodeiconchanged(in nsinavhistoryresultnode anode); void nodekeywordchanged(in nsinavhistoryresultnode anode, in autf8string anewkeyword); void nodemoved(in nsinavhistoryresultnode anode, in nsinavhistorycontainerresultnode aoldparent, in unsigned long aoldindex, in nsinavhistorycontainerresultnode anewparent, in unsigned long anewindex); void nodetitlechanged(in nsinavhistoryresultnode anode, in autf8string anewtitle); void noderemoved(in nsinavhistorycontainerresultnode aparent, in nsinavhistoryresultnode anode, in unsigned long aoldindex); void nodetagschanged(in nsinavhistoryresultnode anode); void nodeurichanged(in nsinavhistoryresultnode a...
... invali
datecontainer() called when something has happened that requires that the contents of a container be rebuilt.
...And 9 more matches
Web Console remoting - Firefox Developer Tools
actor preferences to allow the web console to configure logging options while it is running, we have added the setpreferences packet: { "to": "conn0.console9", "type": "setpreferences", "preferences": { "networkmonitor.saverequestandresponsebodies": false } } reply: { "up
dated": [ "networkmonitor.saverequestandresponsebodies" ], "from": "conn0.console10" } for convenience you can use webconsoleclient.setpreferences(prefs, onresponse).
... ], }, } the response packet is a network event actor grip: { "to": "conn0.console9", "eventactor": { "actor": "conn0.netevent14", "started
datetime": "2013-08-26t19:50:03.699z", "url": "http://localhost", "method": "get" "isxhr": true, "private": false } } you can also use the webconsoleclient.sendhttprequest(request, onresponse) method.
... the variable view needs to up
date objects and it does so by binding _self to the debugger.object of the objectactor that is being viewed.
...And 9 more matches
HTMLInputElement - Web APIs
formnovali
date boolean: returns / sets the element's formnovali
date attribute, indicating that the form is not to be vali
dated when it is submitted.
... this overrides the novali
date attribute of the parent form.
...this is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
...And 9 more matches
Key Values - Web APIs
common ime keys keyboardevent.key value description virtual keycode windows mac linux android "allcandi
dates" the all candi
dates key, which starts multi-candi
date mode, in which multiple candi
dates are displayed for the ongoing input.
... gdk_key_multiplecandi
date (0xff3d qt::key_multiplecandi
date (0x0100113d) "alphanumeric" the alphanumeric key.
... if you wish to identify which specific dead key was pressed (in cases where more than one exists), you can do so by examining the keyboardevent's associated compositionup
date event's data property.
...And 9 more matches
PaymentRequest.show() - Web APIs
if this is provided, show() will not allow the user to interact with the payment interface until the promise is fulfilled, so that data can be up
dated prior to the user engaging with the payment process.
...most examples on mdn and elsewhere use async/await to wait asynchronously while results are vali
dated and so forth.
... syntax paymentpromise = paymentrequest.show(detailspromise); parameters detailspromise optional an optional promise that you can provide if your architecture requires that the payment request's details need to be up
dated between instantiating the payment interface and the user beginning to interact with it.
...And 9 more matches
RTCIceTransport.state - Web APIs
its value will be one of the following: "new" the rtcicetransport is currently gathering local candi
dates, or is waiting for the remote device to begin to transmit the remote candi
dates, or both.
... in this state, checking of candi
dates to look for those which might be acceptable has not yet begun.
... "checking" at least one remote candi
date has been received, and the rtcicetransport has begun examining pairings of remote and local candi
dates in order to attempt to identify viable pairs that could be used to establish a connection.
...And 9 more matches
widget - Archive of obsolete content
widgets.widget({ id: "mouseover-effect", label: "widget with changing image on mouseover", contenturl: "http://www.yahoo.com/favicon.ico", onmouseover: function() { this.contenturl = "http://www.bing.com/favicon.ico"; }, onmouseout: function() { this.contenturl = "http://www.yahoo.com/favicon.ico"; } }); // a widget that up
dates content on a timer.
... widgets.widget({ id: "auto-up
date-widget", label: "widget that up
dates content on a timer", content: "0", contentscript: 'settimeout(function() {' + ' document.body.innerhtml++;' + '}, 2000)', contentscriptwhen: "ready" }); // a widget created with a specified width, that grows.
...setting it up
dates the widget's appearance immediately.
...And 8 more matches
places/bookmarks - Archive of obsolete content
usage this module exports: three constructors: bookmark, group, and separator, corresponding to the types of objects, referred to as bookmark items, in the bookmarks database in firefox two additional functions, save() to create, up
date, and remove bookmark items, and search() to retrieve the bookmark items that match a particular set of criteria.
...k, save } = require("sdk/places/bookmarks"); // create a new bookmark instance, unsaved let bookmark = bookmark({ title: "mozilla", url: "http://mozilla.org" }); // attempt to save the bookmark instance to the bookmarks database // and store the emitter let emitter = save(bookmark); // listen for events emitter.on("data", function (saved, inputitem) { // on a "data" event, an item has been up
dated, passing in the // latest snapshot from the server as `saved` (with properties // such as `up
dated` and `id`), as well as the initial input // item as `inputitem` console.log(saved.title === inputitem.title); // true console.log(saved !== inputitem); // true console.log(inputitem === bookmark); // true }).on("end", function (saveditems, inputitems) { // similar to "data" events, ex...
... save(bookmarks).on("data", function (saved, input) { // a data event is called once for each item saved, as well // as implicit items, like `group` console.log(input === group || ~bookmarks.indexof(input)); // true }).on("end", function (saves, inputs) { // like the previous example, the "end" event returns an // array of all of our up
dated saves.
...And 8 more matches
MCD, Mission Control Desktop, AKA AutoConfig - Archive of obsolete content
also related post in newsgroups: mozilla.dev.tech.js-engine
date: wed, 17 may 2006 19:06:28 +0200 from: jehan procaccia <jehan.procaccia@int-evry.fr> newsgroups: mozilla.dev.tech.js-engine subject: scope of js file functions in frefox/thunderbird autoconfig context firefox 2.x recently (2007/03/20), i've tested autoconfig support in firefox 2.0.0.2 on a linux fedora.
...that "bug" report is then still up to
date!: bug 295329 $ cat /etc/redhat-release fedora core release 6 (zod) $ rpm -qi firefox name : firefox relocations: (not relocatable) version : 2.0.0.2 vendor: remi collet release : 1.fc6.remi build
date: sat 24 feb 2007 01:45:37 pm cet install
date: tue 20 mar 2007 02:47:27 pm cet build host: remi.famillecollet.com packager : http://remi.collet.free.fr/ references other documents about autoconfig http://mit.edu/~firefox/www/maintain...utoconfig.html http://www.alain.knaff.lu/howto/mozi...ion/index.html ht...
...rial.i586 0:1.2.1-1.fc11 check merge tools in [root@b008-02 ~]# vim /etc/mercurial/hgrc.d/mergetools.rc get the source comm-central [root@b008-02 moz]# time hg clone http://hg.mozilla.org/comm-central/ commsrc requesting all changes adding changesets adding manifests adding file changes added 2975 changesets with 16793 changes to 7117 files (+3 heads) updating working directory 5644 files up
dated, 0 files merged, 0 files removed, 0 files unresolved real 0m40.771s user 0m9.284s sys 0m1.304s [root@b008-02 commsrc]# python client.py checkout executing command: ['hg', 'pull', '-r', './.', '-r', 'tip'] pulling from http://hg.mozilla.org/comm-central/ searching for changes no changes found executing command: ['hg', 'up
date', '-r', 'default', '-r', './.'] 0 files up
dated, 0 files ...
...And 8 more matches
How to Write and Land Nanojit Patches - Archive of obsolete content
[njn: it's possible that the other tm/tr public repo hasn't been up
dated from nanojit-central sufficiently recently, in which case the patch won't apply cleanly.
... if it's major you'll need to do a private up
date of that other repo in order to test.
... but don't push that up
date, as that should only be done by a member of that public repo.] once it passes testing, file the patch to bugzilla (file a bug under the "nanojit" component in the "core" product) and get a review.
...And 8 more matches
Numeric Controls - Archive of obsolete content
« previousnext » xul has two elements used for the entry of numeric values or ranges, and well as two elements for entering
dates and times.
...
date and time entry fields the
datepicker and timepicker elements may be used to allow the user to enter
dates and times.
... when used, they display a set of numeric textboxes to enter each of the components of the
date or time.
...And 8 more matches
commandset - Archive of obsolete content
in addition, this element can hold a command up
dater which is used to up
date commands when certain events occur.
... a common use of the command up
dater is to up
date cut, copy, and paste menu items.
... attributes commandup
dater, events, oncommandup
date, targets example <commandset> <command id="cmd_open" oncommand="alert('open!');"/> <command id="cmd_help" oncommand="alert('help!');"/> </commandset> attributes commandup
dater type: boolean if true, the commandset is used for updating commands.
...And 8 more matches
Handling common accessibility problems - Learn web development
complex functionality one of the main areas problematic for accessibility is complex apps that involve complicated form controls (such as
date pickers) and dynamic content that is up
dated often and incrementally.
... regularly up
dated dynamic content can be a problem because screenreader users might miss it, especially if it up
dates unexpectedly.
... if you have a single-page app with a main content panel that is regularly up
dated using xmlhttprequest or fetch, a screenreader user might miss those up
dates.
...And 8 more matches
Eclipse CDT
since it's a pain to install them and keep them up to
date we do not recommend getting eclipse this way.) increase eclipse's memory limits!
... keeping the index up-to-
date as the source changes from day-to-day, you'll want to up
date the index to keep the code assistance working well.
...in principle, you can set the index to rebuild automatically by opening the workspace preferences, selecting "c/c++ > indexer", and reenabling "automatically up
date the index".
...And 8 more matches
OS.File.Info
instances of os.file.info represent file metadata, such as the size of the file, its last modification
date, etc.
... creation
date deprecated in bugzilla :: bug 807875.
... before deprecation, this used to be the
date at which the file was created on windows and mac os x, as a javascript
date object.
...And 8 more matches
NSS Tools crlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... crl generation script syntax: crl generation script file has the following syntax: line with comments should have <bold>#</bold> as a first symbol of a line set "this up
date" or "next up
date" crl fields: up
date=yyyymmddhhmmssz nextup
date=yyyymmddhhmmssz field "next up
date" is optional.
... add certificate entries(s) to crl: addcert range
date where: range: two integer values separated by dash: range of certificates that will be added by this command.
...And 8 more matches
Index
7 gcintegration developing mozilla, firefox, garbage collection, intermediate, intro, jsapi, needsup
date, spidermonkey, tools, memory the spidermonkey garbage collector (gc) will be changing a lot in the future.
... 152 jsruntime jsapi reference, needscontent, needsup
date, spidermonkey in the jsapi, jsruntime is the top-level object that represents an instance of the javascript engine.
... 199 js_clear
datecaches
date, jsapi reference, javascript, reference, référence(2), spidermonkey js_clear
datecaches clears the cache of calculated local time from each
date object.
...And 8 more matches
Places Developer Guide
accessing bookmarks and related items accessing item properties for all items: string getitemtitle(aitemid) - returns an item's title int64 getitemindex(aitemid) - returns an item's position in it's parent folder prtime getitemtype(aitemid) - returns the type of an item (bookmark, folder, separator) prtime getitem
dateadded(aitemid) - returns the time in microseconds that an item was added prtime getitemlastmodified(aitemid) - returns the time in microseconds that an item was last modified int64 getfolderidforitem(aitemid) - returns the id of the folder containing the given item.
... setitem
dateadded(aitemid, a
dateadded) - set the
date the item was first added, in microseconds.
... setitemlastmodified(aitemid, alastmodified) - set the
date the item was last modified, in microseconds.
...And 8 more matches
nsICryptoHash
1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview acstring finish(in prbool aascii); void init(in unsigned long aalgorithm); void initwithstring(in acstring aalgorithm); void up
date([const, array, size_is(alen)] in octet adata, in unsigned long alen); void up
datefromstream(in nsiinputstream astream, in unsigned long alen); constants hash algorithms these constants are used by the init() method to indicate which hashing function to use.
... exceptions thrown ns_error_invalid_arg indicates that an unsupported algorithm type was passed up
date() adds an array of data to be hashed to the object.
... void up
date( [const, array, size_is(alen)] in octet adata, in unsigned long alen ); parameters adata a buffer to calculate the hash over.
...And 8 more matches
Border-radius generator - CSS: Cascading Style Sheets
is.unity = 0; this.unitr = 0; this.maxw = 100; this.maxh = 100; this.maxr = 100; this.topic = y + '-' + x; var sliderw = inputslidermanager.getnode(this.topic + '-w'); var sliderh = inputslidermanager.getnode(this.topic + '-h'); var sliderr = inputslidermanager.getnode(this.topic); this.setunitx(this.unitx); this.setunity(this.unity); this.setunitr(this.unitr); this.up
datewidth(); this.up
dateheight(); this.up
dateradius(); if (x === 'left') this.resizex = 1; if (x === 'right') this.resizex = -1; if (y === 'top') this.resizey = 1; if (y === 'bottom') this.resizey = -1; radius.classname = 'radius'; var unit_selector = document.getelementbyid("unit-selection"); var unitw = new unitselector(this.topic + '-w'); var unith = new unitselector(this.t...
... === 'right' && y == 'top') handle.classname = 'handle handle-top-right'; if (x === 'right' && y == 'bottom') handle.classname = 'handle handle-bottom-right'; if (x === 'left' && y == 'bottom') handle.classname = 'handle handle-bottom-left'; handle.addeventlistener("mousedown", function(e) { active = true; this.radius.style.display = 'block'; previewmousetracking.subscribe(this.up
datecontainer.bind(this)); }.bind(this)); document.addeventlistener("mouseup", function(e) { this.radius.style.display = 'none'; if (active === true) previewmousetracking.unsubscribe(this.up
datecontainer.bind(this)); }.bind(this)); inputslidermanager.subscribe(this.topic + '-w', this.setwidth.bind(this)); inputslidermanager.subscribe(this.topic + '-h', this.setheight.bind(this));...
...(this)); buttonmanager.subscribe(this.topic, function(value) { this.rounded = value; if (value === true) { unitw.container.style.display = 'none'; unith.container.style.display = 'none'; unitr.container.style.display = 'block'; sliderw.style.display = 'none'; sliderh.style.display = 'none'; sliderr.style.display = 'block'; this.setunitr(this.unitr); this.up
dateradius(); } if (value === false) { unitw.container.style.display = 'block'; unith.container.style.display = 'block'; unitr.container.style.display = 'none'; sliderw.style.display = 'block'; sliderh.style.display = 'block'; sliderr.style.display = 'none'; this.setunitx(this.unitx); this.setunity(this.unity); this.up
datewidth(); this.up
dateheight(); ...
...And 8 more matches
Microformats - HTML: Hypertext Markup Language
microformats2 is an up
date to microformats that provides a simpler way of annotating html structured syntax & vocabularies than previous approaches of using rdfa and microdata which require learning new attributes.
...for example: h-card describes a person or organization h-entry describes episodic or
date stamped online content like a blog post h-feed describes a stream or feed of posts you can find many more vocabularies on the microformats2 wiki.
... "dt-*" for
datetime properties, e.g.
...And 8 more matches
SVG documentation index - SVG: Scalable Vector Graphics
16 svg event attributes advanced, attribute, draft, landing, needsup
date, svg event attributes always have their name starting with "on" followed by the name of the event for which they are intended.
... 270 svg tutorial intermediate, needscontent, needshelp, needsup
date, svg, svg:tutorial scalable vector graphics, svg, is a w3c xml dialect to mark up graphics.
... 276 getting started beginner, needsbeginnerup
date, svg, svg:tutorial let us dive straight in with a simple example.
...And 8 more matches
ui/button/toggle - Archive of obsolete content
this can contain a number or a string, and you can up
date it at any time.
...a disabled button will not generate click or change events and its icon will appear disabled: updating state you can up
date all the button's properties, except for its id.
...to set state like this, call state() with 2 parameters: the first parameter is a window or tab object or as a shorthand, the string "window" for the currently active window, or the string "tab" for the currently active tab the second parameter is an object containing the state properties you wish to up
date.
...And 7 more matches
cfx - Archive of obsolete content
up
dateurl and up
datelink if you choose to host the xpi yourself you should enable the host application to find new versions of your add-on.
... to do this, include a url in the xpi called the up
dateurl: the host application will go here to get information about up
dates.
... at the up
dateurl you host a file in the up
date rdf format: among other things, this includes another url called up
datelink which points to the up
dated xpi itself.
...And 7 more matches
How to convert an overlay extension to restartless - Archive of obsolete content
as of may 29, 2017, that module does not work with packed extensions; i'm preserving the link in case the author up
dates the gist to fix this issue).
...doing anuncompressed internal jar (aka, another zip) acts like a poor-man's solid archive and significantly boosts the overall compression ratio of the xpi, resulting in smaller installers and up
dates.
...your restartless add-on won't actually reload some types of files if they are in a jar and the add-on is up
dated without a restart.
...And 7 more matches
Monitoring downloads - Archive of obsolete content
the download manager instance is cached into a member variable in the downloadlogger object for reuse later, and its addlistener() method is called to start listening for download status up
dates.
... if the download's state indicates that the download is finished, canceled, or failed, we call our logtransfercompleted routine to up
date the log to indicate that state change.
... that code looks like this: logtransfercompleted: function(adownload) { var endtime = new
date(); // current time is the end time // issue the replace sqlite command to up
date the record.
...And 7 more matches
Back to the Server: Server-Side JavaScript On The Rise - Archive of obsolete content
fault xml namespace = "http://purl.org/rss/1.0/"; var dc = new namespace( "http://purl.org/dc/elements/1.1/" ); var rdf = new namespace( "http://www.w3.org/1999/02/22-rdf-syntax-ns#" ); // use e4x to process the feed var x = new xml( str ); for each( var i in x..item ) { print( "title: " + i.title + "\n" ); print( "about: " + i.@rdf::about + "\n" ); print( "link: " + i.link + "\n" ); print( "
date: " + i.dc::
date + "\n" ); } the first half of this script is standard java code used to retrieve the feed data.
...notice during the processing of the item element where we use the rdf and dc namespace to access the about attribute of the item element, and the
date element respectively.
...see listing 5 for an up
date to listing 1 to reflect this.
...And 7 more matches
Desktop gamepad controls - Game development
to up
date the state of the gamepad's currently pressed buttons we will need a function that will do exactly that on every frame: function gamepadup
datehandler() { buttonspressed = []; if(controller.buttons) { for(var b=0; b<controller.buttons.length; b++) { if(controller.buttons[b].pressed) { buttonspressed.push(b); } } } } we first rese...
... next, in the draw() function we do two things — execute the gamepadup
datehandler() function to get the current state of pressed buttons on every frame, and use the gamepadbuttonpressedhandler() function to check the buttons we are interested to see whether they are pressed, and do something if they are: function draw() { ctx.clearrect(0, 0, canvas.width, canvas.height); // ...
... gamepadup
datehandler(); if(gamepadbuttonpressedhandler(0)) { playery -= 5; } else if(gamepadbuttonpressedhandler(1)) { playery += 5; } if(gamepadbuttonpressedhandler(2)) { playerx -= 5; } else if(gamepadbuttonpressedhandler(3)) { playerx += 5; } if(gamepadbuttonpressedhandler(11)) { alert('boom!'); } // ...
...And 7 more matches
Index - MDN Web Docs Glossary: Definitions of Web-related terms
52 crud glossary, infrastructure crud (create, read, up
date, delete) is an acronym for ways one can operate on stored data.
... 296 ota glossary, infrastructure, intro, ota, over the air, up
dates over the air (ota) refers to automatic updating of software on connected devices from a central server.
... all device owners receiving a given set of up
dates are on the same "channel", and each device often can access several channels (e.g.
...And 7 more matches
How to build custom form controls - Learn web development
we include our control and the <select>; which one is displayed depends on the class of the body element, with the class of the body element being up
dated by the script that makes the control function, when it loads successfully to achieve this, we need two things: first, we need to add a regular <select> element before each instance of our custom control.
... // we deactivate the control deactivateselect(select); }); // loose focus if the user hits `esc` select.addeventlistener('keyup', function (event) { // deactive on keyup of `esc` if (event.keycode === 27) { deactivateselect(select); } }); }); at that point, our control will change state according to our design, but its value doesn't get up
dated yet.
... live example check out the source code handling the control's value now that our control is working, we have to add code to up
date its value according to user input and make it possible to send the value along with form data.
...And 7 more matches
Drawing graphics - Learn web development
up
date your ctx.drawimage() line like so: ctx.drawimage(image, 20, 20, 185, 175, 50, 50, 185, 175); the first parameter is the image reference, as before.
... loops and animations we have so far covered some very basic uses of 2d canvas, but really you won't experience the full power of canvas unless you up
date or animate it in some way.
... up
date the variables that describe the sequence of triangles, so we can be ready to draw the next one.
...And 7 more matches
Client-Server Overview - Learn web development
a method that defines the required action (for example, to get a file or to save or up
date some data).
...you might for example use a head request to find out the last time a resource was up
dated, and then only use the (more "expensive") get request to download the resource if it has changed.
... put: up
date an existing resource (or create a new one if it doesn't exist).
...And 7 more matches
McCoy
mccoy is an application that allows add-on authors to provide secure up
dates to their users.
... applications periodically look for and install up
dates to their add-ons.
... it's important that the up
date information retrieved has not been tampered with since being written by the add-on author.
...And 7 more matches
NSS_3.12_release_notes.html
bug 391292: shared database implementation slow bug 391294: shared database implementation really slow on network file systems bug 392521: automatic shared db up
date fails if user opens database r/w but never supplies a password bug 392522: integrity hashes must be up
dated when passwords are changed.
...ing aia url with ocsp access method bug 390233: umbrella bug for libpkix cert validation failures discovered from running vfyserv bug 390499: libpkix does not check cached cert chain for revocation bug 390502: libpkix fails cert validation when no valid crl (nist validation policy is always enforced) bug 390530: libpkix does not support time override bug 390536: cert validation functions must vali
date leaf cert themselves bug 390554: all pkix_nullcheck_ errors are reported as pkix alloc error bug 390888: cert_verify* functions should be able to use libpkix bug 391457: libpkix does not check for object ref leak at shutdown bug 391774: pkix_shutdown is not called by nssinit.c bug 393174: memory leaks in ocspclnt/pkix.
...bug 399326: libpkix is unable to vali
date cert for certusagestatusresponder bug 400947: thread unsafe operation in pkix_pl_hashtable_add cause selfserv to crash.
...And 7 more matches
nsINavHistoryObserver
method overview void onbeforedeleteuri(in nsiuri auri, in acstring aguid); obsolete since gecko 21.0 void onbeginup
datebatch(); void onclearhistory(); void ondeleteuri(in nsiuri auri, in acstring aguid); void ondeletevisits(in nsiuri auri, in prtime avisittime, in acstring aguid); void onendup
datebatch(); void onpagechanged(in nsiuri auri, in unsigned long awhat, in astring avalue); void onpageexpired(in nsiuri auri, in prtime avisittime, in boolean awholeentr...
... onbeginup
datebatch() notifies you that a batch of things are about to change.
... you should avoid doing any heavy-duty processing until onendup
datebatch() is called.
...And 7 more matches
HTMLImageElement.srcset - Web APIs
the htmlimageelement property srcset is a string which identifies one or more image candi
date strings, separated using commas (,) each specifying image resources to use under given circumstances.
... each image candi
date string contains an image url and an optional width or pixel density descriptor that indicates the conditions under which that candi
date should be used instead of the image specified by the src property.
... syntax htmlimageelement.srcset = imagecandi
datestrings; let srcset = htmlimageelement.srcset; value a usvstring containing a comma-separated list of one or more image candi
date strings to be used when determining which image resource to present inside the <img> element represented by the htmlimageelement.
...And 7 more matches
IDBObjectStore.put() - Web APIs
the put() method of the idbobjectstore interface up
dates a given record in a database, or inserts a new record if the given item does not already exist.
... the put method is an up
date or insert method.
... bear in mind that if you have a idbcursor to the record you want to up
date, updating it with idbcursor.up
date() is preferable to using idbobjectstore.put().
...And 7 more matches
HTML documentation index - HTML: Hypertext Markup Language
6
date and time formats used in html
date, element, format, html, iso 8601, input, reference, string, time, week,
datetime,
datetime-local, del, ins, month, month-year, week-year certain html elements use
date and/or time values.
... 50 html attribute: step attribute, attributes, constrain validation, step valid for the numeric input types, including the
date, month, week, time,
datetime-local, number and range types, the step attribute is a number that specifies the granularity that the value must adhere to or the keyword any.
...if the content is time- or
date-related, the <time> element must be used.
...And 7 more matches
Cache-Control - HTTP
cache-control: must-revali
date cache-control: no-cache cache-control: no-store cache-control: no-transform cache-control: public cache-control: private cache-control: proxy-revali
date cache-control: max-age=<seconds> cache-control: s-maxage=<seconds> extension cache-control directives extension cache-control directives are not part of the core http caching standards document.
... cache-control: immutable cache-control: stale-while-revali
date=<seconds> cache-control: stale-if-error=<seconds> directives cacheability a response is normally cached by the browser if: it has a status code of 301, 302, 307, 308, or 410 and cache-control does not have no-store, or if proxy, does not have private and authorization is unset either has a status code of 301, 302, 307, 308, or 410 or has public, max-age or s-maxage in cache-control or has expires set public the response may be stored by any cache, even if the response is normally non-cacheable.
...setting must-revali
date does not make sense because in order to go through revalidation you need the response to be stored in a cache, which no-store prevents.
...And 7 more matches
Expressions and operators - JavaScript
this operator is primarily used inside a for loop, to allow multiple variables to be up
dated each time through the loop.
... for example, if a is a 2-dimensional array with 10 elements on a side, the following code uses the comma operator to up
date two variables at once.
... suppose you define the following variables: var myfun = new function('5 + 2'); var shape = 'round'; var size = 1; var foo = ['apple', 'mango', 'orange']; var today = new
date(); the typeof operator returns the following results for these variables: typeof myfun; // returns "function" typeof shape; // returns "string" typeof size; // returns "number" typeof foo; // returns "object" typeof today; // returns "object" typeof doesntexist; // returns "undefined" for the keywords true and null, the typeof operator returns the following r...
...And 7 more matches
XUL user interfaces - Archive of obsolete content
g started - xul demonstration" onload="init();"> <script type="application/javascript" src="script7.js"/> <label class="head-1" value="xul demonstration"/> <vbox> <groupbox class="demo-group"> <caption label="day of week calculator"/> <grid> <columns> <column/> <column/> </columns> <rows> <row> <label class="text-prompt" value="
date:" accesskey="d" control="
date-text"/> <textbox id="
date-text" type="timed" timeout="750" oncommand="refresh();"/> </row> <row> <label value="day:"/> <hbox id="day-box"> <label class="day" value="sunday" disabled="true"/> <label class="day" value="monday" disabled="true"/> <label class="day"...
...ue="wednesday" disabled="true"/> <label class="day" value="thursday" disabled="true"/> <label class="day" value="friday" disabled="true"/> <label class="day" value="saturday" disabled="true"/> </hbox> </row> </rows> </grid> <hbox class="buttons"> <button id="clear" label="clear" accesskey="c" oncommand="clear
date();"/> <button id="today" label="today" accesskey="t" oncommand="settoday();"/> </hbox> </groupbox> <statusbar> <statusbarpanel id="status"/> </statusbar> </vbox> </window> make a new css file, style7.css.
...rid { margin-bottom: 1em; } .demo-group column { margin-right: .5em; } .demo-group row { margin-bottom: .5em; } .demo-group .buttons { -moz-box-pack: end; } /* the day-of-week labels */ .day { margin-left: 1em; } .day[disabled] { color: #777; } .day:first-child { margin-left: 4px; } /* the left column labels */ .text-prompt { padding-top: .25em; } /* the
date input box */ #
date-text { max-width: 8em; } /* the status bar */ statusbar { width: 100%; border: 1px inset -moz-dialog; margin: 4px; padding: 0px 4px; } #status { padding: 4px; } #status[warning] { color: red; } make a new text file, script7.js.
...And 6 more matches
JavaScript Client API - Archive of obsolete content
this document is somewhat out
dated, and the api isn't well-supported for use from add-ons; tread carefully.
... the best, and most up-to-
date, reference to sync's internal apis is the source code.
... the store must also make up
dates to the underlying data itself based on incoming record objects.
...And 6 more matches
Sorting Results - Archive of obsolete content
<treecol id="name" label="name" sort="?name" flex="1"/> <treecol id="
date" label="
date" sort="?
date" flex="1"/> in this example, the first column will be sorted by the ?name variable and the second column by the ?
date variable.
...if the tree is sorted by name, and the user clicks on the
date column header, the sort will change to the
date column.
...for instance, in the example the second column sorts by
date, but if you were to use a different variable such as ?description, the tree would sort by the value of the description variable for each row.
...And 6 more matches
Mozilla release FAQ - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2005.
...as of the time of this up
date, mozilla 1.0 release candicate 2 is the most recent release.
...And 6 more matches
Building up a basic demo with the PlayCanvas engine - Game development
playcanvas application to begin developing our game we have to create the playcanvas application first (using the given <canvas> element), and then start the up
date loop.
... var boxmaterial = new pc.phongmaterial(); boxmaterial.diffuse.set(0, 0.58, 0.86); boxmaterial.up
date(); box.model.model.meshinstances[0].material = boxmaterial; by diffusing the light on the object we can give it it's own color —we'll choose a nice familiar blue.
... after the material is created and its color is set, it has to be up
dated so our changes are going to be applied.
...And 6 more matches
2D maze game with device orientation - Game development
with every asset loaded you can see more of the preloadbar image: from 0% to 100%, up
dated on every frame.
...in particular, take note of the up
date() function (executed at every frame), which up
dates things such as the ball position.
... ball.game = function(game) {}; ball.game.prototype = { create: function() {}, initlevels: function() {}, showlevel: function(level) {}, up
datecounter: function() {}, managepause: function() {}, manageaudio: function() {}, up
date: function() {}, wallcollision: function() {}, handleorientation: function(e) {}, finishlevel: function() {} }; the create and up
date functions are framework-specific, while others will be our own creations: initlevels initializes the level data.
...And 6 more matches
Looping code - Learn web development
let's say we wanted to draw 100 random circles on a <canvas> element (press the up
date button to run the example again and again to see different random sets): hidden code <!doctype html> <html> <head> <meta charset="utf-8"> <title>random canvas circles</title> <style> html { width: 100%; height: inherit; background: #ddd; } canvas { display: block; } body { margin: 0; } button { ...
... position: absolute; top: 5px; left: 5px; } </style> </head> <body> <button>up
date</button> <canvas></canvas> <script> const btn = document.queryselector('button'); const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); let width = document.documentelement.clientwidth; let height = document.documentelement.clientheight; canvas.width = width; canvas.height = height; function random(number) { return math.floor(math.random()*number); } function draw() { ctx.clearrect(0,0,width,height); for (let i = 0; i < 100; i++) { ctx.beginpath(); ctx.fillstyle = 'rgba(255,0,0,0.5)'; ctx.arc(random(width), random(height), random(50), 0, 2 * math.pi...
...ns-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function up
datecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
...And 6 more matches
Focus management with Vue refs - Learn web development
any up
dates are first performed on the in-memory nodes, and then all the changes that need to be made to the actual nodes on the page are synced in a batch.
...up
date it like this: <button type="button" class="btn" ref="editbutton" @click="toggletoitemeditform"> edit <span class="visually-hidden">{{label}}</span> </button> to access the value associated with our ref, we use the $refs property provided on our component instance.
...because vue is trying to optimize and batch changes, it won't immediately up
date the dom when we set isediting to false.
...And 6 more matches
MediaDevices.ondevicechange - Web APIs
you can at any time use enumeratedevices() to get the up
dated list of available devices.
...there is no information about the change included in the event object; to get the up
dated list of devices, you'll have to use enumeratedevices().
... example in this example, we create a function called up
datedevicelist(), which is called once when mediadevices.getusermedia() successfully obtains a stream, and then is called any time the device list changes.
...And 6 more matches
Capabilities, constraints, and settings - Web APIs
you can also change the constraints of an existing mediastreamtrack on the fly, by calling the track's applyconstraints() method, passing into it an object representing the constraints you wish to apply to the track: videotrack.applyconstraints({ width: 1920, height: 1080 }); in this snippet, the video track referenced by videotrack is up
dated so that its resolution as closely as possible matches 1920x1080 pixels (1080p high definition).
... function switchcameras(track, camera) { let constraints = track.getconstraints(); constraints.facingmode = camera; track.applyconstraints(constraints); } this function accepts a mediastreamtrack and a string indicating the camera facing mode to use, fetches the current constraints, sets the value of the mediatrackconstraints.facingmode to the specified value, then applies the up
dated constraint set.
...this display is up
dated by the function getcurrentsettings(), which gets the current settings for the audio and video tracks and inserts the corresponding code into the tracks' settings display boxes by setting their value.
...And 6 more matches
WebRTC API - Web APIs
rtcicecandi
date represents a candi
date interactive connectivity establishment (ice) server for establishing an rtcpeerconnection.
... rtcpeerconnectioniceevent represents events that occur in relation to ice candi
dates with the target, usually an rtcpeerconnection.
... only one event is of this type: icecandi
date.
...And 6 more matches
Using XMLHttpRequest - Web APIs
load the transfer is complete; all data is now in the response var oreq = new xmlhttprequest(); oreq.addeventlistener("progress", up
dateprogress); oreq.addeventlistener("load", transfercomplete); oreq.addeventlistener("error", transferfailed); oreq.addeventlistener("abort", transfercanceled); oreq.open(); // ...
... // progress on transfers from the server to the client (downloads) function up
dateprogress (oevent) { if (oevent.lengthcomputable) { var percentcomplete = oevent.loaded / oevent.total * 100; // ...
... the progress event handler, specified by the up
dateprogress() function in this example, receives the total number of bytes to transfer as well as the number of bytes transferred so far in the event's total and loaded fields.
...And 6 more matches
Constraint validation - Developer guides
therefore, like with html4, you need to also vali
date input constraints on the server side, in a way that is consistent with what is done on the client side.
... rangeunderflow constraint violation
date, month, week a valid
date datetime,
datetime-local, time a valid
date and time max range, number a valid number the value must be less than or equal to the value rangeoverflow constraint violation
date, month, week a valid
date datetime,
datetime-local, time a valid
date and time required text, search, url, tel, email, passwo...
...rd,
date,
datetime,
datetime-local, month, week, time, number, checkbox, radio, file; also on the <select> and <textarea> elements none as it is a boolean attribute: its presence means true, its absence means false there must be a value (if set).
...And 6 more matches
<input type="color"> - HTML: Hypertext Markup Language
the element's presentation may vary substantially from one browser and/or platform to another—it might be a simple textual input that automatically vali
dates to ensure that the color information is entered in the proper format, or a platform-standard color picker, or some kind of custom color picker window.
... providing a default color you can up
date the simple example above to set a default value, so that the color well is pre-filled with the default color and the color picker (if any) will also default to that color: <input type="color" value="#ff0000"> if you don't specify a value, the default is #000000, which is black.
... here's an example that watches changes over time to the color value: colorpicker.addeventlistener("input", up
datefirst, false); colorpicker.addeventlistener("change", watchcolorpicker, false); function watchcolorpicker(event) { document.queryselectorall("p").foreach(function(p) { p.style.color = event.target.value; }); } selecting the value if the <input> element's implementation of the color type on the user's browser doesn't support a color well, but is instead a text field for entering the col...
...And 6 more matches
href - SVG: Scalable Vector Graphics
candi
date recommendation defines href for the <a> element.
... candi
date recommendation defines href for the <feimage> element.
... candi
date recommendation defines href for the <image> element.
...And 6 more matches
Chapter 5: Let's build a Firefox extension - Archive of obsolete content
script" src="chrome://helloworld/content/clock.js"/> <hbox align="center"> <label value="current time:" /> <textbox id="currenttime" /> </hbox> </dialog> listing 6: content for clock.js function initclock() { showcurrenttime(); window.setinterval(showcurrenttime, 1000); } function showcurrenttime() { var textbox = document.getelementbyid("currenttime"); textbox.value = new
date().tolocaletimestring(); textbox.select(); } operations check perform an operations check to make sure that your changes to the source file are correct.
... fixme: figure 10: directory structure with skin package added add the skin package up
date chrome.manifest with the contents of listing 10.
... add the toolbar button to add the toolbar button to the browser window, up
date overlay.xul as shown in listing 11.
...And 5 more matches
Gecko Compatibility Handbook - Archive of obsolete content
they are actually replaced by ''-(example removed)-'' the goal of this handbook is to help you up
date websites to work with standards-based browsers and properly detect gecko.
...this compatibility test will be most beneficial to sites using simple code or that have up
dated to support standards.
...detecting gecko instead is the easy way to fix this as well as accomo
date users of mozilla, compuserve 7, etc.
...And 5 more matches
What is RSS - Archive of obsolete content
for example: <?xml version="1.0"?> <rss version="2.0"> <channel> <title>example news site</title> <description>this is an example news site.</description> <lastbuild
date>wed, 27 jul 2005 00:30:30 -0700</lastbuild
date> <link>http://news.example.com/</link> <item> <title>news flash: i like bread</title> <guid ispermalink="false">4d4a0a12-f188-4c97-908b-eea27213c2fe</guid> <pub
date>wed, 27 jul 2005 00:30:30 -0700</pub
date> <link>http://news.example.com/artcle/554</link> </item> <item> ...
... <title>big news today: birds fly</title> <guid ispermalink="false">c4a63f09-b45b-466b-8773-6ff264001ab7</guid> <pub
date>tue, 19 jul 2005 04:32:51 -0700</pub
date> <link>http://news.example.com/artcle/553</link> </item> <item> <title>fire is hot</title> <guid ispermalink="false">c1795324-d5ea-44fa-95b1-b5ce2090d4f1</guid> <pub
date>sun, 15 may 2005 13:02:08 -0700</pub
date> <link>http://news.example.com/artcle/552</link> </item> </channel> </rss> bloggers use rss to provide everyone with a list of their newest blog posts.
... for example: <?xml version="1.0"?> <rss version="2.0"> <channel> <title>joe blow's blog</title> <description>this is the weblog of joe blow</description> <lastbuild
date>sun, 15 may 2005 13:02:08 -0500</lastbuild
date> <link>http://joe-blow.example.net/</link> <item> <title>i be blogging...</title> <guid>http://joe-blow.example.net/log/21</guid> <pub
date>sun, 15 may 2005 13:02:08 -0500</pub
date> <link>http://joe-blow.example.net/log/21</link> </item> <item> <title>i am so smrt</title> <guid>http://joe-blow.example.net/log/20</guid> <pub
date>sat, 14 may 2005 22:19:18 -0500</pub
date> <link>http://joe-blow.example.net/log/20</link> </i...
...And 5 more matches
Using workers in extensions - Archive of obsolete content
how this differs from previous versions this version of the stock ticker extension moves the xmlhttprequest call that fetches up
dated stock information into a worker thread, which then passes that information back to the main body of the extension's code to up
date the display in the status bar.
... the worker the worker thread's job in this example is to issue the xmlhttprequest calls that fetch the up
dated stock information.
...this provides a way for the main thread to specifically request that the worker up
date the stock information at once.
...And 5 more matches
Reference - Archive of obsolete content
once that is done, the various code samples should be up
dated to reflect current practices and code if they cannot be written in a "version-neutral" manner.
...a subset of the "object > (function, everything else)" chain could be object > function > (object, function, array, string, boolean, number,
date, regexp, error).
...compare this to the
date object.
...And 5 more matches
XForms Custom Controls - Archive of obsolete content
we will also show you how to create custom controls that work with the xforms model and are automatically up
dated just like xforms controls.
...for example, if you have an instance node of type xsd:
date and you'd like to see the
date displayed in a local format.
...this will also allow you to be up to
date with our current approaches (often the result of hard-learned lessons) and that will hopefully help you to more easily write your own controls.
...And 5 more matches
Parsing microformats in JavaScript - Archive of obsolete content
methods
datetimegetter() specifically retrieves a
date from a microformat node.
... after getting the text, it is normalized into an iso 8601
date.
... normalized
date = microformats.parser.
datetimegetter(propnode, parentnode); parameters propnode the dom node to check.
...And 5 more matches
Advanced form styling - Learn web development
<input type="color">
date-related controls such as <input type="
datetime-local"> <input type="range"> <input type="file"> <progress> and <meter> let's first talk about the appearance property, which is pretty useful for making all of the above more stylable.
... for example, let's take the following controls: <form> <p> <label for="search">search: </label> <input id="search" name="search" type="search"> </p> <p> <label for="text">text: </label> <input id="text" name="text" type="text"> </p> <p> <label for="
date">
date: </label> <input id="
date" name="
date" type="
datetime-local"> </p> <p> <label for="radio">radio: </label> <input id="radio" name="radio" type="radio"> </p> <p> <label for="checkbox">checkbox: </label> <input id="checkbox" name="checkbox" type="checkbox"> </p> <p><input type="submit" value="submit"></p> <p><input type="button" value="button"></p> </form> ap...
...in short, these are drop-down boxes, complex control types like color and
datetime-local, and feedback—oriented controls like <progress> and <meter>.
...And 5 more matches
Cooperative asynchronous JavaScript: Timeouts and intervals - Learn web development
the following function creates a new
date() object, extracts a time string out of it using tolocaletimestring(), and then displays it in the ui.
... it then runs the function once per second using setinterval(), creating the effect of a digital clock that up
dates once per second (see this live, and also see the source): function displaytime() { let
date = new
date(); let time =
date.tolocaletimestring(); document.getelementbyid('demo').textcontent = time; } const createclock = setinterval(displaytime, 1000); just like settimeout(), setinterval() returns an identifying value you can use later when you need to clear the interval.
... it is easier to create this example without using a
date() object, like we've done in our version, but less accurate — you can't guarantee that the callback will fire after exactly 1000ms.
...And 5 more matches
Arrays - Learn web development
al.tofixed(2); </textarea> <div class="playable-buttons"> <input id="reset" type="button" value="reset"> <input id="solution" type="button" value="show solution"> </div> const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); let code = textarea.value; let userentry = textarea.value; function up
datecode() { eval(textarea.value); } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = jssolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { ...
... textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');\nconst totalbox = document.queryselector(\'.output p\');\nlet total = 0;\nlist.innerhtml = \'\';\ntotalbox.textcontent = \'\';\n\nlet products = [\'underpants:6.99\',\n \'socks:5.99\',\n \'t-shirt:14.99\',\n \'trousers:31.99\',\n \'shoes:23.99\'];\n\nfor(let i = 0; i < products.length; i++) {\n let subarray = products[i].split(\':\');\n let name = subarray[0];\n let price = number(subarray[1]);\n total += price;\n let itemtext = name + \' — $\' + price;\n\n let listitem = document.createelement(\'li\');\n listitem.textcontent = itemtext;\n list.appendchild(listitem);\n}\n\ntotalbox.textcontent = \'total: $\' + total...
....tofixed(2);'; let solutionentry = jssolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selecti...
...And 5 more matches
Adding features to our bouncing balls demo - Learn web development
the ball draw(), up
date(), and collisiondetect() method definitions should be able to stay exactly the same as they were before.
... checkbounds() this method will do the same thing as the first part of ball()'s up
date() function — look to see whether the evil circle is going to go off the edge of the screen, and stop it from doing so.
... again, you can mostly just copy the ball.prototype.up
date definition, but there are a few changes you should make: get rid of the last two lines — we don't want to automatically up
date the evil circle's position on every frame, because we will be moving it in some other way, as you'll see below.
...And 5 more matches
React interactivity: Editing, filtering, conditional rendering - Learn web development
it’ll be similar to deletetask() because it'll take an id to find its target object, but it'll also take a newname property containing the name to up
date the task to.
... up
date the "edit" button in the viewtemplate like so: <button type="button" classname="btn" onclick={() => setediting(true)}> edit <span classname="visually-hidden">{props.name}</span> </button> now we'll add the same onclick handler to the "cancel" button in the editingtemplate, but this time we'll set isediting to false so that it switches us back to the view template.
... up
date the "cancel" button in the edittemplate like so: <button type="button" classname="btn todo-cancel" onclick={() => setediting(false)} > cancel <span classname="visually-hidden">renaming {props.name}</span> </button> with this code in place, you should be able to press the "edit" and "cancel" buttons in your todo items to toggle between templates.
...And 5 more matches
Vue conditional rendering: editing existing todos - Learn web development
to do this, we will take advantage of vue's conditional rendering capabilities — namely v-if and v-else — to allow us to toggle between the existing todo item view, and an edit view where you can up
date todo item labels.
... up
date your todoitem’s template as shown below.
...in this handler we’ll emit an item-deleted event to our parent component so the list can be up
dated.
...And 5 more matches
Handling common HTML and CSS problems - Learn web development
a good strategy is to vali
date your code regularly.
...to show you an example of how such plugins generally work: install atom (if you haven't got an up-to-
date version already installed) — download it from the atom page linked above.
... html5 form elements also exhibit fallback qualities — html5 introduced some special <input> types for inputting specific information into forms, such as times,
dates, colors, numbers, etc.
...And 5 more matches
Performance best practices for Firefox front-end engineers
it is expected that over time, script will up
date the dom, requiring us to recalculate styles.
... it is expected that over time, script will up
date the dom, requiring us to recalculate styles, and then up
date layout.
...uninterruptible reflow occurs when some dom node’s styles have changed such that the size or position of one or more nodes in the document will need to be up
dated, and then javascript asks for the size or position of anything.
...And 5 more matches
Addon
overview of required methods void iscompatiblewith(in string appversion, in string platformversion) void findup
dates(in up
datelistener listener, in integer reason, in string appversion, in string platformversion) overview of optional methods void uninstall() void canceluninstall() boolean hasresource(in string path) nsiuri getresourceuri(in string path) void getdatadirectory(in datadirectorycallback callback) required properties attribute ...
... providesup
datessecurely read only boolean true if the add-on has a secure means of updating or cannot be up
dated at all.
... applybackgroundup
dates integer indicates whether up
dates found in the background for this add-on will be applied automatically.
...And 5 more matches
Localization content best practices
this would waste everybody's time and create unnecessary frustration: localizers have to translate strings that are destined to change, developers will need to use new ids later to up
date them.
...
date and time formats for example, you shouldn't hard code
date formats into applications: %a, %b %e // resulting in wednesday, may 20 this is fine in english, but in italian results in "mercoledì, mag 20", which sounds unnatural.
... changing existing strings updating entity names if you are changing a string such that its meaning has changed, you must up
date the entity or property name for the string to match the new meaning.
...And 5 more matches
Enc Dec MAC Output Public Key as CSR
null, keysize, keyid, pr_false, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; const char *header; const char *trailer; switch (type) { case symkey: ...
...ams rsaparams; void *params; seckeyprivatekey *privkey = null; secstatus rv; unsigned char randbuf[blocksize + 1]; rv = generaterandom(randbuf, blocksize); if (rv != secsuccess) { fprintf(stderr, "error while generating the random numbers : %s\n", port_errortostring(rv)); goto cleanup; } pk11_randomup
date(randbuf, blocksize); switch (keytype) { case rsakey: rsaparams.keysizeinbits = size; rsaparams.pe = publicexponent; mechanism = ckm_rsa_pkcs_key_pair_gen; algtag = sec_oid_pkcs1_md5_with_rsa_encryption; params = &rsaparams; break; default: ...
...And 5 more matches
NSS tools : crlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... crl generation script syntax crl generation script file has the following syntax: * line with comments should have # as a first symbol of a line * set "this up
date" or "next up
date" crl fields: up
date=yyyymmddhhmmssz nextup
date=yyyymmddhhmmssz field "next up
date" is optional.
... * add certificate entries(s) to crl: addcert range
date range: two integer values separated by dash: range of certificates that will be added by this command.
...And 5 more matches
sslfnc.html
it causes dynamic linking issues at run-time after an up
date of nss because the actual size of the array changes between releases.
... checksig pr_true means signatures are to be checked and the certificate chain is to be vali
dated.
... checksig pr_true means signatures are to be checked and the certificate chain is to be vali
dated.
...And 5 more matches
Utility functions
hash_gethashtypebyoidtag mxr 3.8 and later hash_gettype mxr 3.12 and later hash_hashbuf mxr 3.10 and later hash_resultlen mxr 3.4 and later hash_resultlenbyoidtag mxr 3.10 and later hash_resultlencontext mxr 3.10 and later hash_up
date mxr 3.4 and later nss_init mxr 3.2 and later nss_initialize mxr 3.2 and later nss_initreadwrite mxr 3.2 and later nss_initwithmerge mxr 3.12 and later nss_isinitialized mxr 3.9.2 and later nss_nodb_init mxr 3.2 and late...
... 3.2 and later nss_unregistershutdown mxr 3.11.1 and later nss_versioncheck mxr 3.2 and later nssbase64_decodebuffer mxr 3.4 and later nssbase64decoder_create mxr 3.2 and later nssbase64decoder_destroy mxr 3.2 and later nssbase64decoder_up
date mxr 3.2 and later nssbase64_encodeitem mxr 3.4 and later nssbase64encoder_create mxr 3.2 and later nssbase64encoder_destroy mxr 3.2 and later nssbase64encoder_up
date mxr 3.2 and later nssrwlock_destroy mxr 3.2 and later nssrwlock_h...
...ater sec_asn1decoderclearnotifyproc mxr 3.2 and later sec_asn1decoderfinish mxr 3.2 and later sec_asn1decodersetfilterproc mxr 3.2 and later sec_asn1decodersetnotifyproc mxr 3.2 and later sec_asn1decoderstart mxr 3.2 and later sec_asn1decoderup
date mxr 3.2 and later sec_asn1encode mxr 3.2 and later sec_asn1encodeinteger mxr 3.2 and later sec_asn1encodeitem mxr 3.2 and later sec_asn1encoderabort mxr 3.9 and later sec_asn1encoderclearnotifyproc mxr 3.2 and later sec_asn1encoder...
...And 5 more matches
NSS tools : crlutil
list of possible algorithms: md2 | md4 | md5 | sha1 | sha256 | sha384 | sha512 -n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... crl generation script syntax crl generation script file has the following syntax: * line with comments should have # as a first symbol of a line * set "this up
date" or "next up
date" crl fields: up
date=yyyymmddhhmmssz nextup
date=yyyymmddhhmmssz field "next up
date" is optional.
... * add certificate entries(s) to crl: addcert range
date range: two integer values separated by dash: range of certificates that will be added by this command.
...And 5 more matches
Redis Tips
i mean counters you can up
date atomically.
... > var r = require('redis').createclient(); // and i'll define these utility functions just for this example > function now() { return (new
date()).gettime() / 1000 } > function print(err, results) { console.log(json.stringify(results, null, 2)) } whenever someone logs into my site, i record them in my 'last-login' zset.
... here's what the zset contains now: > r.zrange('last-login', 0, -1, print); // remember, i defined 'print' above ["jparsons", "zcarter", "lloyd"] since this is a set, lloyd only appears once, with up
dated login timestamp.
...And 5 more matches
nsIDOMMozNetworkStatsManager
the query may be filtered by connection type and
date.
... start a
date object representing the beginning of data measurement.
... end a
date object representing the end of data measurement.
...And 5 more matches
nsINavHistoryQueryOptions
instead, we get the result ordered by
date, pick the maxresult most recent ones, and then sort by title.
...only matters when sorting by
date.
... sort_by_
date_ascending 3 sort by the ascending
date order.
...And 5 more matches
nsITreeBoxObject
id ensurecellisvisible(in long row, in nsitreecolumn col); void scrolltorow(in long index); void scrollbylines(in long numlines); void scrollbypages(in long numpages); void scrolltocell(in long row, in nsitreecolumn col); void scrolltocolumn(in nsitreecolumn col); void scrolltohorizontalposition(in long horizontalposition); void invali
date(); void invali
datecolumn(in nsitreecolumn col); void invali
daterow(in long index); void invali
datecell(in long row, in nsitreecolumn col); void invali
daterange(in long startindex, in long endindex); void invali
datecolumnrange(in long startindex, in long endindex, in nsitreecolumn col); long getrowat(in long x, in long y); void getcell...
...at(in long x, in long y, out long row, out nsitreecolumn col, out acstring childelt); void getcoordsforcellitem(in long row, in nsitreecolumn col, in acstring element, out long x, out long y, out long width, out long height); boolean iscellcropped(in long row, in nsitreecolumn col); void rowcountchanged(in long index, in long count); void beginup
datebatch(); void endup
datebatch(); void clearstyleandimagecaches(); attributes attribute type description columns nsitreecolumns readonly: obtain the columns.
... void scrolltohorizontalposition(in long horizontalposition); parameters horizontalposition the number of pixels to scroll invali
date() invali
datecolumn() invali
daterow() invali
datecell() invali
daterange() invali
datecolumnrange() invalidation methods for fine-grained painting control.
...And 5 more matches
Using IndexedDB - Web APIs
if the database does exist but you are specifying an upgraded version number, an onupgradeneeded event is triggered straight away, allowing you to provide an up
dated schema in its handler.
...const customerdata = [ { ssn: "444-44-4444", name: "bill", age: 35, email: "bill@company.com" }, { ssn: "555-55-5555", name: "donna", age: 32, email: "donna@home.org" } ]; of course, you wouldn't use someone's social security number as the primary key to a customer table because not everyone has a social security number, and you would store their birth
date instead of their age, but let's ignore those unfortunate choices for the sake of convenience and move along.
...let's up
date the previous example somewhat: var objectstore = db.transaction(["customers"], "readwrite").objectstore("customers"); var request = objectstore.get("444-44-4444"); request.onerror = function(event) { // handle errors!
...And 5 more matches
RTCConfiguration.iceTransportPolicy - Web APIs
syntax let rtcconfiguration = { icetransportpolicy: policy }; rtcconfiguration.icetransportpolicy = policy; let policy = rtcconfiguration.icetransportpolicy; value a domstring which indicates what ice candi
date policy the ice agent should use during the negotiation process, per the jsep standard.
... the permitted values are: all the ice agent is permitted to use any kind of candi
date, including both local and relay candi
dates.
... the agent—or the browser itself—may still perform some form of ip filtering on the incoming candi
dates for reasons including privacy and security, as well as to simply limit the number of candi
dates.
...And 5 more matches
RTCIceTransport.ongatheringstatechange - Web APIs
the gathering state indicates whether or not the ice agent has begun gathering candi
dates, and if so, whether or not gathering has finished.
... its possible values are: "new" the rtcicetransport is newly created and has not yet started to gather ice candi
dates.
... "gathering" the transport is in the process of gathering candi
dates.
...And 5 more matches
RTCPeerConnection.iceConnectionState - Web APIs
constant description "new" the ice agent is gathering addresses or is waiting to be given remote candi
dates through calls to rtcpeerconnection.addicecandi
date() (or both).
... "checking" the ice agent has been given one or more remote candi
dates and is checking pairs of local and remote candi
dates against one another to try to find a compatible match, but has not yet found a pair which will allow the peer connection to be made.
... it's possible that gathering of candi
dates is also still underway.
...And 5 more matches
RTCPeerConnection: icegatheringstatechange event - Web APIs
the icegatheringstatechange event is sent to the onicegatheringstatechange event handler on an rtcpeerconnection when the state of the ice candi
date gathering process changes.
... when ice firststarts to gather connection candi
dates, the value changes from new to gathering to indicate that the process of collecting candi
date configurations for the connection has begun.
... when the value changes to complete, all of the transports that make up the rtcpeerconnection have finished gathering ice candi
dates.
...And 5 more matches
A simple RTCDataChannel sample - Web APIs
set up the ice candi
dates the next step is to set up each connection with ice candi
date listeners; these will be called when there's a new ice candi
date to tell the other side about.
... note: in a real-world scenario in which the two peers aren't running in the same context, the process is a bit more involved; each side provides, one at a time, a suggested way to connect (for example, udp, udp with a relay, tcp, etc.) by calling rtcpeerconnection.addicecandi
date(), and they go back and forth until agreement is reached.
... localconnection.onicecandi
date = e => !e.candi
date || remoteconnection.addicecandi
date(e.candi
date) .catch(handleaddcandi
dateerror); remoteconnection.onicecandi
date = e => !e.candi
date || localconnection.addicecandi
date(e.candi
date) .catch(handleaddcandi
dateerror); we configure each rtcpeerconnection to have an event handler for the icecandi
date event.
...And 5 more matches
WebRTC Statistics API - Web APIs
mapping of statistic category names to the dictionaries they implement statistic category name (rtcstatstype) description dictionaries implemented candi
date-pair statistics describing the change from one rtcicetransport to another, such as during an ice restart.
... rtcicecandi
datepairstats rtcstats certificate statistics about a certificate being used by an rtcicetransport.
... rtcinboundrtpstreamstats rtcreceivedrtpstreamstats rtcrtpstreamstats rtcstats local-candi
date statistics about a local ice candi
date associated with the connection's rtcicetransports.
...And 5 more matches
ARIA Test Cases - Accessibility
introduction the information on this page is out of
date: it was last up
dated november 2010.
... for more up-to-
date examples, see the openajaxalliance aria examples page.
... - - - voiceover (leopard) n/a n/a - fail window-eyes - - - - nvda - n/a - - zoom (leopard) pass n/a pass pass zoomtext - - - - orca - - - -
datepicker testcases:
datepicker example expected at behavior: markup used: notes: results: at firefox ie opera safari jaws 9 - - n/a n/a jaws 10 - - - voiceover (leopard) n/a n/a - fail window-eyes - - - - nvda - n/a - - zoom (leopard) pass n/a pa...
...And 5 more matches
ARIA annotations - Accessibility
aria-details has been up
dated so that it can support multiple ids — this makes sense, for example you can easily envisage having multiple comments relating to the same bit of text.
...description-id"> <!-- some kind of ui feature that needs an accessible description --> </div> aria-details is appropriate when linking to descriptions or annotations that are a bit more complex — rather than a simple text string, it might contain multiple bits of semantic information: <div id="detail-id"> <h2>a heading</h2> <p>an extended text description of some kind…</p> <p><time
datetime="...">a timestamp</time></p> </div> <div aria-details="detail-id"> <!-- some kind of ui feature that needs an accessible description --> </div> this difference really becomes apparent when you get to how the content is actually interpreted in the accessibility layer, and read out by screenreaders.
...</p> <div id="comment-source">suggested by chris, <time
datetime="2019-03-30t19:29">march 30 2019, 19:29</time></div> browsers tend to provide a default black strikethrough for deletions, and a black underline for insertions, but you’ll probably want to use some more interesting styling of your own, for example: ins, [role="insertion"] { color: #0c0; text-decoration: underline; } del, [role="deletion"] { color: red; text-decoration: line-throu...
...And 5 more matches
Web applications and ARIA FAQ - Accessibility
along with placing them directly in the markup, aria attributes can be added to the element and up
dated dynamically using javascript code like this: // find the progress bar <div> in the dom.
...progressbar.setattribute("role", "progressbar"); progressbar.setattribute("aria-valuemin", 0); progressbar.setattribute("aria-valuemax", 100); // create a function that can be called at any time to up
date the value of the progress bar.
... function up
dateprogress(percentcomplete) { progressbar.setattribute("aria-valuenow", percentcomplete); } will adding aria change my page styles or behavior?
...And 5 more matches
<input type="time"> - HTML: Hypertext Markup Language
12-hour 24-hour chrome 83 in chrome 83, the ui controls have been up
dated with a new look and feel.
... events change and input supported common attributes autocomplete, list, readonly, and step idl attributes value, valueas
date, valueasnumber, and list.
...you can set a default value for the input by including a valid time in the value attribute when creating the <input> element, like so: <label for="appt-time">choose an appointment time: </label> <input id="appt-time" type="time" name="appt-time" value="13:30"> you can also get and set the
date value in javascript using the htmlinputelement.value property, for example: var timecontrol = document.queryselector('input[type="time"]'); timecontrol.value = '15:30'; time value format the value of the time input is always in 24-hour format that includes leading zeros: hh:mm, regardless of the input format, which is likely to be selected based on the user's locale (or by the user agent).
...And 5 more matches
<time> - HTML: Hypertext Markup Language
it may include the
datetime attribute to translate
dates into machine-readable format, allowing for better search engine results or custom features such as reminders.
... a precise
date in the gregorian calendar (with optional time and timezone information).
...
datetime this attribute indicates the time and/or
date of the element and must be in one of the formats described below.
...And 5 more matches
Index - HTTP
57
date general header, http, reference, header the
date general http header contains the
date and time at which the message was originated.
...on the other side, if the content has changed, etags are useful to help prevent simultaneous up
dates of a resource from overwriting each other ("mid-air collisions").
... 62 expires caching, http, response, header the expires header contains the
date/time after which the response is considered stale.
...And 5 more matches
HTTP headers - HTTP
expires the
date/time after which the response is considered stale.
...if width occurs in a message more than once, the last value overrides all previous occurrences conditionals last-modified the last modification
date of the resource, used to compare several versions of the same resource.
...this is used to up
date caches (for safe requests), or to prevent to upload a new resource when one already exists.
...And 5 more matches
context-menu - Archive of obsolete content
this example up
dates the item's label based on the number of times it's been clicked: var numclicks = 0; var myitem = require("sdk/context-menu").item({ label: "click me: " + numclicks, contentscript: 'self.on("click", self.postmessage);', onmessage: function () { numclicks++; this.label = "click me: " + numclicks; // setting myitem.label is equivalent.
... } }); sometimes you might want to up
date the label based on the context.
...you can set this after creating the item to up
date its label later.
...And 4 more matches
package.json - Archive of obsolete content
up
datekey same as the up
datekey in an install.rdf file.
... see supporting up
dates for self-hosted add-ons.
... up
datelink same as the up
datelink for an up
date.rdf file.
...And 4 more matches
Forms related code snippets - Archive of obsolete content
date picker (before implementing it in a working environment, please read the note about the const statement compatibility) <!doctype html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>
datepicker example - mdn</title> <script type="text/javascript"> /*\ |*| |*|
datepicker example mdndeveloper network |*| |*| https://developer.mozilla.org/docs/code_snippets/forms |*| https://developer.mozilla.org/user:fusionchess |*| |*| this snippet is released under the gnu public license, version 3 or later.
... |*| http://www.gnu.org/licenses/gpl-3.0-standalone.html |*| \*/ (function () { function
datepicker (otarget) { const otable = document.createelement("table"), ohrow = document.createelement("tr"), othead = document.createelement("thead"), ocapt = document.createelement("caption"), odecryear = document.createelement("span"), oincryear = document.createelement("span"), odecrmonth = document.createelement("span"), oincrmonth = document.createelement("span"); var nid = ainstances.length, oth; this.target = otarget; this.display = document.createelement("span"); this.current = new
date(); this.container = otable; this.display.classname = sprefs + "-current-month"; this.id = nid; otable.classname = sprefs + "-calendar"; ...
... oth = document.createelement("th"); oth.innerhtml = sdays[nthid]; ohrow.appendchild(oth); } othead.appendchild(ohrow); ocapt.appendchild(odecryear); ocapt.appendchild(odecrmonth); ocapt.appendchild(oincryear); ocapt.appendchild(oincrmonth); ocapt.appendchild(this.display); this.container.appendchild(ocapt); this.container.appendchild(othead); this.current.set
date(1); this.writedays(); otarget.onclick = function () { if (otable.parentnode) { otable.parentnode.removechild(otable); return; } otable.style.zindex = nzindex++; otable.style.position = "absolute"; otable.style.left = otarget.offsetleft + "px"; otable.style.top = (otarget.offsettop + otarget.offsetheight) + "px"; otarget.parentnode...
...And 4 more matches
Enhanced Extension Installation - Archive of obsolete content
if the item is not compatible, the extension system asks the appropriate up
date service (either the one specified by the item, or the default one) if there is remote compatibility information that supercedes the compatibility information held by the item.
...types are defined in nsiup
dateservice.idl on the nsiup
dateitem interface.
...the guid and version supplied are vali
dated, and then compatibility is checked for by the new _getinstalldata function.
...And 4 more matches
Chapter 1: Introduction to Extensions - Archive of obsolete content
the add-ons manager handles the following tasks: safely installs and uninstalls add-ons makes sure add-ons are compatible with the version of firefox you're using manages a whitelist of sites trusted for installing add-ons helps troubleshoot add-ons by disabling them and offering a safe mode confirms and runs up
dates provides access to add-ons' settings dialogs provides access to add-ons' support sites development environment amenities initially, there wasn't adequate documentation available, and extension developers were largely left to fend for themselves1; however, now there's a considerable store of knowledge.
... single feature extensions fixme: up
date this.
... feature enhancing extensions fixme: up
date this.
...And 4 more matches
Layout System Overview - Archive of obsolete content
to
date the only real use of this multiple presentation ability is seen in printing, where multiple presentations are managed, all connected to the same content model.
...sometimes a content element comes in incrementally, and invali
dates the formatting of some of the frames that precede it, frame that have already been formatted.
...conceptually, this could be used to introduce other layout systems, but it might be worth noting that there was no specific facility designed into the layout system to accommo
date this.
...And 4 more matches
MenuItems - Archive of obsolete content
you do not need to up
date the checked attribute as the menuitem will up
date this automatically before the command event is fired.
... note that the checked state is up
dated before the command event fires, so if you use the menuitem's checked attribute within the command listener, it will already be in the new state.
... there may be times when you do not want the checkbox state to be up
dated automatically when the menuitem is activated.
...And 4 more matches
Multiple Rule Example - Archive of obsolete content
ner="?start" child="?photo"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/title" object="?title"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/description" object="?description"/> <triple subject="?photo" predicate="http://purl.org/dc/elements/1.1/
date" object="?
date"/> </conditions> <action> <hbox uri="?photo" class="box-padded"> <vbox> <label value="?title"/> <image src="?photo"/> </vbox> <groupbox> <caption label="photo details"/> <label value="?description"/> <label value="
date: ?
date"/> </groupbox> ...
... predicate="http://purl.org/dc/elements/1.1/title" object="?phototitle"/> </conditions> <action> <vbox uri="?photo" class="box-padded"> <label value="?phototitle"/> <image src="?photo"/> </vbox> </action> </rule> </template> </vbox> in this example, the first rule matches only those photos with title, description, and
date properties.
...the second photo has a title and
date but no description, while the third photo has only a title.
...And 4 more matches
calICalendarViewController - Archive of obsolete content
interface code [scriptable, uuid(1f783898-f4c2-4b2d-972e-360e0de38237)] interface calicalendarviewcontroller : nsisupports { void createnewevent (in calicalendar acalendar, in cali
datetime astarttime, in cali
datetime aendtime); void modifyoccurrence (in caliitemoccurrence aoccurrence, in cali
datetime anewstarttime, in cali
datetime anewendtime); void deleteoccurrence (in caliitemoccurrence aoccurrence); }; methods createnewevent void createnewevent (in calicalendar acalendar, in cali
datetime astarttime, in cali
datetime ...
...the cali
datetime parameters are optional, but aendtime cannot be included without astarttime.
...the calievent should have its end
date set to aendtime, if this parameter is specified.
...And 4 more matches
Implementation Status - Archive of obsolete content
processing model (events) section title status notes bugs 4 processing model (events) partial the xforms-recalculate, xforms-revali
date, and xforms-refresh events are not as separated as they should be.
...el-construct-done supported 4.2.3 xforms-ready supported 4.2.4 xforms-model-destruct supported 4.3.1 xforms-rebuild supported 4.3.2 xforms-recalculate supported 4.3.3 xforms-revali
date supported 4.3.4 xforms-refresh supported 4.3.5 xforms-reset supported 4.3.6 xforms-next xforms-previous supported 4.3.7 xforms-focus supported 4.3.8 xforms-help xforms-hint ...
...ement unsupported 4.8 dom interface for access to instance data supported 4.8.1 getinstancedocument() supported 4.8.2 rebuild() supported 4.8.3 recalculate() supported 4.8.4 revali
date() supported 4.8.5 refresh() supported 4.9 feature string for the hasfeature method call supported 5.
...And 4 more matches
Mozilla XForms User Interface - Archive of obsolete content
for example, a xforms input control may appear as a text field or as a
datepicker depending on whether it is bound to a xsd:string type or a xsd:
date type.
... when a xf:output binds to a node that has a type of xsd:
date, we output the
date value as plain text.
... an output bound to a
date and also having @appearance='full' will display as a calendar.
...And 4 more matches
Implementing controls using the Gamepad API - Game development
the first one is fired when the browser detects the connection of a new gamepad while the second one is fired when a gamepad is disconnected (either physically by the user or due to inactivity.) in the demo, the gamepadapi object is used to store everything related to the api: var gamepadapi = { controller: {}, turbo: false, connect: function() {}, disconnect: function() {}, up
date: function() {}, buttonpressed: function() {}, buttons: [], buttonscache: [], buttonsstatus: [], axesstatus: [] }; the buttons array contains the xbox 360 button layout: buttons: [ 'dpad-up','dpad-down','dpad-left','dpad-right', 'start','back','axis-left','axis-right', 'lb','rb','power','a','b','x','y', ], this can be different for other types of gamepads like the ps3 controller...
... querying the gamepad object beside connect() and disconnect(), there are two more methods in the gamepadapi object: up
date() and buttonpressed().
... up
date() is executed on every frame inside the game loop, to up
date the actual status of the gamepad object regularly: up
date: function() { // clear the buttons cache gamepadapi.buttonscache = []; // move the buttons status from the previous frame to the cache for(var k=0; k<gamepadapi.buttonsstatus.length; k++) { gamepadapi.buttonscache[k] = gamepadapi.buttonsstatus[k]; } // clear the buttons status gamepadapi.buttonsstatus = []; // get the gamepad object var c = gamepadapi.controller || {}; // loop through buttons and push the pressed ones to the array var pressed = []; if(c.buttons) { for(var b=0,t=c.buttons.length; b<t; b++) { if(c.buttons[b].pressed) { pressed.push(gamepadapi.buttons[b]); } } } // loop through axes and push th...
...And 4 more matches
MVC - MDN Web Docs Glossary: Definitions of Web-related terms
if the state of this data changes, then the model will usually notify the view (so the display can change as needed) and sometimes the controller (if different logic is needed to control the up
dated view).
... the controller the controller contains logic that up
dates the model and/or view in response to input from the users of the app.
...these actions require the model to be up
dated, so the input is sent to the controller, which then manipulates the model as appropriate, which then sends up
dated data to the view.
...And 4 more matches
Client-side storage - Learn web development
our example will allow you enter a name, after which the page will up
date to give you a personalized greeting.
...in this function we remove the name item from web storage using removeitem(), then again run namedisplaycheck() to up
date the display.
...e let request = objectstore.add(newitem); request.onsuccess = function() { // clear the form, ready for adding the next entry titleinput.value = ''; bodyinput.value = ''; }; // report on the success of the transaction completing, when everything is done transaction.oncomplete = function() { console.log('transaction completed: database modification finished.'); // up
date the display of data to show the newly added item, by running displaydata() again.
...And 4 more matches
What is JavaScript? - Learn web development
a high-level definition javascript is a scripting or programming language that allows you to implement complex features on web pages — every time a web page does more than just sit there and display static information for you to look at — displaying timely content up
dates, interactive maps, animated 2d/3d graphics, scrolling video jukeboxes, etc.
...ign: center; border: 2px solid rgba(0,0,200,0.6); background: rgba(0,0,200,0.3); color: rgba(0,0,200,0.6); box-shadow: 1px 1px 2px rgba(0,0,200,0.4); border-radius: 10px; padding: 3px 10px; display: inline-block; cursor: pointer; } and finally, we can add some javascript to implement dynamic behaviour: const para = document.queryselector('p'); para.addeventlistener('click', up
datename); function up
datename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } try clicking on this last version of the text label to see what happens (note also that you can find this demo on github — see the source code, or run it live)!
...we used a click event in our example above to detect when the button is clicked and then run the code that up
dates the text label.
...And 4 more matches
Getting started with Svelte - Learn web development
svelte will watch for file up
dates, and automatically recompile and refresh the app for you when changes are made to the source files.
... at this point you can try updating your app.svelte component — for example change the <h1> element on line 6 of app.svelte so that it reads like this: <h1>hello {name} from mdn!</h1> just save your changes and the app running at localhost:5000 will be automatically up
dated.
... a first look at svelte reactivity in the context of a ui framework, reactivity means that the framework can automatically up
date the dom when the state of any component is changed.
...And 4 more matches
Deploying our app - Learn web development
actually deploying the up
dated code to a live url: or potentially a staging url so it can be reviewed first.
...this unique filename "busts" your browser's cache, thereby making sure the browser downloads the fresh code each time an up
date is made to the deployed code.
...we can commit our code and push to github and the up
dated code will automatically trigger the entire build routine.
...And 4 more matches
Creating a spell check dictionary add-on
this page describes how to package a hunspell spell check dictionary as a firefox add-on, or how to up
date your existing add-on, so that it can be installed, uninstalled and up
dated without a restart.
...if there already is one, try contacting the author to get it up
dated, or contact amo editors if the author does not respond.
...if you up
date an existing dictionary add-on, you must keep the existing em:id, or your users will not be up
dated to the latest version.
...And 4 more matches
Updating NSPR or NSS in mozilla-central
(because some developers might not be aware that nspr/nss are separately maintained and released, the mozilla hg server rejects accidental changes/forking, if the required keywords are missing in the commit comment.) if nspr or nss must be upgraded to a new static tag, follow this procedure: before starting, make sure your local repository is up
dated to mozilla-central tip and that there are no local changes: $ hg status -mard pull the new sources $ python client.py up
date_nspr nspr_tag_name or $ python client.py up
date_nss nss_tag_name if you up
date a branch older than mozilla 17 (without the change from bug 782784), you must manually add a dummy change (add or remove a blank line) to force a rebuild of nspr: mozilla/nsprp...
...if merging is required, up
date the patch file.
... if a patch is no longer needed, remove the patch from the directory and up
date the readme file.
...And 4 more matches
Webapps.jsm
ebapps.jsm"); // exported symbol is domapplicationregistry method overview init: function() loadcurrentregistry: function() notifyappsregistrystart: function notifyappsregistrystart() notifyappsregistryready: function notifyappsregistryready() sanitizeredirects: function sanitizeredirects(asource) _savewidgetsfullpath: function(amanifest, adestapp) appkind: function(aapp, amanifest) up
datepermissionsforapp: function(aid, aispreinstalled) up
dateofflinecacheforapp: function(aid) installpreinstalledapp: function installpreinstalledapp(aid) removeifhttpsduplicate: function(aid) installsystemapps: function() loadandup
dateapps: function() up
datedatastore: function(aid, aorigin, amanifesturl, amanifest) _registersystemmessagesforentrypoint: function(amanifest, aapp, aentrypoint) _...
...registerinterappconnectionsforentrypoint: function(amanifest, aapp,) _registersystemmessages: function(amanifest, aapp) _registerinterappconnections: function(amanifest, aapp) _createactivitiestoregister: function(amanifest, aapp, aentrypoint, arunup
date) _registeractivitiesforapps: function(aappstoregister, arunup
date) _registeractivities: function(amanifest, aapp, arunup
date) _createactivitiestounregister: function(amanifest, aapp, aentrypoint) _unregisteractivitiesforapps: function(aappstounregister) _unregisteractivities: function(amanifest, aapp) _processmanifestforids: function(aids, arunup
date) observe: function(asubject, atopic, adata) addmessagelistener: function(amsgnames, aapp, amm) removemessagelistener: function(amsgnames, amm) formatmessage: function(adata) receivem...
...essage: function(amessage) getappinfo: function getappinfo(aappid) broadcastmessage: function broadcastmessage(amsgname, acontent) registerup
datehandler: function(ahandler) unregisterup
datehandler: function(ahandler) notifyup
datehandlers: function(aapp, amanifest, azippath) _getappdir: function(aid) _writefile: function(apath, adata) dogetlist: function() doexport: function(amsg, amm) doimport: function(amsg, amm) doextractmanifest: function(amsg, amm) dolaunch: function (adata, amm) launch: function launch(amanifesturl, astartpoint, atimestamp, aonsuccess, aonfailure) close: function close(aapp) canceldownload: function canceldownload(amanifesturl, aerror) startofflinecachedownload: function(amanifest, aapp, aprofiledir, aisup
date) computemanifesthash: function(amanifest) up...
...And 4 more matches
XPCOM changes in Gecko 2.0
this article details those changes, and provides suggestions for how to up
date your code.
...documentation will be up
dated as time allows to remove references to interfaces being "frozen" or "unfrozen." component registration the way xpcom components are registered changed in gecko 2.
...all existing xpcom components will need to be up
dated to support this.
...And 4 more matches
nsICRLManager
inherits from: nsisupports last changed in gecko 1.7 method overview wstring computenextautoup
datetime(in nsicrlinfo info, in unsigned long autoup
datetype, in double noofdays); void deletecrl(in unsigned long crlindex); nsiarray getcrls(); void importcrl([array, size_is(length)] in octet data, in unsigned long length, in nsiuri uri, in unsigned long type, in boolean dosilentdownload, in wstring crlkey); void reschedulecrlautoup
date(); boolean up
datecrlfromurl(in wstring url, in wstring key); constants constant value description type_autoup
date_time_based 1 type_autoup
date_freq_based 2 methods computenextautoup
datetime() wstring computenextautoup
datetime( ...
... in nsicrlinfo info, in unsigned long autoup
datetype, in double noofdays ); parameters info autoup
datetype noofdays return value deletecrl() delete the crl.
...void importcrl( [array, size_is(length)] in octet data, in unsigned long length, in nsiuri uri, in unsigned long type, in boolean dosilentdownload, in wstring crlkey ); parameters data length uri type dosilentdownload crlkey reschedulecrlautoup
date() this would reschedule the autoup
date of crls with auto up
date enable.
...And 4 more matches
nsIDOMSimpleGestureEvent
mozmagnifygestureup
date - generated periodically while the user is continuing the magnify ("pinch") gesture.
... the "delta" value represents the movement since the last mozmagnifygesturestart or mozmagnifygestureup
date event.
...if you only want to receive a single event when the magnify gesture is complete, you only need to hook this event and can safely ignore the mozmagnifygesturestart and the mozmagnifygestureup
date events.
...And 4 more matches
nsIDownloadManager
adddownload(in short adownloadtype, in nsiuri asource, in nsiuri atarget, in astring adisplayname, in nsimimeinfo amimeinfo, in prtime astarttime, in nsilocalfile atempfile, in nsicancelable acancelable, in boolean aisprivate); void addlistener(in nsidownloadprogresslistener alistener); void canceldownload(in unsigned long aid); void cleanup(); void endbatchup
date(); obsolete since gecko 1.9.1 void flush(); obsolete since gecko 1.8 nsidownload getdownload(in unsigned long aid); void onclose(); obsolete since gecko 1.9.1 void open(in nsidomwindow aparent, in nsidownload adownload); obsolete since gecko 1.9.1 void openprogressdialogfor(in nsidownload adownload, in nsidomwindow aparent, in boolean acanceldownloado...
...; void removedownload(in unsigned long aid); void removedownloadsbytimeframe(in long long abegintime, in long long aendtime); void removelistener(in nsidownloadprogresslistener alistener); void resumedownload(in unsigned long aid); void retrydownload(in unsigned long aid); void savestate(); obsolete since gecko 1.8 void startbatchup
date(); obsolete since gecko 1.9.1 attributes attribute type description activedownloadcount long the number of files currently being downloaded.
... endbatchup
date() obsolete since gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) indicate that a batch up
date is ending.
...And 4 more matches
nsIWindowMediator
void up
datewindowtimestamp(in nsixulwindow awindow); native code only!
... void up
datewindowtitle(in nsixulwindow awindow, in wstring intitle ); native code only!
...you may need to up
date your code or recompile binary components, if they use this method.
...And 4 more matches
RTCIceProtocol - Web APIs
the webrtc api's rtciceprotocol enumerated type provides a set of domstring values representing the names of the transport protocols ice candi
dates can use.
... these strings are taken directly from the candi
date a-line in sdp.
... values tcp the candi
date, if selected, would use tcp as the transport protocol for its data.
...And 4 more matches
RTCPeerConnection() - Web APIs
rtcconfiguration dictionary bundlepolicy optional specifies how to handle negotiation of candi
dates when the remote peer is not compatible with the sdp bundle standard.
... icecandi
datepoolsize optional an unsigned 16-bit integer value which specifies the size of the prefetched ice candi
date pool.
... the default value is 0 (meaning no candi
date prefetching will occur).
...And 4 more matches
RTCPeerConnection: iceconnectionstatechange event - Web APIs
this can happen when only the last checked candi
date is successful, and the gathering and end-of-candi
dates signals both occur before the successful negotiation is completed.
... state transitions as negotiation ends when the negotiation process runs out of candi
dates to check, the ice connection transitions to one of two states.
... if no suitable candi
dates were found, the state transitions to failed.
...And 4 more matches
Service Worker API - Web APIs
they are intended, among other things, to enable the creation of effective offline experiences, intercept network requests and take appropriate action based on whether the network is available, and up
date assets residing on the server.
... after that, it is up
dated when: a navigation to an in-scope page occurs.
... receiving centralized up
dates to expensive-to-calculate data such as geolocation or gyroscope, so multiple pages can make use of one set of data.
...And 4 more matches
SourceBuffer - Web APIs
sourcebuffer.updating read only a boolean indicating whether the sourcebuffer is currently being up
dated — i.e.
... sourcebuffer.onup
date fired whenever sourcebuffer.appendbuffer() method or the sourcebuffer.remove() completes.
...this event is fired before onup
dateend.
...And 4 more matches
WebGL best practices - Web APIs
avoid invalidating fbo attachment bindings almost any change to an fbo's attachment bindings will invali
date its framebuffer completeness.
...for unchanged vaos, browsers can cache the fetch limits, whereas when vaos change, browsers must revali
date and recalculate limits.
...the cap also must typically be up
dated as the browser window resizes, and older resources above the limit must be purged.
...And 4 more matches
Using the Web Storage API - Web APIs
the landing page provides controls that can be used to customize the color, font, and decorative image: when you choose different options, the page is instantly up
dated; in addition, your choices are stored in localstorage, so that when you leave the page and load it again, later on, your choices are remembered.
... we have also provided an event output page — if you load this page in another tab, then make changes to your choices in the landing page, you'll see the up
dated storage information outputted as a storageevent is fired.
...if there are already values there, we run setstyles() to up
date the page styling with the stored values.
...And 4 more matches
ARIA - Accessibility
for example, aria enables accessible navigation landmarks in html4, javascript widgets, form hints and error messages, live content up
dates, and more.
...the aria-valuemin and aria-valuemax attributes specify the minimum and maximum values for the progress bar, and the aria-valuenow describes the current state of it and therefore must be kept up
dated with javascript.
... along with placing them directly in the markup, aria attributes can be added to the element and up
dated dynamically using javascript code like this: // find the progress bar <div> in the dom.
...And 4 more matches
Backwards Compatibility of Flexbox - CSS: Cascading Style Sheets
the history of flexbox as with all css specifications the flexbox specification went through a large number of changes before it became the candi
date recommendation that we have today.
... as a candi
date recommendation we should not see large changes at this point to the spec, however this has not been the case with past flexbox iterations.
...however, prefixes ultimately were used in production code, and changes to the experimental specification caused people to need to up
date their sites to keep up.
...And 4 more matches
<input type="file"> - HTML: Hypertext Markup Language
lastmodified a number specifying the
date and time at which the file was last modified, in milliseconds since the unix epoch (january 1, 1970 at midnight).
... lastmodified
date a
date object representing the
date and time at which the file was last modified.
... the accept attribute doesn't vali
date the types of the selected files; it simply provides hints for browsers to guide users towards selecting the correct file types.
...And 4 more matches
Intl - JavaScript
the intl object is the namespace for the ecmascript internationalization api, which provides language sensitive string comparison, number formatting, and
date and time formatting.
... intl.
datetimeformat() constructor for objects that enable language-sensitive
date and time formatting.
... this registry is periodically up
dated over time, and implementations may not always be up to
date, so be careful not to rely too much on tags being universally supported.
...And 4 more matches
eval() - JavaScript
bad code with eval(): function loosejsonparse(obj){ return eval("(" + obj + ")"); } console.log(loosejsonparse( "{a:(4-1), b:function(){}, c:new
date()}" )) better code without eval(): function loosejsonparse(obj){ return function('"use strict";return (' + obj + ')')(); } console.log(loosejsonparse( "{a:(4-1), b:function(){}, c:new
date()}" )) comparing the two code snippets above, the two code snippets might seem to work the same way, but think again: the eval() one is a great deal slower.
... notice c: new
date() in the evaluated object.
... in the function without the eval(), the object is being evaluated in the global scope, so it is safe for the browser to assume that
date refers to window.
date() instead of a local variable called
date.
...And 4 more matches
Porting the Library Detector - Archive of obsolete content
it's a very simple add-on and a good candi
date for porting because there are suitable sdk apis for all its features.
... finally, it listens to gbrowser's tabselect event, to up
date the contents of the box for that window.
...ry-detector.js')), onattach: function(worker) { worker.on('message', function(librarylist) { if (!worker.tab.libraries) { worker.tab.libraries = []; } librarylist.foreach(function(library) { if (worker.tab.libraries.indexof(library) == -1) { worker.tab.libraries.push(library); } }); if (worker.tab == tabs.activetab) { up
datewidgetview(worker.tab); } }); } }); the content script is executed once for every window.onload event, so it will run multiple times when a single page containing multiple iframes is loaded.
...And 3 more matches
ui/button/action - Archive of obsolete content
this can be a number or a string, and you can up
date it at any time.
...a disabled button will not generate click events and its icon will appear disabled: updating state you can up
date all the button's properties except for its id.
... by default, the button has global state: that is, its properties are the same across all open windows and tabs, and updating them up
dates the button's state across all open windows and tabs.
...And 3 more matches
Installing Extensions and Themes From Web Pages - Archive of obsolete content
a note on up
dateenabled() installtrigger exposes a function called up
dateenabled that some of you may be calling before you call installtrigger.install.
... this is not necessary as install calls up
dateenabled itself internally.
... furthermore, calling up
dateenabled may lead to problems if your distribution site is not in the user's whitelist, because firefox only displays the "installation blocked" message when install or installchrome are called, or when a xpi file is loaded.
...And 3 more matches
Promises - Archive of obsolete content
let info = yield os.file.stat(configpath); if (info.lastmodification
date <= timestamp) return; timestamp = info.lastmodification
date; // read the file as a utf-8 string, parse as json.
... config.indexstats = processor.stats; yield os.file.writeatomic(configpath, json.stringify(config), { tmppath: configpath + "." + math.random(), encoding: "utf-8" }) timestamp = new
date; }); http requests http requests should, in nearly all circumstances, be made via the standard xmlhttprequest api.
... resp = yield new promise((resolve, reject) => { let xhr = new xmlhttprequest; xhr.onload = resolve; xhr.onerror = reject; xhr.open("post", up
dateurl); xhr.send(form); }); // use the response of the second request.
...And 3 more matches
Adding preferences to an extension - Archive of obsolete content
get the code here: download the sample up
date the manifests the install manifest and chrome manifest need to be up
dated.
...its job is to start up the observer to watch for changes to our preferences, instantiate an object to use to manage our preferences, and install an interval routine to up
date the stock information periodically.
... if the changed preference is "symbol", we grab the up
dated value of the preference by calling the nsiprefbranch.getcharpref() method, and stash it in our tickersymbol variable.
...And 3 more matches
Source code directories overview - Archive of obsolete content
it is a living document which is (supposed to be) up
dated monthly according to changes in the mozilla source tree.
...it has not been up
dated to support xpcom yet.
...the format of the
date and time for different cultures) and other localization facilities.
...And 3 more matches
jspage - Archive of obsolete content
rn d;};native.genericize=function(b,c,a){if((!a||!b[c])&&typeof b.prototype[c]=="function"){b[c]=function(){var d=array.prototype.slice.call(arguments); return b.prototype[c].apply(d.shift(),d);};}};native.implement=function(d,c){for(var b=0,a=d.length;b<a;b++){d[b].implement(c);}};native.typize=function(a,b){if(!a.type){a.type=function(c){return($type(c)===b); };}};(function(){var a={array:array,
date:
date,function:function,number:number,regexp:regexp,string:string};for(var h in a){new native({name:h,initialize:a[h],protect:true}); }var d={"boolean":boolean,"native":native,object:object};for(var c in d){native.typize(d[c],c);}var f={array:["concat","indexof","join","lastindexof","pop","push","reverse","shift","slice","sort","splice","tostring","unshift","valueof"],string:["charat","charcodeat"...
...or(var c in b){var g=b[c],f=e[c];e[c]=(f&&$type(g)=="object"&&$type(f)=="object")?$mixin(f,g):$unlink(g);}}return e;}function $pick(){for(var b=0,a=arguments.length; b<a;b++){if(arguments[b]!=undefined){return arguments[b];}}return null;}function $random(b,a){return math.floor(math.random()*(a-b+1)+b);}function $splat(b){var a=$type(b); return(a)?((a!="array"&&a!="arguments")?[b]:b):[];}var $time=
date.now||function(){return +new
date;};function $try(){for(var b=0,a=arguments.length;b<a; b++){try{return arguments[b]();}catch(c){}}return null;}function $type(a){if(a==undefined){return false;}if(a.$family){return(a.$family.name=="number"&&!isfinite(a))?false:a.$family.name; }if(a.nodename){switch(a.nodetype){case 1:return"element";case 3:return(/\s/).test(a.nodevalue)?"textnode":"whitespace";}}el...
...eturn json.encode(this);}});var cookie=new class({implements:options,options:{path:false,domain:false,duration:false,secure:false,document:document},initialize:function(b,a){this.key=b; this.setoptions(a);},write:function(b){b=encodeuricomponent(b);if(this.options.domain){b+="; domain="+this.options.domain;}if(this.options.path){b+="; path="+this.options.path; }if(this.options.duration){var a=new
date();a.settime(a.gettime()+this.options.duration*24*60*60*1000);b+="; expires="+a.togmtstring();}if(this.options.secure){b+="; secure"; }this.options.document.cookie=this.key+"="+b;return this;},read:function(){var a=this.options.document.cookie.match("(?:^|;)\\s*"+this.key.escaperegexp()+"=([^;]*)"); return(a)?decodeuricomponent(a[1]):null;},dispose:function(){new cookie(this.key,$merge(this.option...
...And 3 more matches
RDF Datasource How-To - Archive of obsolete content
this article is at least partially out
dated.
... help bring it up to
date, if you can.
... the xpcom registration parts and the "as of this writing, it is not currently possible to implement javascript xpcom components" comment seem out
dated didn't check the whole article.
...And 3 more matches
RDF Datasources - Archive of obsolete content
date http://home.netscape.com/nc-rdf#
date date of last visit name http://home.netscape.com/nc-rdf#name title of the page page http://home.netscape.com/nc-rdf#page page name referrer http://home.netscape.com/nc-rdf#referrer referrer of the page url http://home.netscape.com/nc-rdf#url ...
...you can also use the value nc:historyby
date to get the history sorted into days.
...we'll display the history in a tree with three columns, the name, the url and the
date.
...And 3 more matches
Trees and Templates - Archive of obsolete content
the following example uses the history datasource: <tree datasources="rdf:history" ref="nc:historyby
date" flags="dont-build-content"> as described in the previous section, the tree may use a tree builder for template generation instead of the normal content builder.
...example 1 : source <tree id="my-tree" flex="1" datasources="rdf:files" ref="nc:filesroot" flags="dont-build-content"> <treecols> <treecol id="name" label="name" primary="true" flex="1"/> <splitter/> <treecol id="
date" label="
date" flex="1"/> </treecols> <template> <rule> <treechildren> <treeitem uri="rdf:*"> <treerow> <treecell label="rdf:http://home.netscape.com/nc-rdf#name"/> <treecell label="rdf:http://home.netscape.com/web-rdf#lastmodified
date"/> </treerow> </treeitem> </treechildren> </rule> </t...
...emplate> </tree> here, a tree is created with two columns, for the name and
date of a file.
...And 3 more matches
XForms Select1 Element - Archive of obsolete content
xhtml widget characteristics analogous widgets is <html:select/> visual grouping by choices element is supported selection="open" is supported if incremental attribute value is false, the bound node is up
dated when the select1 control is blurred (i.e.
... loses focus), otherwise it is up
dated upon item selection xul widget characteristics analogous widgets are <html:select/> and <xul:menulist/> visual grouping by choices element isn't implemented selection="open" attribute isn't supported if incremental attribute value is false, the bound node is up
dated when the select control is blurred (i.e.
... loses focus), otherwise it is up
dated upon item selection listbox the select1 is represented as listbox (xhtml/xul).
...And 3 more matches
Images in HTML - Learn web development
.a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); var htmlsolution = '<img src="https://udn.realityripple.com/samples/ec/5a13bd14f6.jpg"\n alt="the head and torso of a dinosaur skeleton; it has a large head with long sharp teeth"\n width="200"\n height="171"\n title="a t-rex on display in the manchester university museum">'; var solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(...
...; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // up
date the saved usercode every time the user up
dates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } up
datecode(); }; annotati...
...And 3 more matches
General asynchronous programming concepts - Learn web development
in our simple-sync.html example (see it running live), we add a click event listener to a button so that when clicked, it runs a time-consuming operation (calculates 10 million
dates then logs the final one to the console) and then adds a paragraph to the dom: const btn = document.queryselector('button'); btn.addeventlistener('click', () => { let my
date; for(let i = 0; i < 10000000; i++) { let
date = new
date(); my
date =
date } console.log(my
date); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; docume...
...nt.body.appendchild(pelem); }); when running the example, open your javascript console then click the button — you'll notice that the paragraph does not appear until after the
dates have finished being calculated and the console message has been logged.
...you would never calculate 10 million
dates on a real web app!
...And 3 more matches
Third-party APIs - Learn web development
the app will end up allowing you to type in a search term and optional start and end
dates, which it will then use to query the article search api and display the search results.
...and fetchresults() function definitions, below the previous line: function submitsearch(e) { pagenumber = 0; fetchresults(e); } function fetchresults(e) { // use preventdefault() to stop the form submitting e.preventdefault(); // assemble the full url url = baseurl + '?api-key=' + key + '&page=' + pagenumber + '&q=' + searchterm.value + '&fq=document_type:("article")'; if(start
date.value !== '') { url += '&begin_
date=' + start
date.value; }; if(end
date.value !== '') { url += '&end_
date=' + end
date.value; }; } submitsearch() sets the page number back to 0 to begin with, then calls fetchresults().
... next, we use a couple of if() statements to check whether the start
date and end
date <input>s have had values filled in on them.
...And 3 more matches
Object building practice - Learn web development
updating the ball's data we can draw the ball in position, but to actually move the ball, we need an up
date function of some kind.
... add the following code at the bottom of your javascript file, to add an up
date() method to the ball()'s prototype: ball.prototype.up
date = function() { if ((this.x + this.size) >= width) { this.velx = -(this.velx); } if ((this.x - this.size) <= 0) { this.velx = -(this.velx); } if ((this.y + this.size) >= height) { this.vely = -(this.vely); } if ((this.y - this.size) <= 0) { this.vely = -(this.vely); } this.x += this.velx; this.y += this.vely; } the first four parts of the function check whether the ball has reached the edge of the canvas.
... add the following to the bottom of your code now: function loop() { ctx.fillstyle = 'rgba(0, 0, 0, 0.25)'; ctx.fillrect(0, 0, width, height); for (let i = 0; i < balls.length; i++) { balls[i].draw(); balls[i].up
date(); } requestanimationframe(loop); } all programs that animate things generally involve an animation loop, which serves to up
date the information in the program and then render the resulting view on each frame of the animation; this is the basis for most games and other such programs.
...And 3 more matches
Ember interactivity: Events, classes and state - Learn web development
up
date the content to the following: import component from '@glimmer/component'; import { action } from '@ember/object'; export default class headercomponent extends component { @action onkeydown({ target, key }) { let text = target.value.trim(); let hasvalue = boolean(text); if (key === 'enter' && hasvalue) { alert(text); target.value = '' } } } the @action decor...
...for example, the @tracked decorator (see slightly later on) runs code it is applied to, but additionally tracks it and automatically up
dates the app when values change.
...the only ember-specific part of this class is the @tracked decorator — this hooks in to the reactivity system and allows ember to up
date what you're seeing in your app automatically if the tracked properties change.
...And 3 more matches
Using Vue computed properties - Learn web development
add the described <h2> and up
date the <ul> inside your app's template as follows: <h2 id="list-summary">{{listsummary}}</h2> <ul aria-labelledby="list-summary" class="stack-large"> <li v-for="item in todoitems" :key="item.id"> <to-do-item :label="item.label" :done="item.done" :id="item.id"></to-do-item> </li> </ul> you should now see the list summary in your app, and the total number of items up
date as you add more todo...
... tracking changes to "done" we can use events to capture the checkbox up
date and manage our list accordingly.
... up
date the <input> element in todoitem.vue to look like this.
...And 3 more matches
Creating reftest-based unit tests
another part is testing invalidation - testing that when a document is changed after it has finished loading and displaying, that the browser correctly "invali
dates" the parts of the screen that should change so that the screen displays the correct output the next time it is repainted.
... invalidation tests check both that the internal state of the document has been up
dated correctly, and that the browser then correctly invali
dates and repaints the appropriate parts of the screen.
...next you need to add a listener for the 'mozreftestinvali
date' event, and only make the changes you want to test invalidation for after that event has fired.
...And 3 more matches
Displaying Places information using views
when a view's underlying data changes, the view will automatically up
date itself so that it displays the new data.
... this up
date is handled by logic between the view and its results.
... the following table shows the mappings between these magic column id values and their corresponding nsinavhistoryresultnode properties: treecol id or anonid corresponding nsinavhistoryresultnode property title title url uri
date time visitcount accesscount keyword * description *
dateadded
dateadded lastmodified lastmodified tags tags ** icon *keyword and description are looked up in the places database using the nsinavhistoryresultnode property itemid.
...And 3 more matches
Localizing with Koala
owing commands: c:\users\stas> cd c:\mozilla\l10n\application\firefox c:\mozilla\l10n\application\firefox> rmdir 3.6 c:\mozilla\l10n\application\firefox> hg clone http://hg.mozilla.org/releases/mozilla-1.9.2 3.6 requesting all changes adding changesets adding manifests adding file changes added 33099 changesets with 158636 changes to 50664 files (+9 heads) updating working directory 40357 files up
dated, 0 files merged, 0 files removed, 0 files unresolved configure the locale locale id: x-testing (put your locale's code) version: 3.6 location: choose the folder where you want to keep the localized files or leave empty for now check "mercurial" if you wish to use mercurial to keep the revision history of your files (very recommended) existing localizations: url: if you're editing an existi...
...to make sure you're always translating the most recent en-us reference, you should up
date the source repository before you start working.
...in "last used compares" click "up
date repo" to up
date the en-us repository to the most recent version.
...And 3 more matches
Localizing with Mercurial
if the utility modified your %path% successfully, a dialog will open saying, "%path% has been up
dated correctly." alternatively, you can edit the %path% variable manually.
...for example, to clone your firefox nightly l10n repo, run the following command, replacing ab-cd with your locale code: hg clone https://hg.mozilla.org/l10n-central/ab-cd/ updating your local repos to up
date your working copy of mozilla-central, go to your local mozilla-central directory and run: hg pull -u this will both get new changesets from mozilla-central and apply those changes in your working copy.
... to up
date your working copy of comm-central, go to your comm-central directory and run: python client.py checkout this will both get new changesets from comm-central, mozilla-central and the other appropriate locations and apply those changes in your working copy.
...And 3 more matches
Localizing with Mozilla Translator
getting started with mozillatranslator mt uses products as groups of localization files with a common root directory (for instance, you may have a product for thunderbird, other for seamonkey, other for dom, other for toolkit, etc.) you up
date your repository copy using your favorite repository tool, and then up
date the product(s) in mt.
... this will remove obsolete strings and files from the internal database of mt, and will present you with a list of new and up
dated strings.
... if you are starting a new localization, all strings will be marked as new or up
dated.mt puts a fuzzy flag on each flag and saves it in its database.
...And 3 more matches
Localization formats
how often, if at all, the site will be up
dated after the launch?
... is this a long-term project with continuous up
dates to content?
... html/php maybe you are designing a project that has relatively small translation needs like three to four lines (or more) of content asking users to up
date to the next version of software available.
...And 3 more matches
NSS 3.35 release notes
nss 3.35 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_35_rtm/src/ new in nss 3.35 new functionality tls 1.3 support has been up
dated to draft -23.
...cn = chambers of commerce root sha-256 fingerprint: 0c:25:8a:12:a5:67:4a:ef:25:f2:8b:a7:dc:fa:ec:ee:a3:48:e5:41:e6:f5:cc:4e:e6:3b:71:b3:61:60:6a:c3 cn = global chambersign root sha-256 fingerprint: ef:3c:b4:17:fc:8e:bf:6f:97:87:6c:9e:4e:ce:39:de:1e:a5:fe:64:91:41:d1:02:8b:7d:11:c0:b2:29:8c:ed significant changes to tls 1.3 were made, along with the up
date from draft -18 to draft -23: support for keyup
date was added.
... keyup
date will be used automatically, if a cipher is used for a sufficient number of records.
...And 3 more matches
NSS 3.52 release notes
notable changes in nss 3.52 bug 1603628 - up
date nss to support pkcs #11 v3.0.
... bug 1626751 - fix error in generation of fuzz32 docker image after up
dates.
... bug 1619056 - up
date readme: tls 1.3 is not experimental anymore.
...And 3 more matches
Notes on TLS - SSL 3.0 Intolerant Servers
for up-to-
date information, you can read a bugzilla bug report which keeps track of this problem with mozilla-based browsers.
...) domino-go-webserver/4.6.2.6 (and perhaps some later versions) ibm_http_server/1.3.6.3 or earlier (* up
date to 1.3.6.4) ibm_http_server/1.3.12.1 or earlier (* up
date to 1.3.12.2) java web server 2 osu/3.2 - decthreads http server for openvm stronghold/2.2 webmail v.
... 3.6.1 by infinite technologies (* up
date available) n.b.
...And 3 more matches
GCIntegration - SpiderMonkey Redirect 1
every time a pointer is up
dated, a small amount of code runs that may mark one of the objects involved in the up
date.
...any time a property is up
dated in the vm or the jit, a write barrier is invoked.
...for example, the following code will be incorrect: autorootedobject obj1 = ...; jsobject *obj2 = obj1; // use obj2 if a gc runs in the middle of this code, and if obj1/obj2 is moved, then the obj1 pointer will be up
dated to point to the new location.
...And 3 more matches
Hacking Tips
$ valgrind --smc-check=all-non-file --vex-iropt-register-up
dates=allregs-at-mem-access --vgdb-error=0 ./js … this command will tell you how to start gdb as a remote.
...(2 locations) (gdb) dprintf ion.cpp:3196, "invali
date %s:%d:%d-%d\n", co->script_->scriptsource()->filename_.mtuple.mfirsta, co->script_->lineno_, co->script_->sourcestart_, co->script_->sourceend_ dprintf 3 at 0x7fb4f6a0b62a: file /home/nicolas/mozilla/contrib-push/js/src/jit/ion.cpp, line 3196.
... (gdb) continue compiling self-hosted:650:20470-21501 bailout from self-hosted:20:403-500 invali
date self-hosted:20:403-500 note: the line 3196, listed above, corresponds to the location of the jit spew inside jit::invali
date function.
...And 3 more matches
SpiderMonkey 1.8.5
note that version 1.8.5 is out
dated.
...embeddings that defined jsnatives in previous versions must up
date all those functions to the new signature.
... the type of setters has changed from jspropertyop to jsstrictpropertyop (to accomo
date es5 strict mode).
...And 3 more matches
Mozilla Projects
mccoy is an application that allows add-on authors to provide secure up
dates to their users.
... applications periodically look for and install up
dates to their add-ons.
... it's important that the up
date information retrieved has not been tampered with since being written by the add-on author.
...And 3 more matches
History Service Design
the user can query his visits based on a
date range, meta contents or revisit behavior.
...old history system was instead only storing first and last visit
date, and a generic visits counter, creating some problem due to the impossibility to represent real history flow in a timeframe.
...for example, is possible to create a query folder containing the 10 pages most visited by the user, allowing to fast find good candi
dates for bookmarking.
...And 3 more matches
Querying Places
the visit
date for each node will be the last visit
date for that url.
...the result may contain duplicate entries for urls, each with a different
date.
...te unsigned long foldercount basic query configuration options const unsigned short group_by_day = 0 const unsigned short group_by_host = 1 const unsigned short group_by_domain = 2 const unsigned short group_by_folder = 3 const unsigned short sort_by_none = 0 const unsigned short sort_by_title_ascending = 1 const unsigned short sort_by_title_descending = 2 const unsigned short sort_by_
date_ascending = 3 const unsigned short sort_by_
date_descending = 4 const unsigned short sort_by_uri_ascending = 5 const unsigned short sort_by_uri_descending = 6 const unsigned short sort_by_visitcount_ascending = 7 const unsigned short sort_by_visitcount_descending = 8 const unsigned short sort_by_keyword_ascending = 9 const unsigned short sort_by_keyword_descending = 10 const unsigned short...
...And 3 more matches
Using the Places history service
this entry contained the url, title, visit count, last visit
date, first visit
date, host name, last referrer, flags for typed, hidden, and gecko flags (gecko flags is trunk only).
...a visit contains a reference to the url table for the page, the visit
date, the transition type (typed, click, redirect, bookmark, etc.), a reference to the referring visit, and the session id.
... nsinavhistoryservice.beginup
datebatch: call when you will be making many small changes to the history system.
...And 3 more matches
nsIAccessibleTreeCache
last changed in gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) inherits from: nsisupports method overview nsiaccessible getcachedtreeitemaccessible(in long arow, in nsitreecolumn acolumn); void invali
datecache(in long arow, in long acount); void treeviewchanged(); void treeviewinvali
dated(in long astartrow, in long aendrow, in long astartcol, in long aendcol); methods getcachedtreeitemaccessible() returns the tree item from the cache for the cell in the specified row and column; the nsiaccessible is created if it doesn't already exist in the cache.
...invali
datecache() invali
dates the number of cached treeitem accessibles.
... void invali
datecache( in long arow, in long acount ); parameters arow row index the invalidation starts from.
...And 3 more matches
nsICache
access_read_write 3 access requested - i want to read, but i'm willing to up
date an existing entry if necessary, or create a new one if none exists.
...if a cache entry is waiting to be vali
dated by another cache descriptor (so no new cache descriptors for that key can be created), opencacheentry() will return ns_error_cache_wait_for_validation in non-blocking mode.
... if the cache entry is vali
dated, then a descriptor for that entry will be created and returned.
...And 3 more matches
nsIMsgDBView
ordervalue sortorder, in nsmsgviewflagstypevalue viewflags, out long count); void openwithhdrs(in nsisimpleenumerator aheaders, in nsmsgviewsorttypevalue asorttype, in nsmsgviewsortordervalue asortorder, in nsmsgviewflagstypevalue aviewflags, out long acount); void close(); void init(in nsimessenger amessengerinstance, in nsimsgwindow amsgwindow, in nsimsgdbviewcommandup
dater acommandup
dater); void sort(in nsmsgviewsorttypevalue sorttype, in nsmsgviewsortordervalue sortorder); void docommand(in nsmsgviewcommandtypevalue command); void docommandwithfolder(in nsmsgviewcommandtypevalue command, in nsimsgfolder destfolder); void getcommandstatus(in nsmsgviewcommandtypevalue command, out boolean selectable_p, out nsmsgviewcommandcheckst...
...smsgnavigationtypevalue motion); nsmsgkey getkeyat(in nsmsgviewindex index); nsimsgdbhdr getmsghdrat(in nsmsgviewindex index); nsimsgfolder getfolderforviewindex(in nsmsgviewindex index); acstring geturiforviewindex(in nsmsgviewindex index); nsimsgdbview clonedbview(in nsimessenger amessengerinstance, in nsimsgwindow amsgwindow, in nsimsgdbviewcommandup
dater acommandup
dater); void geturisforselection([array, size_is(count)] out string uris, out unsigned long count); void getindicesforselection([array, size_is(count)] out nsmsgviewindex indices, out unsigned long count); void loadmessagebymsgkey(in nsmsgkey amsgkey); void loadmessagebyviewindex(in nsmsgviewindex aindex); void loadmessagebyurl(in string aur...
...author,
date, status, etc).
...And 3 more matches
nsIMsgFolder
this page is out of
date.
... inherits from: nsisupports method overview void startfolderloading(); void endfolderloading(); void up
datefolder(in nsimsgwindow awindow); nsimsgfilterlist getfilterlist(in nsimsgwindow msgwindow); void setfilterlist(in nsimsgfilterlist filterlist); void forcedbclosed(); void delete(); void deletesubfolders(in nsisupportsarray folders, in nsimsgwindow msgwindow); void propagatedelete(in nsimsgfolder folder, in boolean deletestorage,in nsimsgwindow msgwindow); void recursivedelete(in boolean deletestorage, in nsimsgwindow msgwindow); void createsubfolder...
...w amsgwindow,in nsisupportsarray aofflinefolderarray); void emptytrash(in nsimsgwindow amsgwindow, in nsiurllistener alistener); void rename(in astring name, in nsimsgwindow msgwindow); void renamesubfolders( in nsimsgwindow msgwindow, in nsimsgfolder oldfolder); astring generateuniquesubfoldername(in astring prefix,in nsimsgfolder otherfolder); void up
datesummarytotals(in boolean force); void summarychanged(); long getnumunread(in boolean deep); long gettotalmessages(in boolean deep); void clearnewmessages(); void clearrequirescleanup(); void setflag(in unsigned long flag); void clearflag(in unsigned long flag); boolean getflag(in unsigned long flag); void toggleflag(i...
...And 3 more matches
nsIRequest
by default, cached content is automatically vali
dated if necessary before reuse.
... note: these flags are intended for normal browsing, and they should therefore not apply to content that must be vali
dated before each use.
...according to rfc2616, this response must be vali
dated before it can be taken from a cache.
...And 3 more matches
nsISelectionPrivate
inherits from: nsisupports last changed in gecko 35 (firefox 35 / thunderbird 35 / seamonkey 2.32) warning: the content of this article may be out of
date.
... this page wasn't up
dated since the initial import in 2011.
... see the idl file linked above for up-to-
date information.
...And 3 more matches
Index
the thunderbird team can up
date this content via the website at any time.
... 79 building a thunderbird extension 6: adding javascript in this step we will create a small piece of javascript code that inserts the current
date into our statusbar widget.
...in addition mozilla up
date allows users to comment and provide feedback on your extension.
...And 3 more matches
WebIDL bindings
webidl type argument type return type dictionary/member type any js::handle<js::value> js::mutablehandle<js::value> js::value boolean bool bool bool byte int8_t int8_t int8_t bytestring const nsacstring& nscstring& (outparam) nsacstring& (outparam) nscstring
date mozilla::dom::
date domstring const nsastring& mozilla::dom::domstring& (outparam) nsastring& (outparam) nsstring& (outparam) nsstring utf8string const nsacstring& nsacstring& (outparam) nscstring double double double double float float float float interface: non-nullable foo& already_addrefed...
...
date webidl
date types are represented by a mozilla::dom::
date struct.
...this allows the binding code to change the exact definition (e.g., to use auto arrays of different sizes and so forth) without having to up
date all the callees.
...And 3 more matches
Waterfall - Firefox Developer Tools
rendering waterfall one pattern that you'll often see in the waterfall view is something like this: this is a visualization of the basic algorithm the browser uses to up
date the page in response to some event: javascript function call: some event - for example, a dom event - causes some javascript in the page to run.
... this sequence needs to fit into a single frame, since the screen isn't up
dated until it is complete.
... importantly for responsiveness, the browser doesn't always have to go through every step: css animations up
date the page without having to run any javascript.
...And 3 more matches
Validators - Firefox Developer Tools
this document lists different resources for developers to vali
date web pages.
... w3c html validator the w3c html validator will vali
date any web page according to the w3c html standards.
... w3c css validator the w3c css validator will vali
date the css within any web page or external css files according to the w3c css standards.
...And 3 more matches
Basic animations - Web APIs
scheduled up
dates first there's the window.setinterval(), window.settimeout(), and window.requestanimationframe() functions, which can be used to call a specific function over a set period of time.
... requestanimationframe(callback) tells the browser that you wish to perform an animation and requests that the browser call a specified function to up
date an animation before the next repaint.
...nvas_earth.png'; window.requestanimationframe(draw); } function draw() { var ctx = document.getelementbyid('canvas').getcontext('2d'); ctx.globalcompositeoperation = 'destination-over'; ctx.clearrect(0, 0, 300, 300); // clear canvas ctx.fillstyle = 'rgba(0, 0, 0, 0.4)'; ctx.strokestyle = 'rgba(0, 153, 255, 0.4)'; ctx.save(); ctx.translate(150, 150); // earth var time = new
date(); ctx.rotate(((2 * math.pi) / 60) * time.getseconds() + ((2 * math.pi) / 60000) * time.getmilliseconds()); ctx.translate(105, 0); ctx.fillrect(0, -12, 40, 24); // shadow ctx.drawimage(earth, -12, -12); // moon ctx.save(); ctx.rotate(((2 * math.pi) / 6) * time.getseconds() + ((2 * math.pi) / 6000) * time.getmilliseconds()); ctx.translate(0, 28.5); ctx.drawimage(moon, -3.5, -3.5...
...And 3 more matches
Document.cookie - Web APIs
note that each key and value may be surrounded by whitespace (space and tab characters): in fact, rfc 6265 man
dates a single space after each semicolon, but some user agents may not abide by this.
...note that you can only set/up
date a single cookie at a time using this method.
... consider also that: any of the following cookie attribute values can optionally follow the key-value pair, specifying the cookie to set/up
date, and preceded by a semi-colon separator: ;path=path (e.g., '/', '/mydir') if not specified, defaults to the current path of the current document location.
...And 3 more matches
Document.lastModified - Web APIs
the lastmodified property of the document interface returns a string containing the
date and time on which the current document was last modified.
... alert(document.lastmodified); // returns: tuesday, december 16, 2017 11:09:42 transforming lastmodified into a
date object this example transforms lastmodified into a
date object.
... let olastmodif = new
date(document.lastmodified); transforming lastmodified into milliseconds this example transforms lastmodified into the number of milliseconds since january 1, 1970, 00:00:00, local time.
...And 3 more matches
Using the Gamepad API - Web APIs
timestamp: this returns a domhighrestimestamp representing the last time the data for this gamepad was up
dated, allowing developers to determine if the axes and button data have been up
dated from the hardware.
...values are monotonically increasing, meaning that they can be compared to determine the ordering of up
dates, as newer values will always be greater than or equal to older values.
...behind the scenes, this object will be up
dated every time the gamepad's state changes.
...And 3 more matches
HTMLFieldSetElement - Web APIs
this is the empty string if the element is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... htmlfieldsetelement.willvali
date a boolean false, because <fieldset> objects are never candi
dates for constraint validation.
... htmlfieldsetelement.checkvalidity() always returns true because <fieldset> objects are never candi
dates for constraint validation.
...And 3 more matches
HTMLTextAreaElement - Web APIs
this is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... willvali
date read only boolean: returns whether the element is a candi
date for constraint validation.
... checkvalidity() returns false if the element is a candi
date for constraint validation, and it does not satisfy its constraints.
...And 3 more matches
Basic concepts - Web APIs
the only place where the schema of the database can be up
dated is inside the handler of that event.
... note: this definition describes the most recent specification, which is only implemented in up-to-
date browsers.
...the records in an index are automatically populated whenever records in the referenced object store are inserted, up
dated, or deleted.
...And 3 more matches
Online and offline events - Web APIs
this property is up
dated whenever the user switches into "offline mode" by selecting the corresponding menu item (file -> work offline in firefox).
... additionally, this property should up
date whenever a browser is no longer capable of connecting to the network.
... firefox 2 up
dates this property when switching to/from the browser's offline mode.
...And 3 more matches
Payment Request API - Web APIs
paymentrequestup
dateevent enables the web page to up
date the details of the payment request in response to a user action.
... merchantvalidationevent represents the browser requiring the merchant (website) to vali
date themselves as allowed to use a particular payment handler (e.g., registered as allowed to use apple pay).
... paymentdetailsup
date an object describing changes that need to be made to the payment details in the event that the server needs to up
date information following the instantiation of the payment interface but before the user begins to interact with it.
...And 3 more matches
Multi-touch interaction - Web APIs
see the up
date_background function for more details about the color changes.
... // save this event for later processing (this could be part of a // multi-touch interaction) and up
date the background color push_event(ev); if (logevents) log("pointerdown: name = " + ev.target.id, ev); up
date_background(ev); } pointer move the pointermove handler is called when the pointer moves.
... if (logevents) log("pointermove", ev); up
date_background(ev); ev.target.style.border = "dashed"; } pointer up the pointerup event is fired when a pointer is raised from the contact surface.
...And 3 more matches
RTCPeerConnectionIceEvent() - Web APIs
syntax var event = new rtcpeerconnectioniceevent(type, options); parameters type is a domstring containing the name of the event, like "icecandi
date".
... options a dictionary of type rtcpeerconnectioninit, which may contain one or more of the following fields: "candi
date" (optional, default is null): a rtcicecandi
date representing the ice candi
date being concerned by the event.
... if null, the event indicates the end of candi
date gathering.
...And 3 more matches
RTCPeerConnectionIceEvent - Web APIs
the rtcpeerconnectioniceevent interface represents events that occurs in relation to ice candi
dates with the target, usually an rtcpeerconnection.
... only one event is of this type: icecandi
date.
... rtcpeerconnectioniceevent.candi
date read only contains the rtcicecandi
date containing the candi
date associated with the event, or null if this event indicates that there are no further candi
dates to come.
...And 3 more matches
RTCStatsReport - Web APIs
the statistic category names are members of the enumerated type rtcstatstype, as follows: candi
date-pair an rtcicecandi
datepairstats object providing statistics related to an rtcicetransport.
... candi
date pairs other than the currently active pair for the transport are deleted when the rtcpeerconnection changes its rtcpeerconnection.icegatheringstate to new during an ice restart.
... the active candi
date pair is deleted after the transport switches to another candi
date pair; this change cannot be detected otherwise.
...And 3 more matches
RTCStatsType - Web APIs
values candi
date-pair an rtcicecandi
datepairstats object providing statistics related to an rtcicetransport.
... candi
date pairs other than the currently active pair for the transport are deleted when the rtcpeerconnection changes its rtcpeerconnection.icegatheringstate to new during an ice restart.
... the active candi
date pair is deleted after the transport switches to another candi
date pair; this change cannot be detected otherwise.
...And 3 more matches
Basic scissoring - Web APIs
although the clear() drawing command writes the clear color (set by clearcolor()) to all pixels in the drawing buffer, scissor() defines a mask that only allows pixels inside the specified rectangular area to be up
dated.
...in other cases, the fragments may be discarded altogether (so the pixel value is not up
dated), or it may interact with the already existing pixel value (such as when doing color blending for non-opaque elements in the scene).
...before the actual pixels are up
dated, fragments must go through the scissor test.
...And 3 more matches
Animating textures in WebGL - Web APIs
getting access to the video the first step is to create the <video> element that we'll use to retrieve the video frames: // will set to true when video can be copied to texture var copyvideo = false; function setupvideo(url) { const video = document.createelement('video'); var playing = false; var timeup
date = false; video.autoplay = true; video.muted = true; video.loop = true; // waiting for these 2 events ensures // there is data in the video video.addeventlistener('playing', function() { playing = true; checkready(); }, true); video.addeventlistener('timeup
date', function() { timeup
date = true; checkready(); }, true); video.src = url; video.play(); ...
... function checkready() { if (playing && timeup
date) { copyvideo = true; } } return video; } first we create a video element.
...we then set up two events to make sure the video is playing and the time has been up
dated.
...And 3 more matches
Using the Web Animations API - Web APIs
if your keyframe list has only one entry, element.animate() may throw a notsupportederror exception in some browsers until they are up
dated.
...terations (by default, animations iterate once), we could pass in the milliseconds alone: document.getelementbyid("alice").animate( [ { transform: 'rotate(0) translate3d(-50%, -50%, 0)', color: '#000' }, { color: '#431236', offset: 0.3}, { transform: 'rotate(360deg) translate3d(-50%, -50%, 0)', color: '#000' } ], 3000); controlling playback with play(), pause(), reverse(), and up
dateplaybackrate() while we can write css animations with the web animations api, where the api really comes in handy is manipulating the animation’s playback.
...we use up
dateplaybackrate() instead of setting the playbackrate directly since that produces a smooth up
date: setinterval( function() { // make sure the playback rate never falls below .4 if (redqueen_alice.playbackrate > .4) { redqueen_alice.up
dateplaybackrate(redqueen_alice.playbackrate * .9); } }, 3000); but urging them on by clicking or tapping causes them to speed up by multiplying their pla...
...And 3 more matches
Web audio spatialization basics - Web APIs
s transforms let transform = { xaxis: 0, yaxis: 0, zaxis: 0.8, rotatex: 0, rotatey: 0 } // set our bounds const topbound = -posy; const bottombound = posy; const rightbound = posx; const leftbound = -posx; const innerbound = 0.1; const outerbound = 1.5; let's create a function that takes the direction we want to move as a parameter, and both modifies the css transform and up
dates the position and orientation values of our panner node properties to change the sound as appropriate.
...we'll move the boombox along these axis and up
date the appropriate position.
...not only do we have to up
date two axis values (e.g.
...And 3 more matches
Creating a cross-browser video player - Developer guides
the span within the <progress> element is for browsers that do not support the progress element and will be up
dated at the same time as progress (this span element won't be visible on browsers that support progress).
... another event, timeup
date, is raised periodically as the video is being played through.
... video.addeventlistener('timeup
date', function() { progress.value = video.currenttime; progressbar.style.width = math.floor((video.currenttime / video.duration) * 100) + '%'; }); as the timeup
date event is raised, the progress element's value attribute is set to the video's currenttime.
...And 3 more matches
Mouse gesture events - Developer guides
mozmagnifygestureup
date the mozmagnifygestureup
date event is sent periodically while processing a magnify gesture, to provide up
dated status information.
... the event's delta value represents the amount by which the gesture has moved since the mozmagnifygesturestart or mozmagnifygestureup
date event.
...if you only care about the end results of the pinch gesture, you can simply watch for this event; however, if you want to provide feedback during the handling of the gesture, you should also watch the mozmagnifygesturestart and mozmagnifygestureup
date events.
...And 3 more matches
Making content editable - Developer guides
as of firefox 60, firefox will be up
dated to wrap the separate lines in <div> elements, matching the behavior of chrome, modern opera, edge, and safari.
...this is useful if your web application expects the older firefox behavior, and you don't want to or don't have the time to up
date it to use the new behavior.
...board.paste", "allaccess"); example: a simple but complete rich text editor <!doctype html> <html> <head> <title>rich text editor</title> <script type="text/javascript"> var odoc, sdeftxt; function initdoc() { odoc = document.getelementbyid("textbox"); sdeftxt = odoc.innerhtml; if (document.compform.switchmode.checked) { setdocmode(true); } } function formatdoc(scmd, svalue) { if (vali
datemode()) { document.execcommand(scmd, false, svalue); odoc.focus(); } } function vali
datemode() { if (!document.compform.switchmode.checked) { return true ; } alert("uncheck \"show html\"."); odoc.focus(); return false; } function setdocmode(btosource) { var ocontent; if (btosource) { ocontent = document.createtextnode(odoc.innerhtml); odoc.innerhtml = ""; var opre = docum...
...And 3 more matches
HTML attribute reference - HTML: Hypertext Markup Language
datetime <del>, <ins>, <time> indicates the
date and time associated with the element.
... formnovali
date <button>, <input> if the button/input is a submit button (type="submit"), this boolean attribute specifies that the form is not to be vali
dated when it is submitted.
... if this attribute is specified, it overrides the novali
date attribute of the button's form owner.
...And 3 more matches
<input type="email"> - HTML: Hypertext Markup Language
the input value is automatically vali
dated to ensure that it's either empty or a properly-formatted e-mail address (or list of addresses) before the form can be submitted.
...presenting an e-mail address, or empty events change and input supported common attributes autocomplete, list, maxlength, minlength, multiple, name,pattern, placeholder, readonly, required, size, and type idl attributes list and value methods select() value the <input> element's value attribute contains a domstring which is automatically vali
dated as conforming to e-mail syntax.
... see validation for details on how e-mail addresses are vali
dated to ensure that they're formatted properly.
...And 3 more matches
<input type="hidden"> - HTML: Hypertext Markup Language
tracking edited content one of the most common uses for hidden inputs is to keep track of what database record needs to be up
dated when an edit form is submitted.
... after editing, the user submits the form, and the up
dated data is sent back to the server to be up
dated in the database.
... the idea here is that during step 2, the id of the record being up
dated is kept in a hidden input.
...And 3 more matches
<input type="image"> - HTML: Hypertext Markup Language
supported common attributes alt, src, width, height, formaction, formenctype, formmethod, formnovali
date, formtarget idl attributes none.
...s, image button inputs support the following attributes: attribute description alt alternate string to display when the image can't be shown formaction the url to which to submit the data formenctype the encoding method to use when submitting the form data formmethod the http method to use when submitting the form formnovali
date a boolean which, if present, indicates that the form shouldn't be vali
dated before submission formtarget a string indicating a browsing context from where to load the results of submitting the form height the height, in css pixels, at which to draw the image src the url from which to load the image width the width, in css pixels, at which to draw...
... formnovali
date a boolean attribute which, if present, specifies that the form should not be vali
dated before submission to the server.
...And 3 more matches
<input type="url"> - HTML: Hypertext Markup Language
the input value is automatically vali
dated to ensure that it's either empty or a properly-formatted url before the form can be submitted.
... value the <input> element's value attribute contains a domstring which is automatically vali
dated as conforming to url syntax.
... see validation for details on how urls are vali
dated to ensure that they're formatted properly.
...And 3 more matches
<input type="week"> - HTML: Hypertext Markup Language
value a domstring representing a week and year, or empty events change and input supported common attributes autocomplete, list, readonly, and step idl attributes value, valueas
date, valueasnumber, and list.
...the format of the
date and time value used by this input type is described in format of a valid week string in
date and time formats used in html.
...this will be up
dated as soon as that information is determined.
...And 3 more matches
Warning - HTTP
note: the warning header is soon to be deprecated; see warning (https://github.com/httpwg/http-core/issues/139) and warning: header & stale-while-revali
date (https://github.com/whatwg/fetch/issues/913) for more details.
... header type general header forbidden header name no syntax warning: <warn-code> <warn-agent> <warn-text> [<warn-
date>] directives <warn-code> a three-digit warning number.
... <warn-
date> optional.
...And 3 more matches
Proxy Auto-Configuration (PAC) file - HTTP
ment these functions can be used in building the pac file: hostname based conditions isplainhostname() dnsdomainis() localhostordomainis() isresolvable() isinnet() related utility functions dnsresolve() convert_addr() myipaddress() dnsdomainlevels() url/hostname based conditions shexpmatch() time based conditions weekdayrange()
daterange() timerange() logging utility alert() there was one associative array (object) already defined, because at the time javascript code was unable to define it by itself: proxyconfig.bindings note: pactester (part of the pacparser package) was used to test the following syntax examples.
... // returns true monday through friday (local timezone) weekdayrange("mon", "fri", "gmt"); // returns true monday through friday (gmt timezone) weekdayrange("sat"); // returns true on saturdays local time weekdayrange("sat", "gmt"); // returns true on saturdays gmt time weekdayrange("fri", "mon"); // returns true friday and monday only (note, order does matter!)
daterange() syntax
daterange(<day> | <month> | <year>, [gmt]) // ambiguity is resolved by assuming year is greater than 31
daterange(<day1>, <day2>, [gmt])
daterange(<month1>, <month2>, [gmt])
daterange(<year1>, <year2>, [gmt])
daterange(<day1>, <month1>, <day2>, <month2>, [gmt])
daterange(<month1>, <year1>, <month2>, <year2>, [gmt])
daterange(<day1>, <month1>, <year1>, <day2>, <month2>, <year2>, [...
... the order of the days, months, and years matter; before firefox 49,
daterange("jan", "dec") will always evaluate to true.
...And 3 more matches
Codecs used by WebRTC - Web media technologies
which codecs can be within those tracks is not man
dated by the webrtc specification.
... supported audio codecs the audio codecs which rfc 7874 man
dates that all webrtc-compatible browsers must support are shown in the table below.
...neither g.711.0 (lossless compression), g.711.1 (wideband capability), nor any other extensions to the g.711 standard are man
dated by webrtc.
...And 3 more matches
Communication between HTML and your extension - Archive of obsolete content
what i wanted to do was have an extension "look" for something on an html page and if it found that something perform some operation on the found thing and then up
date the status bar with the results of the operation.
...the onreadystatechange was set to another little javascript function that would up
date a specific element on the html page with the result.
...i wasn't sure about the difference between the capture or bubbling flag that you pass to addeventlistener but every time i would catch the event in the extension, the element from the ajax request wasn't fully up
dated into the html page.
...And 2 more matches
Creating a dynamic status bar extension - Archive of obsolete content
or, if you've already got the code from the creating a status bar extension sample, you can follow this tutorial to up
date that existing code with new features.
... download the sample up
date the install manifest replace all occurrences of the first sample's id, "status-bar-sample-1", with the new sample's id, "stockwatcher", and up
date the front end metadata to describe our new extension.
...up
date the chrome manifest the chrome manifest needs only a minor up
date from the previous sample; simply replace the id of the first sample, "status-bar-sample-1", with the name of the new sample, "stockwatcher".
...And 2 more matches
Enabling the behavior - retrieving tinderbox status - Archive of obsolete content
var gxmlhttprequest; function loadtinderboxstatus() { gxmlhttprequest = new xmlhttprequest(); gxmlhttprequest.onload = up
datetinderboxstatus; gxmlhttprequest.open("get", "http://tinderbox.mozilla.org/seamonkey/panel.html"); gxmlhttprequest.send(null); } xmlhttprequest is an interface in mozilla for retrieving documents via http.
...that document gets up
dated by the tinderbox server every time a build finishes.
...we use new to create a new instance of it, set the instance's onload property to up
datetinderboxstatus(), the function we want to execute when the document finishes loading, call its open method with the type of http request we want to make and the url of the document to retrieve, and then call its send method to send the request.
...And 2 more matches
Mozilla Crypto FAQ - Archive of obsolete content
i've up
dated this version of the mozilla crypto faq to discuss the situation now that the rsa public key algorithm is in the public domain and a full open source crypto implementation is being added to the mozilla code base.
...department of commerce press release announcing the new regulations as well as the up
dated regulations (pdf) themselves.
...for the statement by the bureau of export administration on notification requirements for mirror sites, see the section "notification requirements" in the bernstein advisory opinion contained in the letter
dated february 17, 2000, from james lewis of bxa to cindy cohn, counsel for daniel bernstein.
...And 2 more matches
Standalone XPCOM - Archive of obsolete content
warning: the content of this article may be out of
date.
... these instructions were last up
dated in 2000.
... get xpcom/tests directory upto
date and documented.
...And 2 more matches
XUL Events - Archive of obsolete content
the event handler should be placed on an observer.checkboxstatechangethe checkboxstatechange event is executed when the state of a <checkbox> element has changed.closethe close event is executed when a request has been made to close the window when the user presses the close button.commandthe command event is executed when an element is activated.commandup
datethe commandup
date event is executed when a command up
date occurs on a <commandset>.
... this event would be used to up
date the disabled status of its commands.dommenuitemactivethe dommenuitemactive event is executed when a <menu> or a <menuitem> has been hovered or highlighted.dommenuiteminactivethe dommenuiteminactive event is executed when a <menu> or a <menuitem> in no longer hovered or highlighted.popuphiddenthe popuphidden event is executed when a <menupopup>, <panel> or <tooltip> has become hidden.popuphidingthe popuphiding event is executed when a <menupopup>, <panel> or <tooltip> is about to be hidden.popupshowingthe popupshowing event is executed when a <menupopup>, <panel> or <tooltip> is about to become visible.
... attribute: oncommand commandup
date this event occurs when a command up
date occurs on a <commandset> element.
...And 2 more matches
RDF Modifications - Archive of obsolete content
« previousnext » one of the most useful aspects of using templates with rdf datasources is that when the rdf datasource changes, for instance a new triple is added, or a triple is removed, the template up
dates accordingly, adding or removing result output as needed.
...the template builder uses these notifcations to up
date the template as necessary based on the new or removed information.
...the rdf observer also has two methods onbeginup
datebatch and onendup
datebatch.
...And 2 more matches
Tree Box Objects - Archive of obsolete content
the simplest is to call invali
daterow() which will redraw a specific row in the tree.
... the tree will call the view to get the up
dated data and up
date the contents of the tree on screen.
... other redrawing functions are invali
datecell() to redraw only a single cell invali
datecolumn() to redraw a column invali
daterange() to redraw a range of rows invali
date() to redraw the entire tree.
...And 2 more matches
textbox - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
...the old name is retained for compatibility, but you should up
date your code.
...a listener for the command event should up
date search results.
...And 2 more matches
timepicker - Archive of obsolete content
the value may be retrieved and changed using the value property or the
datevalue property.
... the former specifies the time as a string of the form hh:mm:ss whereas the latter specifies the time as a
date object.
... attributes disabled, hideseconds, increment, readonly, tabindex, value properties amindicator,
datevalue, disabled, hideseconds, hour, hourleadingzero, increment, is24hourclock, ispm, minute, minuteleadingzero, pmindicator, readonly, second, secondleadingzero, tabindex, value examples <timepicker value="12:05"/> attributes disabled type: boolean indicates whether the element is disabled or not.
...And 2 more matches
2006-10-06 - Archive of obsolete content
announcements firefox 2 release candi
date 2 is now available for download beltzner announced ff2 rc2 is availabe for all 3 major platforms in some 40 langauges.
... rc2 testing up
date tim riley announced minimum tests for rc2 have been run and that rc2 is go for the final staging of the release.
... simon paquet asked for an up
date of the road map and either up
date or removal of the planning blog.
...And 2 more matches
-ms-ime-align - Archive of obsolete content
the -ms-ime-align css property is a microsoft extension aligning the input method editor (ime) candi
date window box relative to the element on which the ime composition is active.
... ime candi
date lists are positioned on the screen with sufficient size to allow basic text input.
... in the case of -ms-ime-align: after, an ime might adjust the candi
date window and keyboard input behavior to provide a better user experience, such as using a horizontal candi
date list and allowing some keys to be sent to the app for suggestion list navigation.
...And 2 more matches
Array.observe() - Archive of obsolete content
it's equivalent to object.observe() invoked with the accept type list ["add", "up
date", "delete", "splice"].
...one of "add", "up
date", "delete", or "splice".
... oldvalue: only for "up
date" and "delete" types.
...And 2 more matches
Object.observe() - Archive of obsolete content
one of "add", "up
date", or "delete".
... oldvalue: only for "up
date" and "delete" types.
...if omitted, the array ["add", "up
date", "delete", "reconfigure", "setprototype", "preventextensions"] will be used.
...And 2 more matches
Efficient animation for web games - Game development
requestanimationframe includes a domhighrestimestamp in its callback function prototype, which you definitely should use (as opposed to using the
date object), as this will be the time the frame began rendering, and ought to make your animations look more fluid.
... if (progress < animationlength) { requestanimationframe(doanimation); } } // start animation requestanimationframe(doanimation); you will note that we set starttime to -1 at the beginning, when we could just as easily have set the time using the
date() object and avoided the extra code in the animation callback.
...it is worth trying to batch similar operations, and to schedule them at a time when screen up
dates are unlikely to occur, or when such up
dates are of a more subtle nature.
...And 2 more matches
What is a Domain Name? - Learn web development
alternatively, if you use a system with a built-in shell, type a whois command into it, as shown here for mozilla.org: $ whois mozilla.org domain name:mozilla.org domain id: d1409563-lror creation
date: 1998-01-24t05:00:00z up
dated
date: 2013-12-08t01:16:57z registry expiry
date: 2015-01-23t05:00:00z sponsoring registrar:markmonitor inc.
... (r37-lror) sponsoring registrar iana id: 292 whois server: referral url: domain status: clientdeleteprohibited domain status: clienttransferprohibited domain status: clientup
dateprohibited registrant id:mmr-33684 registrant name:dns admin registrant organization:mozilla foundation registrant street: 650 castro st ste 300 registrant city:mountain view registrant state/province:ca registrant postal code:94041 registrant country:us registrant phone:+1.6509030800 as you can see, i can't register mozilla.org because the mozilla foundation has already registered it.
... whenever your registrar creates or up
dates any information for a given domain, the information must be refreshed in every dns database.
...And 2 more matches
Styling web forms - Learn web development
these include: <input type="color">
date-related controls such as <input type="
datetime-local"> <input type="range"> <input type="file"> elements involved in creating dropdown widgets, including <select>, <option>, <optgroup> and <datalist>.
... the real problem with all these controls is that they have a very complex structure, and beyond some basic styling (such as changing the width or margin of the control) you generally don't have the ability to style the controls' internal components (such as the
date picker calendar, or the button on the <select> that causes the options list to display) making up those widgets.
...on the left is the default rendering of an <input type="text">, <input type="
date">, <select>, <textarea>, <input type="submit">, and a <button> in chrome on macos, with the platform's default font style in use.
...And 2 more matches
Marking up a letter - Learn web development
use an appropriate list type to mark up the semester start
dates, study subjects, and exotic dances.
... the four
dates in the document should be have appropriate elements containing machine-readable
dates.
... the first address and first
date in the letter should have a class attribute value of sender-column.
...And 2 more matches
From object to iframe — other embedding technologies - Learn web development
bel { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); let code = textarea.value; let userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); const htmlsolution = '<iframe width="420" height="315" src="https://www.youtube.com/embed/qh2-tgulwu4" frameborder="0" allowfullscreen>\n</iframe>\n\n<iframe src="https://www.google.com/maps/embed?pb=!1m18!1m12!1m3!1d37995.65748333395!2d-2.273568166412784!3d53.473310471916975!2m3!1f0!2f0!3f0!3m2!1i1024!2i768!4f13.1!3m3!1m2!1s0x487bae6c05743d3d%3a0xf82fddd1e49fc0a1!2sthe+lowry!5e0!3m2!1sen!2suk!4v1518171785211" width="600" height="450" frameborder="0" style="border:0" allowfullscreen>\n</iframe>'; let solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a t...
...nst caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // up
date the saved usercode every time the user up
dates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } up
datecode(); }; iframes ...
...And 2 more matches
Index - Learn web development
every time a web page does more than just sit there and display static information for you to look at—displaying timely content up
dates, interactive maps, animated 2d/3d graphics, scrolling video jukeboxes, or more—you can bet that javascript is probably involved.
... 124 styling tables article, beginner, css, codingscripting, guide, needsup
date, styling, tables with styling tables now behind us, we need something else to occupy our time.
... 168 using css generated content basic, beginner, css, css:getting_started, graphics, guide, needsup
date, web this article describes some ways in which you can use css to add content when a document is displayed.
...And 2 more matches
Basic math in JavaScript — numbers and operators - Learn web development
for a start, note that you can't apply these directly to a number, which might seem strange, but we are assigning a variable a new up
dated value, not operating on the value itself.
... open in new window in the editable code box above, there are two lines marked with a comment that we'd like you to up
date to make the box grow/shrink to certain sizes, using certain operators and/or values in each case.
...for now, let's look at a quick example: <button>start machine</button> <p>the machine is stopped.</p> const btn = document.queryselector('button'); const txt = document.queryselector('p'); btn.addeventlistener('click', up
datebtn); function up
datebtn() { if (btn.textcontent === 'start machine') { btn.textcontent = 'stop machine'; txt.textcontent = 'the machine has started!'; } else { btn.textcontent = 'start machine'; txt.textcontent = 'the machine is stopped.'; } } open in new window you can see the equality operator being used just inside the up
datebtn() function.
...And 2 more matches
Ember Interactivity: Footer functionality, conditional rendering - Learn web development
here we'll get the todo counter to up
date to show the correct number of todos still to complete, and correctly apply styling to completed todos (i.e.
...enter the following terminal command to do so: ember generate component-class footer next, go and find the newly-created todomvc/app/components/footer.js file and up
date it to the following: import component from '@glimmer/component'; import { inject as service } from '@ember/service'; export default class footercomponent extends component { @service('todo-data') todos; } now we need to go back to our todo-data.js file and add some functionality that will allow us to return the number of incomplete todos (useful for showing how many are left), and cle...
... to fix this, we need to up
date this part of the template to include some conditional rendering.
...And 2 more matches
Routing in Ember - Learn web development
to do this you’ll need to enter the following commands into your terminal, inside the root directory of your app: ember generate route index ember generate route completed ember generate route active the second and third commands should have not only generated new files, but also up
dated an existing file, app/router.js.
... the index route model first of all, up
date todomvc/app/routes/index.js so it looks as follows: import route from '@ember/routing/route'; import { inject as service } from '@ember/service'; export default class indexroute extends route { @service('todo-data') todos; model() { let todos = this.todos; return { get alltodos() { return todos.all; } } } } we can now up
date the todomvc/app/templates/ind...
... in this file, change <todolist /> to <todolist @todos={{ @model.alltodos }}/> the completed route model now up
date todomvc/app/routes/completed.js so it looks as follows: import route from '@ember/routing/route'; import { inject as service } from '@ember/service'; export default class completedroute extends route { @service('todo-data') todos; model() { let todos = this.todos; return { get completedtodos() { return todos.completed; } } } } we can now up
date the todomvc/app/templates/completed.hbs file so that when it includes the <todolist /> component, it does so ...
...And 2 more matches
Framework main features - Learn web development
this component should be responsible for tracking its own count state, and could be written like this: function counterbutton() { const [count] = usestate(0); return ( <button>clicked {count} times</button> ); } usestate() is a react hook which, given an initial data value, will keep track of that value as it is up
dated.
...let’s up
date our counterbutton code from above to allow it to count clicks: function counterbutton() { const [count, setcount] = usestate(0); return ( <button onclick={() => setcount(count + 1)}>clicked {count} times</button> ); } in this version we are using additional usestate() functionality to create a special setcount() function, which we can invoke to up
date the value of count.
...it's also excessive: home and article don’t actually make use of the author's portrait or byline, but if we want to get that information into the authorcredit, we will need to change home and author to accommo
date it.
...And 2 more matches
Handling common JavaScript problems - Learn web development
to install it: install atom (if you haven't got an up-to-
date version already installed) — download it from the atom page linked above.
...let's fix this problem by running the code once the load event has been fired — remove the console.log() line, and up
date this code block: let superheroes = request.response; populateheader(superheroes); showheroes(superheroes); to the following: request.onload = function() { let superheroes = request.response; populateheader(superheroes); showheroes(superheroes); } to summarize, anytime something is not working and a value does not appear to be what it is meant to be at some point in your code, you can us...
...at this point, the right-hand side will up
date to show some very useful information.
...And 2 more matches
Mozilla accessibility architecture
to see what parts of the accessibility cache need to be invali
dated.
...we need to listen to some attribute changes because they might signal the need to invali
date parts of our cache; for example, if the name or href attribute on an anchor element changes, or the usemap attribute of an img changes.
...for example, this allows the msaa client to invali
date parts of its own cache or data model based on dom mutation events.
...And 2 more matches
Theme concepts
however, please feel free to up
date your themes to use any of the new features described here.
... updating static themes if your static theme is hosted on amo, you can upload a new version using the developer hub with the following steps: visit the product page for your theme through the developer hub select "upload new version" on the left upload your packaged file for validation or modify it using the theme generator for self-hosted static themes, a new version can be up
dated through amo by following the above steps or be handled by you through an up
dateurl or external application up
dates.
...next, you build a json object containing the same information you would use in a static theme’s manifest.json, finally, pass the json object in a theme.up
date() call.
...And 2 more matches
Embedding the editor
ensure that focus changes between editors up
date the window's notion of the "current" editor.
... if we continue to use window.editorshell, then this needs to be up
dated on focus changes.
...in composer, we'd have an implementation in js that talks to the existing commands, and up
dates the xul nodes.
...And 2 more matches
HTTP Cache
the consumer then indicates the cache entry needs to be revali
dated by returning entry_needs_revalidation from oncacheentrycheck.
... the consumer is then responsible to vali
date the partial content cache entry with the network server and attempt to load the rest of the data.
... lifetime of an existing entry that doesn't pass server revalidation such a cache entry is first examined in the nsicacheentryopencallback.oncacheentrycheck callback, where the consumer finds out it must be revali
dated with the server before use.
...And 2 more matches
DownloadTarget
this is a dynamic property, which is up
dated when the download is completed or when the download.refresh() method is called.
... this is a dynamic property, which is up
dated when the download finishes or whenever the download.refresh() method is called.
... methods refresh() up
dates the state of a finished, failed, or canceled download based on the current state as indicated by the file system.
...And 2 more matches
SVN for Localizers
when localizing websites, l10n-drivers will always add needed files to your repository or up
date your files with new strings in english.
... it's very important for you to up
date your working copy with the newest files from mozilla svn repository before you start making changes.
... enter the following command from the command-line: svn up
date your local svn repository (i.e., working directory) will be up
dated with the newest files from the url you initially cloned your repository from.
...And 2 more matches
NSS 3.15 release notes
certutil has been up
dated to support creating name constraints extensions.
...secitem_reallocitemv2 better matches caller expectations, in that it up
dates item->len on allocation.
... up
dated build instructions are available at migration to hg as part of this migration, the source code directory layout has been re-organized.
...And 2 more matches
NSS 3.24 release notes
nss 3.24 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_24_rtm/src/ new in nss 3.24 nss 3.24 includes two nss softoken up
dates, a new function to configure ssl/tls server sockets, and two functions to improve the use of temporary arenas.
... new functionality nss softoken has been up
dated with the latest national institute of standards and technology (nist) guidance (as of 2015): software integrity checks and post functions are executed on shared library load.
... nss softoken has also been up
dated to allow nss to run in fips level 1 (no password).
...And 2 more matches
NSS 3.50 release notes
notable changes in nss 3.50 verified primitives from hacl* were up
dated, bringing performance improvements for several platforms.
... up
dated dtls 1.3 implementation to draft-30.
... bugs fixed in nss 3.50 bug 1599514 - up
date dtls 1.3 implementation to draft-30 bug 1603438 - fix native tools build failure due to lack of zlib include dir if external bug 1599603 - nist sp800-108 kbkdf - pkcs#11 implementation bug 1606992 - cache the most recent pbkdf1 password hash, to speed up repeated sdr operations, important with the increased kdf iteration counts.
...And 2 more matches
FIPS mode of operation
fc_encryptinit fc_encrypt fc_encryptup
date fc_encryptfinal decryption functions these functions support triple des and aes in ecb and cbc modes.
... fc_decryptinit fc_decrypt fc_decryptup
date fc_decryptfinal message digesting functions these functions support sha-1, sha-256, sha-384, and sha-512.
... fc_digestinit fc_digest fc_digestup
date fc_digestkey fc_digestfinal signature and mac generation functions these functions support dsa, rsa, ecdsa, and hmac.
...And 2 more matches
NSS_3.12.3_release_notes.html
backwards compatibility (wildcards) bug 334678: prng_fips1861.c redefines the macro bsize on hp-ux bug 335016: mpp_pprime (miller-rabin probabilistic primality test) may choose 0 or 1 as the random integer bug 347037: make shlibsign depend on the softoken only bug 371522: auto-up
date of crls stops after first up
date bug 380784: pk11mode in non fips mode failed.
... bug 472319: vfychain vali
dates chain even if revoked certificate.
... bug 473357: ssltap incorrectly parses handshake messages that span record boundaries bug 473365: incompatible argument in pkix_vali
date.c.
...And 2 more matches
Necko Architecture
warning: the content of this article may be out of
date.
... it was last up
dated in 1999.
...necko has been designed to accommo
date pluggable protocols so developers can contribute their own protocol libraries that can be dynamically loaded and used by applications utilizing necko.
...And 2 more matches
How to embed the JavaScript engine
// time you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new
date()"; const char *filename = "noname"; int lineno = 1; bool ok = js_evaluatescript(cx, global, script, strlen(script), filename, lineno, rval.address()); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx); js_destroyruntime(rt); js_shutdown(); return...
...me you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr, js::fireonnewglobalhook)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new
date()"; const char *filename = "noname"; int lineno = 1; bool ok = js_evaluatescript(cx, global, script, strlen(script), filename, lineno, &rval); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx); js_destroyruntime(rt); js_shutdown(); return 0; } s...
...me you're spinning the event loop js::rootedobject global(cx, js_newglobalobject(cx, &global_class, nullptr, js::fireonnewglobalhook)); if (!global) return 1; js::rootedvalue rval(cx); { // scope for jsautocompartment jsautocompartment ac(cx, global); js_initstandardclasses(cx, global); const char *script = "'hello'+'world, it is '+new
date()"; const char *filename = "noname"; int lineno = 1; js::compileoptions opts(cx); opts.setfileandline(filename, lineno); bool ok = js::evaluate(cx, global, opts, script, strlen(script), &rval); if (!ok) return 1; } jsstring *str = rval.tostring(); printf("%s\n", js_encodestring(cx, str)); } js_destroycontext(cx)...
...And 2 more matches
JSAPI User Guide
a js::value can be a number, a string, a boolean value, a reference to an object (like an object, array,
date, or function), or one of the special values null or undefined.
... deploy security up
dates - firefox automatically installs up
dates, so security fixes are deployed as soon as they are available.
... unless you also regularly deploy spidermonkey security up
dates, a determined hacker could use publicly known bugs in the engine to attack your application.
...And 2 more matches
Parser API
interface forstatement <: statement { type: "forstatement"; init: variabledeclaration | expression | null; test: expression | null; up
date: expression | null; body: statement; } a for statement.
... interface up
dateexpression <: expression { type: "up
dateexpression"; operator: up
dateoperator; argument: expression; prefix: boolean; } an up
date (increment or decrement) operator expression.
... enum up
dateoperator { "++" | "--" } an up
date (increment or decrement) operator token.
...And 2 more matches
Shell global objects
datenow() return the current time with sub-ms precision.
...the added functions and their behavior are experimental: don't depend upon them unless you're willing to up
date your code if these experimental apis change underneath you.
... isasmjsmodule(fn) returns whether the given value is a function containing "use asm" that has been vali
dated according to the asm.js spec.
...And 2 more matches
WebReplayRoadmap
in a non-recording tab this will up
date the console whenever the log point's location executes in the future.
... in a recording tab, however, this will up
date the console with messages for every time the location has ever been hit.
... this requires scanning the recording and the console will not up
date immediately.
...And 2 more matches
amIInstallTrigger
ced gecko 2.0 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview boolean enabled(); boolean install(in nsivariant aargs, [optional] in amiinstallcallback acallback); boolean installchrome(in pruint32 atype, in astring aurl, in astring askin); deprecated since gecko 2.0 boolean startsoftwareup
date(in astring aurl, [optional] in print32 aflags); deprecated since gecko 2.0 boolean up
dateenabled(); deprecated since gecko 2.0 constants retained for backwards compatibility.
... startsoftwareup
date starts installing a new add-on.
... boolean startsoftwareup
date( in astring aurl, in print32 aflags optional ); parameters aurl the url of the add-on.
...And 2 more matches
nsICryptoHMAC
1.0 66 introduced gecko 1.9 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview acstring finish(in prbool aascii); void init(in unsigned long aalgorithm, in nsikeyobject akeyobject); void reset(); void up
date([const, array, size_is(alen)] in octet adata, in unsigned long alen); void up
datefromstream(in nsiinputstream astream, in unsigned long alen); constants hashing algorithms.
...up
date() void up
date( [const, array, size_is(alen)] in octet adata, in unsigned long alen ); parameters adata a buffer to calculate the hash over.
... up
datefromstream() calculates and up
dates a new hash based on a given data stream.
...And 2 more matches
nsIMicrosummaryGenerator
1.0 66 introduced gecko 1.8 obsolete gecko 6.0 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview long calculateup
dateinterval(in nsidomnode apagecontent); boolean equals(in nsimicrosummarygenerator aother); astring generatemicrosummary(in nsidomnode apagecontent); attributes attribute type description loaded boolean has the generator itself (which may be a remote resource) been loaded.
...it tells us where the generator comes from and where to go for up
dates.
... methods calculateup
dateinterval() calculates the interval until the microsummary should be up
dated for the next time, depending on the page content.
...And 2 more matches
nsIMicrosummaryObserver
pports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview void oncontentloaded(in nsimicrosummary microsummary); void onelementappended(in nsimicrosummary microsummary); void onerror(in nsimicrosummary microsummary); methods oncontentloaded() called when an observed microsummary up
dates its content.
... since an observer might watch multiple microsummaries at the same time, the microsummary whose content has been up
dated gets passed to this handler.
... void oncontentloaded( in nsimicrosummary microsummary ); parameters microsummary the microsummary whose content has just been up
dated.
...And 2 more matches
nsIMsgDatabase
void markreadby
date(in prtime start
date, in prtime end
date, in nsmsgkeyarrayptr markedids); native code only!
... void getnewlist(out unsigned long count, array, size_is(count) out nsmsgkey newkeys); nsisimpleenumerator getcachedhits(in string asearchfolderuri); void refreshcache(in string asearchfolderuri, in unsigned long anumkeys, array, size_is (anumkeys) in nsmsgkey anewhits, out unsigned long anumbadhits, array, size_is(anumbadhits) out nsmsgkey astalehits); void up
datehdrincache(in string asearchfolderuri, in nsimsgdbhdr ahdr, in boolean aadd); boolean hdrisincache(in string asearchfolderuri, in nsimsgdbhdr ahdr); attributes attribute type description dbfolderinfo nsidbfolderinfo readonly: firstnew nsmsgkey readonly: msgretentionsettings nsimsgretentionsettings msgdownloadsettings nsimsgdownloadsettings lowwaterarticlenum nsmsgkey readonly...
...ns_msg_error_folder_summary_out_of_
date the database is present (and was opened), but the summary file is out of
date.
...And 2 more matches
nsISmsDatabaseService
to create an instance, use: var smsservice = components.classes["@mozilla.org/sms/smsdatabaseservice;1"] .createinstance(components.interfaces.nsismsdatabaseservice); method overview long savereceivedmessage(in domstring asender, in domstring abody, in unsigned long long a
date); long savesentmessage(in domstring areceiver, in domstring abody, in unsigned long long a
date); void getmessage(in long messageid, in long requestid, [optional] in unsigned long long processid); void deletemessage(in long messageid, in long requestid, [optional] in unsigned long long processid); void createmessagelist(in nsidommozsmsfilter filter, in boolean reverse, in long requestid, [...
...oid getnextmessageinlist(in long listid, in long requestid, [optional] in unsigned long long processid); void clearmessagelist(in long listid); void markmessageread(in long messageid, in boolean value, in long requestid, [optional] in unsigned long long processid) methods savereceivedmessage() void savereceivedmessage( in domstring asender, in domstring abody, in unsigned long long a
date ); parameters asender a domstring with the sender of the text message.
...a
date the timestamp of the message.
...And 2 more matches
nsIXPConnect
onthistranslator(in nsiidref aiid, in nsixpcfunctionthistranslator atranslator); void setreportalljsexceptions(in boolean reportalljsexceptions); void setsafejscontextforcurrentthread(in jscontextptr cx); void setsecuritymanagerforjscontext(in jscontextptr ajscontext, in nsixpcsecuritymanager amanager, in pruint16 flags); void syncjscontexts(); void up
datexows(in jscontextptr ajscontext, in nsixpconnectwrappednative aobject, in pruint32 away); native code only!
... deferreleasesuntilaftergarbagecollection prbool obsolete since gecko 1.9 pendingexception nsiexception constants constant value description init_js_standard_classes 1 << 0 flag_system_global_object 1 << 1 omit_components_object 1 << 2 xpc_xow_clearscope 1 tells up
datexows() to clear the scope of all of the xows it finds.
... return value missing description exceptions thrown missing exception missing description getxpcwrappednativejsclassinfo() get the jsequalityop pointer to use for identifying jsobjects that hold a pointer to an nsixpconnectwrappednative or to the native in their private
date.
...And 2 more matches
XPCOM Interface Reference
ozistorageprogresshandlermozistorageresultsetmozistoragerowmozistorageservicemozistoragestatementmozistoragestatementcallbackmozistoragestatementparamsmozistoragestatementrowmozistoragestatementwrappermozistoragevacuumparticipantmozistoragevaluearraymozitxttohtmlconvmozithirdpartyutilmozivisitinfomozivisitinfocallbackmozivisitstatuscallbacknsiabcardnsiaboutmodulensiabstractworkernsiaccelerometerup
datensiaccessnodensiaccessibilityservicensiaccessiblensiaccessiblecaretmoveeventnsiaccessiblecoordinatetypensiaccessibledocumentnsiaccessibleeditabletextnsiaccessibleeventnsiaccessiblehyperlinknsiaccessiblehypertextnsiaccessibleimagensiaccessibleprovidernsiaccessiblerelationnsiaccessibleretrievalnsiaccessiblerolensiaccessiblescrolltypensiaccessibleselectablensiaccessiblestatechangeeventnsiaccessiblest...
...cessibletablechangeeventnsiaccessibletextnsiaccessibletextchangeeventnsiaccessibletreecachensiaccessiblevaluensiaccessiblewin32objectnsialertsservicensiannotationobservernsiannotationservicensiappshellnsiappshellservicensiappstartupnsiappstartup_mozilla_2_0nsiapplicationcachensiapplicationcachechannelnsiapplicationcachecontainernsiapplicationcachenamespacensiapplicationcacheservicensiapplicationup
dateservicensiarraynsiasyncinputstreamnsiasyncoutputstreamnsiasyncstreamcopiernsiasyncverifyredirectcallbacknsiauthinformationnsiauthmodulensiauthpromptnsiauthprompt2nsiauthpromptadapterfactorynsiauthpromptcallbacknsiauthpromptprovidernsiauthpromptwrappernsiautocompletecontrollernsiautocompleteinputnsiautocompleteitemnsiautocompletelistenernsiautocompleteobservernsiautocompleteresultnsiautocompletesea...
...ifeedresultnsifeedresultlistenernsifeedtextconstructnsifilensifileinputstreamnsifileoutputstreamnsifilepickernsifileprotocolhandlernsifilespecnsifilestreamsnsifileurlnsifileutilitiesnsifileviewnsifocusmanagernsiformhistory2nsiframeloadernsiframeloaderownernsiframemessagelistenernsiframemessagemanagernsiframescriptloadernsigsettingscollectionnsigsettingsservicensigeolocationprovidernsigeolocationup
datensiglobalhistorynsiglobalhistory2nsiglobalhistory3nsihtmleditornsihttpheaderlistenernsihapticfeedbacknsihttpactivitydistributornsihttpactivityobservernsihttpchannelnsihttpchannelinternalnsihttpheadervisitornsihttpservernsihttpupgradelistenernsiidnservicensiiframeboxobjectnsiiniparsernsiiniparserfactorynsiiniparserwriternsiioservicensiidleservicensiinprocesscontentframemessagemanagernsiinputstreamn...
...And 2 more matches
Xray vision
xrays for javascript objects until recently, built-in javascript objects that are not part of the dom, such as
date, error, and object, did not get xray vision when accessed by more-privileged code.
...for example, if content code creates a new
date object, it will usually be created as a property of a dom object, and then it will be filtered out by the dom xray: // content code // redefine
date.getfullyear()
date.prototype.getfullyear = function() {return 1000}; var
date = new
date(); // chrome code // contentwindow is an xray, and
date is an expando on contentwindow // so
date is filtered out gbrowser.contentwindow.
date.getfullyear() // -> typeerror: gbrowser.contentwindow.
date is undefined the chrome code will only even see
date if it waives xrays, and then, because waiving is transitive, it should expect to be...
... vulnerable to redefinition: // chrome code components.utils.waivexrays(gbrowser.contentwindow).
date.getfullyear(); // -> 1000 however, there are some situations in which privileged code will access javascript objects that are not themselves dom objects and are not properties of dom objects.
...And 2 more matches
Building a Thunderbird extension 6: Adding JavaScript
in this step we will create a small piece of javascript code that inserts the current
date into our statusbar widget.
... window.addeventlistener("load", function(e) { startup(); }, false); window.setinterval( function() { startup(); }, 60000); //up
date date every minute function startup() { var mypanel = document.getelementbyid("my-panel"); var
date = new
date(); var day =
date.getday(); var
datestring =
date.getfullyear() + "." + (
date.getmonth()+1) + "." +
date.get
date(); mypanel.label = "
date: " +
datestring; } the first part registers a new event listener that will be executed automatically when thunderbird loads.
...it then uses javascript's
date class to get the current
date, which it converts into a string that has the format of yyyy.mm.dd.
...And 2 more matches
Mozilla
creating a spell check dictionary add-on this page describes how to package a hunspell spell check dictionary as a firefox add-on, or how to up
date your existing add-on, so that it can be installed, uninstalled and up
dated without a restart.
... setting up an up
date server the goal of this document is to provide instructions for installing a locally-served firefox up
date.
...this format is used by the extension manager, software up
date, and other parts of the platform.
...And 2 more matches
Introduction to DOM Inspector - Firefox Developer Tools
the dom inspector keeps track of all the windows that are open, so to inspect the dom of a particular window in the dom inspector, simply access that window as you would normally and then choose its title from this dynamically up
dated menulist.
...by clicking around in the document pane, you'll see that the viewers are linked; whenever you select a new node from the dom nodes viewer, the dom node viewer is automatically up
dated to reflect the information for that node.
... updating the dom dynamically another feature to mention in this introduction is the ability is the ability the dom inspector gives you to dynamically up
date information reflected in the dom about web pages, user interface, and other elements.
...And 2 more matches
Network request details - Firefox Developer Tools
sults through a json validator): { "response headers (1.113 kb)": { "headers": [ { "name": "accept-ranges", "value": "bytes" }, { "name": "age", "value": "0" }, { "name": "backend-timing", "value": "d=74716 t=1560258099074460" }, { "name": "cache-control", "value": "private, must-revali
date, max-age=0" }, { "name": "content-disposition", "value": "inline; filename=api-result.js" }, { "name": "content-encoding", "value": "gzip" }, { "name": "content-length", "value": "673" }, { "name": "content-type", "value": "text/javascript; charset=utf-8" }, { "name"...
...: "
date", "value": "tue, 11 jun 2019 13:01:39 gmt" }, { "name": "mediawiki-login-suppressed", "value": "true" }, { "name": "p3p", "value": "cp=\"this is not a p3p policy!
... these details include: last fetched: the
date the resource was last fetched fetched count: the number of times in the current session that the resource has been fetched data size: the size of the resource.
...And 2 more matches
Constraint validation API - Web APIs
therefore, you need to also vali
date input values on the server side, in a way that is consistent with what is done on the client side.
...together, they help explain whether and why an element's value fails to vali
date.
... validationmessage a read-only property that returns an empty string if the element is not a candi
date for constraint validation, or if the element's value is valid.
...And 2 more matches
Using files from web applications - Web APIs
ctype html> <html> <head> <meta charset="utf-8"> <title>file(s) size</title> </head> <body> <form name="uploadform"> <div> <input id="uploadinput" type="file" name="myfiles" multiple> selected files: <span id="filenum">0</span>; total size: <span id="filesize">0</span> </div> <div><input type="submit" value="send file"></div> </form> <script> function up
datesize() { let nbytes = 0, ofiles = this.files, nfiles = ofiles.length; for (let nfileid = 0; nfileid < nfiles; nfileid++) { nbytes += ofiles[nfileid].size; } let soutput = nbytes + " bytes"; // optional code for multiples approximation const amultiples = ["kib", "mib", "gib", "tib", "pib", "eib", "zib", "yib"]; for (nmultiple = 0, napprox = nbytes /...
... 1024; napprox > 1; napprox /= 1024, nmultiple++) { soutput = napprox.tofixed(3) + " " + amultiples[nmultiple] + " (" + nbytes + " bytes)"; } // end of optional code document.getelementbyid("filenum").innerhtml = nfiles; document.getelementbyid("filesize").innerhtml = soutput; } document.getelementbyid("uploadinput").addeventlistener("change", up
datesize, false); </script> </body> </html> using hidden file input elements using the click() method you can hide the admittedly ugly file <input> element and present your own interface for opening the file picker and displaying which file or files the user has selected.
... function fileupload(img, file) { const reader = new filereader(); this.ctrl = createthrobber(img); const xhr = new xmlhttprequest(); this.xhr = xhr; const self = this; this.xhr.upload.addeventlistener("progress", function(e) { if (e.lengthcomputable) { const percentage = math.round((e.loaded * 100) / e.total); self.ctrl.up
date(percentage); } }, false); xhr.upload.addeventlistener("load", function(e){ self.ctrl.up
date(100); const canvas = self.ctrl.ctx.canvas; canvas.parentnode.removechild(canvas); }, false); xhr.open("post", "http://demos.hacks.mozilla.org/paul/demos/resources/webservices/devnull.php"); xhr.overridemimetype('text/plain; charset=x-user-defined-bin...
...And 2 more matches
File.lastModified - Web APIs
the file.lastmodified read-only property provides the last modified
date of the file as the number of milliseconds since the unix epoch (january 1, 1970 at midnight).
... files without a known last modified
date return the current
date.
... example reading from file input <input type="file" multiple id="fileinput"> const fileinput = document.queryselector('#fileinput'); fileinput.addeventlistener('change', (event) => { // files is a filelist object (similar to nodelist) const files = event.target.files; for (let file of files) { const
date = new
date(file.lastmodified); console.log(`${file.name} has a last modified
date of ${
date}`); } }); try the results out below: dynamically created files if a file is created dynamically, the last modified time can be supplied in the new file() constructor function.
...And 2 more matches
HTMLButtonElement - Web APIs
htmlbuttonelement.formnovali
date is a boolean indicating that the form is not to be vali
dated when it is submitted.
... if specified, this attribute overrides the novali
date attribute of the <form> element that owns this element.
... htmlbuttonelement.willvali
date read only is a boolean indicating whether the button is a candi
date for constraint validation.
...And 2 more matches
HTMLObjectElement - Web APIs
this is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... htmlobjectelement.willvali
date read only returns a boolean that indicates whether the element is a candi
date for constraint validation.
... htmlobjectelement.checkvalidity() retuns a boolean that always is true, because object objects are never candi
dates for constraint validation.
...And 2 more matches
PayerErrors.name - Web APIs
the name property is included in a payererrors object if the payername returned in the response couldn't be vali
dated.
...if the payer's name vali
dated successfully, the name property is omitted from the payererrors object.
... syntax payername = payererrors.name; value if this property is present in the payererrors object, the payer's name couldn't be successfully vali
dated, and the name property's value is a domstring explaining the error.
...And 2 more matches
PayerErrors.phone - Web APIs
the phone property is found in a payererrors object if the payername returned in the response couldn't be vali
dated as a valid phone number.
...if the payer's phone number vali
dated successfully, the phone property is omitted from the payererrors object.
... syntax payerphone = payererrors.phone; value if this property is present in the payererrors object, the payer's phone number couldn't be successfully vali
dated, and the phone property's value is a domstring explaining the error.
...And 2 more matches
PaymentRequest: merchantvalidation event - Web APIs
merchantvalidation events are delivered by the payment request api to a paymentrequest object when a payment handler requires that the merchant requesting the purchase vali
date itself as permitted to use the payment handler.
... request.addeventlistener("merchantvalidation", event => { event.complete(async () => { const merchantserverurl = window.location.origin + '/vali
date?url=' + encodeuricomponent(event.validationurl); // get validation data, and complete validation; return await fetch(merchantserverurl).then(response => response.text()); }, false); }; const response = await request.show(); how merchant server handles the validation depends on the server implementation and payment method documentation.
...this response lets the payment handler know if the merchant is vali
dated.
...And 2 more matches
PaymentRequest: paymentmethodchange event - Web APIs
the code assumes the existence of a method detailsforshipping(), which returns a paymentdetailsup
date object containing the shipping options for the ground shipping method, in the form found in the paymentshippingoption dictionary.
... detailsforshipping("ground"), options); paymentrequest.addeventlistener("paymentmethodchange", handlepaymentchange, false); paymentrequest.show() .then(response => response.complete("success")) .catch(err => console.log("error handling payment request: " + err)); the event handler function itself, handlepaymentchange(), looks like this: handlepaymentchange = event => { const detailsup
date = {}; if (event.methodname === "https://apple.com/apple-pay") { const servicefeeinfo = calculateservicefee(event.methoddetails); object.assign(detailsup
date, servicefeeinfo); } event.up
datewith(detailsup
date); }, false); this begins by looking at the event's methodname property; if that indicates that the user is trying to use apple pay, we pass the methoddetails into a function...
... called calculateservicefee(), which we might create to take the information about the transaction, such as the underlying credit card being used to service the apple pay request, and compute and return an paymentdetailsup
date object that specifies changes to be applied to the paymentrequest in order to add any service fees that the payment method might require.
...And 2 more matches
PaymentRequest: shippingaddresschange event - Web APIs
bubbles no cancelable no interface paymentrequestup
dateevent event handler property onshippingaddresschange usage notes depending on the browser, the shipping address information may be redacted for privacy reasons.
... example in this example, a handler for the shippingaddresschange event is set up to vali
date that the address meets requirements set by the web application.
... const paymentrequest = new paymentrequest(methoddata, details, options); paymentrequest.addeventlistener("shippingaddresschange", event => { let detailsup
date = checkaddress(paymentrequest.shippingaddress); event.up
datewith(detailsupate); }, false); const checkaddress = theaddress => { let detailsup
date = {}; // check the address, return a paymentdetailsup
date object // with any changes or errors.
...And 2 more matches
PaymentRequest: shippingoptionchange event - Web APIs
bubbles no cancelable no interface paymentrequestup
dateevent event handler property onshippingoptionchange examples this code snippet sets up a handler for the shippingoptionchange event.
... paymentrequest.addeventlistener("shippingoptionchange", event => { const value = calculatenewtotal(paymentrequest.shippingoption); const total = { currency: "eur", label: "total due", value, }; event.up
datewith({ total }); }, false); after caling a custom function, calculatenewtotal(), to compute the up
dated total based on the newly-selected shipping option as specified by the shippingoption.
... the revised total is submitted back to the payment request by calling the event's up
datewith() method.
...And 2 more matches
PaymentResponse: payerdetailchange event - Web APIs
if any are invalid, appropriate error messages should be configured and the retry() method should be called on the paymentresponse to ask the user to up
date the invalid entries.
... bubbles no cancelable no interface paymentrequestup
dateevent event handler property onpayerdetailchange examples in the example below, onpayerdetailchange is used to set up a listener for the payerdetailchange event in order to vali
date the information entered by the user, requesting that any mistakes be corrected // options for paymentrequest(), indicating that shipping address, // payer email address, name, and phone number all be collected.
... response.onpayerdetailchange = async ev => { const promisestovali
date = []; const { payername, payeremail, payerphone } = response; // vali
date each value which changed by calling a function // that vali
dates each type of data, returning a promise which // resolves if the data is valid.
...And 2 more matches
PaymentResponse.retry() - Web APIs
vali
date the returned reponse; if there are any fields whose values are not acceptable, call the response's complete() method with a value of "fail" to indicate failure.
...} async function dopaymentrequest() { const request = new paymentrequest(methoddata, details, options); const response = await request.show(); await recursivevali
date(request, response); await response.complete("success"); } // keep validating until the data looks good!
... async function recursivevali
date(request, response) { const promisestofixthings = []; const errors = await vali
date(request, response); if (!errors) { return; } if (errors.shippingaddress) { // "shippingaddresschange" fired at request object const promise = fixfield(request, "shippingaddresschange", shippingvalidator); promisestofixthings.push(promise); } if (errors.payer) { // "payerdetailchange" fired at response object const promise = fixfield(response, "payerdetailchange", payervalidator); promisestofixthings.push(promise); } await promise.all([response.retry(errors), ...promisestofixthings]); await recursivevali
date(request, response); } function fixfield(requestorresponse, event, validator) { return new promise(resolve => { // brows...
...And 2 more matches
Pointer Lock API - Web APIs
if so, it attached an event listener to handle the mouse movements with the up
dateposition() function.
... function lockchangealert() { if (document.pointerlockelement === canvas || document.mozpointerlockelement === canvas) { console.log('the pointer lock status is now locked'); document.addeventlistener("mousemove", up
dateposition, false); } else { console.log('the pointer lock status is now unlocked'); document.removeeventlistener("mousemove", up
dateposition, false); } } the up
dateposition() function up
dates the position of the ball on the canvas (x and y), and also includes if() statements to check whether the ball has gone off the edges of the canvas.
...it also includes a check whether a requestanimationframe() call has previously been made, and if so, calls it again as required, and calls the canvasdraw() function that up
dates the canvas scene.
...And 2 more matches
RTCIceGathererState - Web APIs
values "new" the rtcicetransport is newly created and has not yet started to gather ice candi
dates.
... "gathering" the transport is in the process of gathering candi
dates.
... "complete" the transport has finished gathering ice candi
dates and has sent the end-of-candi
dates indicator to the remote device.
...And 2 more matches
RTCIceTransport.gatheringState - Web APIs
syntax gatherstate = rtcicetransport.gatheringstate; value a string from the rtcicegathererstate enumerated type whose value indicates the current state of the ice agent's candi
date gathering process: "new" the rtcicetransport is newly created and has not yet started to gather ice candi
dates.
... "gathering" the transport is in the process of gathering candi
dates.
... "complete" the transport has finished gathering ice candi
dates and has sent the end-of-candi
dates indicator to the remote device.
...And 2 more matches
RTCIceTransport: gatheringstatechange event - Web APIs
a gatheringstatechange event is sent to an rtcicetransport when its ice candi
date gathering state changes.
... the gathering state, whose actual status can be found in the transport object's gatheringstate property, indicates whether or not the ice agent has begun gathering candi
dates, and if so, if it has finished doing so.
...in contrast, gatheringstatechange represents changes to the candi
date gathering state for a single transport.
...And 2 more matches
RTCPeerConnection.iceGatheringState - Web APIs
this lets you detect, for example, when collection of ice candi
dates has finished.
... "gathering" the ice agent is in the process of gathering candi
dates for the connection.
... "complete" the ice agent has finished gathering candi
dates.
...And 2 more matches
SVGAngle - Web APIs
the associated element is used to determine which element's content attribute to up
date if the object reflects an attribute.
...setting this attribute will cause valueinspecifiedunits and valueasstring to be up
dated automatically to reflect this setting.
...setting this attribute will cause value and valueasstring to be up
dated automatically to reflect this setting.
...And 2 more matches
SVGSVGElement - Web APIs
each candi
date graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...each candi
date graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...each candi
date graphics element is to be considered a match only if the same graphics element can be a target of pointer events as defined in pointer-events processing.
...And 2 more matches
Screen Wake Lock API - Web APIs
examples feature detection this code checks for wake lock support and up
dates the ui accordingly.
...the wakelock.request method is promise based and so we can create an asynchronous function, which in turn up
dates the ui to reflect the wake lock is active.
... wakelock.release() .then(() => { wakelock = null; }); listening for wake lock release this example up
dates the ui if the wake lock has been released for any reason (such as navigating away from the active window/tab).
...And 2 more matches
ServiceWorkerRegistration - Web APIs
event handlers serviceworkerregistration.onup
datefound read only an eventlistener property called whenever an event of type up
datefound is fired; it is fired any time the serviceworkerregistration.installing property acquires a new service worker.
... serviceworkerregistration.up
date() checks the server for an up
dated version of the service worker without consulting caches.
...next, it adds an up
datefound listener in which it uses the service worker registration to listen for further changes to the service worker's state.
...And 2 more matches
Using Service Workers - Web APIs
this doesn’t have much of a distinct use the first time your service worker is installed/activated, but it means more when the service worker is up
dated (see the updating your service worker section later on.) note: localstorage works in a similar way to service worker cache, but it is synchronous, so not allowed in service workers.
... a service worker is fetched, which includes the documents inside the specified scope, and any resources referenced in those documents (for example if index.html makes a cross origin request to embed an image, that still goes through its service worker.) you can attach a fetch event listener to the service worker, then call the respondwith() method on the event to hijack our http responses and up
date them with your own magic.
...resp || fetch(event.request).then((response) => { let responseclone = response.clone(); caches.open('v1').then((cache) => { cache.put(event.request, responseclone); }); return response; }); }).catch(() => { return caches.match('./sw-test/gallery/mylittlevader.jpg'); }) ); }); we have opted for this fallback image because the only up
dates that are likely to fail are new images, as everything else is depended on for installation in the install event listener we saw earlier.
...And 2 more matches
Lighting in WebGL - Web APIs
then we up
date the vertex shader to adjust the color of each vertex, taking into account the ambient lighting as well as the effect of the directional lighting given the angle at which it's striking the face.
... const normalize = false; const stride = 0; const offset = 0; gl.bindbuffer(gl.array_buffer, buffers.normal); gl.vertexattribpointer( programinfo.attriblocations.vertexnormal, numcomponents, type, normalize, stride, offset); gl.enablevertexattribarray( programinfo.attriblocations.vertexnormal); } finally, we need to up
date the code that builds the uniform matrices to generate and deliver to the shader a normal matrix, which is used to transform the normals when dealing with the current orientation of the cube in relation to the light source: const normalmatrix = mat4.create(); mat4.invert(normalmatrix, modelviewmatrix); mat4.transpose(normalmatrix, normalmatrix); ...
... gl.uniformmatrix4fv( programinfo.uniformlocations.normalmatrix, false, normalmatrix); up
date the shaders now that all the data the shaders need is available to them, we need to up
date the code in the shaders themselves.
...And 2 more matches
Web Authentication API - Web APIs
browser calls authenticatormakecredential() on authenticator - internally, the browser will vali
date the parameters and fill in any defaults, which become the authenticatorresponse.clientdatajson.
...the public key will become part of the attestation, which the authenticator will sign over with a private key that was burned into the authenticator during its manufacturing process and that has a certificate chain that can be vali
dated back to a root of trust.
... server vali
dates and finalizes registration - finally, the server is required to perform a series of checks to ensure that the registration was complete and not tampered with.
...And 2 more matches
ARIA: timer role - Accessibility
while the value does not necessarily need to be machine parsable, it should continuously up
date at regular intervals unless the timer is paused or reaches its end-point.
...the clock is up
dated each minute, with the new remaining time simply overwriting the current content.
... <div id="clock" role="timer" aria-live="off">20</div> <button onclick="starttimer('clock')">start</button> /* basic javascript to up
date a timer */ function starttimer(timername) { // get the number of seconds let timer = document.getelementbyid(timername), seconds = parseint(timer.innertext); // remove a second // up
dated the content of timer timer.innertext = --seconds // if timer != 0, settimeout if (seconds) { settimeout( function() { starttimer(timername); }, 1000); } } the first time the function executes, the entirety of the string that is added will be announced.
...And 2 more matches
Accessibility documentation index - Accessibility
7 aria live regions aria, accessibility, arialive using javascript, it is possible to dynamically change parts of a page without requiring the entire page to reload — for instance, to up
date a list of search results on the fly, or to display a discreet alert or notification which does not require user interaction.
... 51 aria: alert role aria, aria role, aria alert, aria widget, reference the alert role can be used to tell the user an element has been dynamically up
dated.
... screen readers will instantly start reading out the up
dated content when the role is added.
...And 2 more matches
Ordering Flex Items - CSS: Cascading Style Sheets
you should always take the source order as the logical order of the document as all up-to-
date user agents will be following the specification and doing so.
...the card also has a
date; the finished design we want to create is something like this.
... visually the
date appears above the heading, in the source.
...And 2 more matches
CSS Grid Layout and Progressive Enhancement - CSS: Cascading Style Sheets
this early specification did not contain all of the properties and values that the up-to-
date specification has.
...as these properties are vendor prefixed, they will not effect any browser supporting the up to
date and unprefixed specification.
... autoprefixer grid layout support the popular tool autoprefixer has been up
dated to support the -ms- grid version.
...And 2 more matches
Rich-Text Editing in Mozilla - Developer guides
note: this document is out-of-
date; you are advised to consult the more up-to-
date document available at making content editable.
...).contentwindow.focus() } example: a simple but complete rich text editor <!doctype html> <html> <head> <title>rich text editor</title> <script type="text/javascript"> var odoc, sdeftxt; function initdoc() { odoc = document.getelementbyid("textbox"); sdeftxt = odoc.innerhtml; if (document.compform.switchmode.checked) { setdocmode(true); } } function formatdoc(scmd, svalue) { if (vali
datemode()) { document.execcommand(scmd, false, svalue); odoc.focus(); } } function vali
datemode() { if (!document.compform.switchmode.checked) { return true ; } alert("uncheck \"show html\"."); odoc.focus(); return false; } function setdocmode(btosource) { var ocontent; if (btosource) { ocontent = document.createtextnode(odoc.innerhtml); odoc.innerhtml = ""; var opre = docum...
...tenteditable = true; opre.appendchild(ocontent); odoc.appendchild(opre); } else { if (document.all) { odoc.innerhtml = odoc.innertext; } else { ocontent = document.createrange(); ocontent.selectnodecontents(odoc.firstchild); odoc.innerhtml = ocontent.tostring(); } odoc.contenteditable = true; } odoc.focus(); } function printdoc() { if (!vali
datemode()) { return; } var oprntwin = window.open("","_blank","width=450,height=470,left=400,top=100,menubar=yes,toolbar=no,location=no,scrollbars=yes"); oprntwin.document.open(); oprntwin.document.write("<!doctype html><html><head><title>print<\/title><\/head><body onload=\"print();\">" + odoc.innerhtml + "<\/body><\/html>"); oprntwin.document.close(); } </script> <style type="text/css"> .in...
...And 2 more matches
Index - Developer guides
17 event developer guide dom, event, guide, needsup
date, events events refers both to a design pattern used for the asynchronous handling of various incidents which occur in the lifetime of a web page and to the naming, characterization, and use of a large number of incidents of different types.
... 19 dom onevent handlers beginner, dom, dom beginner, needsbeginnerup
date, needsup
date the web platform provides several ways to be notified of dom events.
... 24 overview of events and handlers beginner, dom, example, javascript, needsbeginnerup
date, needsup
date, events this overview of events and event handling explains the code design pattern used to react to incidents occurring when a browser accesses a web page, and it summarizes the types of such incidents modern web browsers can handle.
...And 2 more matches
HTML attribute: step - HTML: Hypertext Markup Language
valid for the numeric input types, including the
date, month, week, time,
datetime-local, number and range types, the step attribute is a number that specifies the granularity that the value must adhere to or the keyword any.
... the step sets the stepping interval when clicking up and down spinner buttons, moving a slider left and right on a range, and validating the different
date types.
... if not explicitly included, step defaults to 1 for number and range, and 1 unit type (minute, week, month, day) for the
date/time input types.
...And 2 more matches
<article>: The Article Contents element - HTML: Hypertext Markup Language
the publication
date and time of an <article> element can be described using the
datetime attribute of a <time> element.
... note that the pub
date attribute of <time> is no longer a part of the w3c html5 standard.
... examples <article class="film_review"> <header> <h2>jurassic park</h2> </header> <section class="main_review"> <p>dinos were great!</p> </section> <section class="user_reviews"> <article class="user_review"> <p>way too scary for me.</p> <footer> <p> posted on <time
datetime="2015-05-16 19:00">may 16</time> by lisa.
...And 2 more matches
itemprop - HTML: Hypertext Markup Language
op="name">panasonic white 60l refrigerator</span> <img src="panasonic-fridge-60l-white.jpg" alt=""> <div itemprop="aggregaterating" itemscope itemtype="http://schema.org/aggregaterating"> <meter itemprop="ratingvalue" min=0 value=3.5 max=5>rated 3.5/5</meter> (based on <span itemprop="reviewcount">11</span> customer reviews) </div> </div> similarly, for
date- and time-related data, the time element and its
datetime attribute can be used.
... an item with one property, "birthday", whose value is a
date <div itemscope> i was born on <time itemprop="birthday"
datetime="2009-05-10">may 10th 2009</time>.
...sing the value of the element's data attribute relative to the node document of the element at the time the attribute is set if the element is a data element the value is the value of the element's value attribute if the element is a meter element the value is the value of the element's value attribute if the element is a time element the value is the element's
datetime value otherwise the value is the element's textcontent.
...And 2 more matches
Evolution of HTTP - HTTP
at this point, a typical request and response looked like this: get /mypage.html http/1.0 user-agent: ncsa_mosaic/2.0 (windows 3.1) 200 ok
date: tue, 15 nov 1994 08:12:31 gmt server: cern/3.0 libwww/2.17 content-type: text/html <html> a page with an image <img src="/myimage.gif"> </html> followed by a second connection and request to fetch the image (followed by a response to that request): get /myimage.gif http/1.0 user-agent: ncsa_mosaic/2.0 (windows 3.1) 200 ok
date: tue, 15 nov 1994 08:12:32 gmt server: cern/3.0 libwww/2.17 con...
...la.org user-agent: mozilla/5.0 (macintosh; intel mac os x 10.9; rv:50.0) gecko/20100101 firefox/50.0 accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 accept-language: en-us,en;q=0.5 accept-encoding: gzip, deflate, br referer: https://developer.mozilla.org/docs/glossary/simple_header 200 ok connection: keep-alive content-encoding: gzip content-type: text/html; charset=utf-8
date: wed, 20 jul 2016 10:55:30 gmt etag: "547fa7e369ef56031dd3bff2ace9fc0832eb251a" keep-alive: timeout=5, max=1000 last-modified: tue, 19 jul 2016 00:59:33 gmt server: apache transfer-encoding: chunked vary: cookie, accept-encoding (content) get /static/img/header-background.png http/1.1 host: developer.cdn.mozilla.net user-agent: mozilla/5.0 (macintosh; intel mac os x 10.9; rv:50.0) gecko/201001...
...01 firefox/50.0 accept: */* accept-language: en-us,en;q=0.5 accept-encoding: gzip, deflate, br referer: https://developer.mozilla.org/docs/glossary/simple_header 200 ok age: 9578461 cache-control: public, max-age=315360000 connection: keep-alive content-length: 3077 content-type: image/png
date: thu, 31 mar 2016 13:34:46 gmt last-modified: wed, 21 oct 2015 18:27:50 gmt server: apache (image content of 3077 bytes) http/1.1 was first published as rfc 2068 in january 1997.
...And 2 more matches
Browser detection using the user agent - HTTP
another such case is for fixing bugs in browsers that do not automatically up
date.
...webkit is a bit worse because apple forces all of the browsers on ios to use webkit internally, thus the user has no way to get a better more up
dated browser on older devices.
... var ua=navigator.useragent, iswebkit=/\b(ipad|iphone|ipod)\b/.test(ua) && /webkit/.test(ua) && !/edge/.test(ua) && !window.msstream; var mediaqueryup
dated = true, mql = []; function whenmediachanges(){mediaqueryup
dated = true} var listentomediaquery = iswebkit ?
...And 2 more matches
Cross-Origin Resource Sharing (CORS) - HTTP
additionally, for http request methods that can cause side-effects on server data (in particular, http methods other than get, or post with certain mime types), the specification man
dates that browsers "preflight" the request, soliciting supported methods from the server with the http options request method, and then, upon "approval" from the server, sending the actual request.
... http/1.1 200 ok
date: mon, 01 dec 2008 00:23:53 gmt server: apache/2 access-control-allow-origin: * keep-alive: timeout=2, max=100 connection: keep-alive transfer-encoding: chunked content-type: application/xml […xml data…] in response, the server sends back an access-control-allow-origin header.
... user-agent: mozilla/5.0 (macintosh; intel mac os x 10.14; rv:71.0) gecko/20100101 firefox/71.0 accept: text/html,application/xhtml+xml,application/xml;q=0.9,*/*;q=0.8 accept-language: en-us,en;q=0.5 accept-encoding: gzip,deflate connection: keep-alive origin: http://foo.example access-control-request-method: post access-control-request-headers: x-pingother, content-type http/1.1 204 no content
date: mon, 01 dec 2008 01:15:39 gmt server: apache/2 access-control-allow-origin: https://foo.example access-control-allow-methods: post, get, options access-control-allow-headers: x-pingother, content-type access-control-max-age: 86400 vary: accept-encoding, origin keep-alive: timeout=2, max=100 connection: keep-alive once the preflight request is complete, the real request is sent: post /doc http...
...And 2 more matches
Set-Cookie - HTTP
header type response header forbidden header name no forbidden response-header name yes syntax set-cookie: <cookie-name>=<cookie-value> set-cookie: <cookie-name>=<cookie-value>; expires=<
date> set-cookie: <cookie-name>=<cookie-value>; max-age=<non-zero-digit> set-cookie: <cookie-name>=<cookie-value>; domain=<domain-value> set-cookie: <cookie-name>=<cookie-value>; path=<path-value> set-cookie: <cookie-name>=<cookie-value>; secure set-cookie: <cookie-name>=<cookie-value>; httponly set-cookie: <cookie-name>=<cookie-value>; samesite=strict set-cookie: <cookie-name>=<cookie-value>; samesi...
... expires=<
date> optional the maximum lifetime of the cookie as an http-
date timestamp.
... see
date for the required formatting.
...And 2 more matches
Text formatting - JavaScript
internationalization the intl object is the namespace for the ecmascript internationalization api, which provides language sensitive string comparison, number formatting, and
date and time formatting.
... the constructors for collator, numberformat, and
datetimeformat objects are properties of the intl object.
...
date and time formatting the
datetimeformat object is useful for formatting
date and time.
...And 2 more matches
SDK API Lifecycle - Archive of obsolete content
it has two main components: a stability index that defines how stable each module is a deprecation process that defines when and how stable sdk apis can be changed or removed from future versions of the sdk while giving developers enough time to up
date their code.
... deprecation process deprecation in the chosen release, the sdk team will communicate the module's deprecation: up
date the module's stability index to be "deprecated" include a deprecation notice in the release notes, the add-ons blog, and the jetpack google group.
... removal the target removal
date is 18 weeks after deprecation.
... in preparation for this
date the sdk team will decide whether to go ahead with removal: this will depend on how many developers have successfully migrated from the deprecated module, and on how urgently the module needs to be removed.
Creating Reusable Modules - Archive of obsolete content
.createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells up
datefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.up
datefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
....createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells up
datefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.up
datefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
....createinstance(ci.nsilocalfile); f.initwithpath(path); var istream = cc["@mozilla.org/network/file-input-stream;1"] .createinstance(ci.nsifileinputstream); // open for reading istream.init(f, 0x01, 0444, 0); var ch = cc["@mozilla.org/security/hash;1"] .createinstance(ci.nsicryptohash); // we want to use the md5 algorithm ch.init(ch.md5); // this tells up
datefromstream to read the entire file const pr_uint32_max = 0xffffffff; ch.up
datefromstream(istream, pr_uint32_max); // pass false here to get binary data back var hash = ch.finish(false); // convert the binary hash data to a hex string.
... var s = array.from(hash, (c, i) => tohexstring(hash.charcodeat(i))).join(""); return s; } exports.hashfile = md5file; index.js finally, up
date index.js to import these two new modules and use them: var filepicker = require("./filepicker.js"); var md5 = require("./md5.js"); require("sdk/ui/button/action").actionbutton({ id: "show-panel", label: "show panel", icon: { "16": "./icon-16.png" }, onclick: function() { console.log(md5.hashfile(filepicker.promptforfile())); } }); distributing modules with jpm, we use npm as the package manager for sdk modules that don't ship inside firefox.
Localization - Archive of obsolete content
er → everything else russian uses four forms, that can be described as follows: one → n mod 10 is 1 and n mod 100 is not 11; few → n mod 10 in 2..4 and n mod 100 not in 12..14; many → n mod 10 is 0 or n mod 10 in 5..9 or n mod 100 in 11..14; other → everything else plural rules for all languages can be found in the cldr language plural rules page (although this table is out of
date compared to the cldr xml source).
... locale up
dater the locale up
dater add-on makes it easier to up
date locale files.
... once you've installed it, open the add-on manager, and you'll see a new button labeled "up
date l10n" next to each add-on you've installed: click the button and you'll be prompted for a new .properties file for that add-on.
... if you provide a new file, the add-on's locale data will be up
dated with the new file.
Creating custom Firefox extensions with the Mozilla build system - Archive of obsolete content
if someone can confirm this and/or provide guidelines for what's different, i'll up
date the article to incorporate this information.
...add the following line at the end of the file: ac_add_options --enable-extensions=default,myextension now launch make from the mozilla root: make -f client.mk build even if you have an up-to-
date firefox build, you'll have to wait a while for make to recurse over the entire mozilla source tree looking for new stuff (on my machine, which is pretty fast, this takes a good 10-15 minutes).
...rumor has it that at some future
date, this will possible through the nsiextensionmanager interface or something similar.
...the downside is that you will need to up
date the modified makefile any time a new version of the library is released.
Deploying a Plugin as an Extension - Archive of obsolete content
this feature is particularly useful for vendors who wish to deploy the plugin even if firefox is not currently installed, or who want to use the automatic extension up
date mechanism to up
date their plugin to a newer version.
...one of the additional things that can be placed in the install.rdf is called an up
dateurl.
... for example: <em:up
dateurl><http://www.rhapsody.com/up
date.rdf></em:up
dateurl> this url specifies an rdf file that can be used to tell firefox that there are up
dates available for your extension.
... this rdf file can be up
dated to indicate that an up
date to our extension/plugin is available.
Jetpack Processes - Archive of obsolete content
to prevent such memory leaks, a process can either invali
date a handle, immediately preventing it from being passed as a message argument, or it can unroot the handle, allowing it to be passed as a message argument until all references to it are removed, at which point it is garbage collected.
... handles have the following native methods and properties: invali
date() invali
dates the handle.
... either process may invali
date a handle when it is no longer useful.
...oninvali
date a callback to call when the handle is garbage collected, either through an explicit call to invali
date() or being unrooted and then unreachable.
Signing an XPI - Archive of obsolete content
note: these instructions are out
dated.
... this article is a mirror of the original, with minor reformatting, some new info and all links up
dated in march 2010.
...mytestcert u,u,cu certum root ca ct,c,c certum level iii ca c,c,c code signing (certum) u,u,u you should notice that the existing certificate has been up
dated.
...echo started at %
date% %time% > %x%\build.log md build\chrome cd chrome zip -r -0 "%x%.jar" * >> %x%\build.log move "%x%.jar" ..\build\chrome >> %x%\build.log cd ..
Tabbed browser - Archive of obsolete content
note that some http requests aren't associated with a tab; for example, rss feed up
dates, extension manager requests, xhr requests from xpcom components, etc.
... warning: this code should be up
dated to use nsiloadcontext instead of getinterface(components.interfaces.nsidomwindow).
... up
dated example is in section below this observe: function (subject, topic, data) { if (topic == "http-on-modify-request") { subject.queryinterface(components.interfaces.nsihttpchannel); var url = subject.uri.spec; /* url being requested.
...: achannel.loadgroup.notificationcallbacks; if (!notificationcallbacks) return null; var domwin = notificationcallbacks.getinterface(components.interfaces.nsidomwindow); return gbrowser.getbrowserfordocument(domwin.top.document); } catch (e) { dump(e + "\n"); return null; } } getting the browser that fires the http-on-modify-request notification (example code up
dated for loadcontext) here an example of the previous section is shown.
Index of archived content - Archive of obsolete content
extension developing add-ons displaying web content in an extension without security issues downloading json and javascript in extensions enhanced extension installation extension etiquette extension library extension packaging extension samples extension theming guidelines extension versioning, up
date and compatibility extensions support in seamonkey 2 firefox addons developer guide hiding browser chrome hotfix extension how to convert an overlay extension to restartless inline options install manifests installing extensions and themes from web pages interaction between privileged and non-privileged pages...
... install script template xpinstall api reference examples file.macalias file.windowsshortcut install.adddirectory install.addfile installtrigger.installchrome installtrigger.startsoftwareup
date trigger scripts and install scripts windows install file object methods install object methods properties ...
... engine extending gecko with xbl and xtf mozilla e4x rich web svg and canvas in mozilla xul - mozilla's xml user interface language xtech 2006 presentations xul explorer xulrunner application up
date article building xulrunner building xulrunner with python commandline components creating xulrunner apps with the mozilla build system creating a windows inno setup installer for xulrunner applications custom app bundles for mac os x debugging a xulrunner application deploying x...
...ticationinfo npn_getintidentifier npn_getproperty npn_getstringidentifier npn_getstringidentifiers npn_geturl npn_geturlnotify npn_getvalue npn_getvalueforurl npn_hasmethod npn_hasproperty npn_identifierisstring npn_intfromidentifier npn_invali
daterect npn_invali
dateregion npn_invoke npn_invokedefault npn_memalloc npn_memflush npn_memfree npn_pluginthreadasynccall npn_posturl npn_posturlnotify npn_releaseobject npn_releasevariantvalue npn_reloadplugins npn_removeproperty npn_...
Localizing an extension - Archive of obsolete content
the stockwatcher2.dtd file contains the mappings for the stockwatcher2.xul file: <!entity panel_loading "loading..."> <!entity menu_refresh_now.label "refresh now"> <!entity menu_apple.label "apple (aapl)"> <!entity menu_google.label "google (goog)"> <!entity menu_microsoft.label "microsoft (msft)"> <!entity menu_yahoo.label "yahoo (yhoo)"> up
date the xul files each xul file needs to reference its corresponding locale file.
... we also need to up
date the code to use the entities instead of the strings, so that the substitutions take place based on the currently active locale.
...up
date the chrome manifest to let firefox know about the locale files, we need to make a revision to our chrome.manifest file, adding one line for each localization: locale stockwatcher2 en-us chrome/locale/ this instructs firefox that the en-us localization is located in the chrome/locale/en-us directory.
...id="myextensionname-filename") up
date the javascript code now we're ready to revise the javascript code to load the strings from the string bundle instead of using literal strings.
Developing New Mozilla Features - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2004.
... if you’ve got a large patch, let the likely reviewers know when they might expect to see it if your timeframe is tight, check out the mozilla roadmap for milestone
dates and see if your feature will arrive at a time of furious activity.
... original document information author(s): mitchell baker last up
dated
date: october 30, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
JavaScript crypto - Archive of obsolete content
avoid using it and up
date existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
...d checked against a pre-installed certificate copy in the local certificate database) the public keys, wrapped encryption private key, and text string from the script (possibly containing naming or enrollment info) are signed by the user signed blob is returned to the script script submits signed blob and any other necessary info to the ca/ra ca/ra verifies signature on signed blob ca/ra vali
dates identity of user ca/ra sends wrapped encryption private key to kra kra sends escrow verification back to ca ca creates and signs certificates ca sends certificates back to the user (importusercertificates) typical use the ca's enrollment page could look something like this: <!doctype html> <h2>request a cert</h2> <form name="reqform" method="post" action="http://your.ra.site.org"> <p><in...
...en name=cert_request value=""> <p>name: <input type=text name=name value=""> <p>password: <input type=password name="password" value=""> <p><input type=submit name="send" value="submit"> </form> <script> /* the following values could be filled in by the server cgi */ var authenticator = "server_magic"; var keytransportcert = null; var crmfobject = null; var form = document.forms[0]; function vali
date() { // generate keys for nsm.
...peof(crypto.version) != "undefined") { crmfobject = crypto.generatecrmfrequest( "cn=" + form.name.value, form.password.value, authenticator, keytransportcert, "setcrmfrequest();", 1024, null, "rsa-dual-use"); } return false; } function setcrmfrequest() { form.cert_request.value = crmfobject.request; form.submit(); } form.onsubmit = vali
date; </script> on completion of the request, the ca may submit a page that looks something like this: <!doctype html> <h2>certificate request successful</h2> <p>hit 'load' to load your certificate</p> <form name="reqform"> <p><input type=submit name="load" value="submit"></p> </form> <script> /* the following values could be filled in by the server cgi */ var nickname= "mycertnickname"; var cert =...
Twitter - Archive of obsolete content
for example, the twitter method for tweeting, statuses/up
date, maps to jetpack.lib.twitter.statuses.up
date().
...example: jetpack.lib.twitter.statuses.up
date({ data: { status: "o frabjous day!" }, username: "basic_auth_username", password: "basic_auth_password", success: function () console.log("hey!") }); user authentication you can supply a username and password to methods that require authentication using the second, more advanced call style described above.
...when you call a method that requires authentication -- such as jetpack.lib.twitter.statuses.up
date() -- without providing a username or password, firefox will prompt the user for them if she is not already authenticated with twitter.
... example usage tweeting jetpack.lib.twitter.statuses.up
date({ status: "o frabjous day!" }); firefox will prompt for a username and password if the user is not already authenticated with twitter.
Menu - Archive of obsolete content
null is recommended because it stands out.) function a menuitem that will up
date itself when its menu is shown.
...examples before running any examples, import the api from the future: jetpack.future.import("menu"); snippets add a single, static menuitem to the jetpack menu that doesn't do anything: jetpack.menu.add("two drink holders and a captain's chair"); add a menuitem to the jetpack menu that displays the current
date and time each time it's opened: jetpack.menu.add(function () new
date().tostring()); click an item in the jetpack menu to be notified of the current
date and time: jetpack.menu.add({ label: "show current
date and time", command: function () jetpack.notifications.show(new
date()) }); the same, except on the content context menu: jetpack.menu.context.page.add({ label: "show current
date and...
... time", command: function () jetpack.notifications.show(new
date()) }); create a submenu within the content context menu.
...p://example.com/ice-cream.png", menu: new jetpack.menu(["vanilla", "chocolate", "pistachio", null, "none"]), command: function (menuitem) jetpack.notifications.show(menuitem.label) }); add an item to the hyperlink context menu that tweets the link: jetpack.menu.context.page.on("a").add(function (context) { return { label: "tweet", command: function () jetpack.lib.twitter.statuses.up
date({ status: context.node.href }) }; )); add an item to the page's context menu depending on some complex criteria that can't be completely expressed via a css selector: jetpack.menu.context.page.beforeshow = function (menu, context) { menu.reset(); if (matchesmycriteria(context)) menu.add("match!"); }; add an item to both the hyperlink context menu and the image context menu: ...
Simple Storage - Archive of obsolete content
jetpack.storage.simple.notes = jetpack.storage.simple.notes || []; var notes = jetpack.storage.simple.notes; // up
dates the jetpack menu with the current notes.
...function up
datejetpackmenu() { jetpack.menu.set({ label: "notes", menu: new jetpack.menu(notes.length > 0 ?
...:( jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); up
datejetpackmenu(); } }); }; // initialize the jetpack menu with the current notes.
... up
datejetpackmenu(); see also settings jep 11 ...
Modularization techniques - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2004.
...this sample code should be up
dated to reflect this, but it gives you a good basic understanding of com from the c++ perspective.
... links the component object model specification revision history feb 25, 1998, created oct 19, 1998, dusted off momentarily oct 10, 1999, added comments about xpidl, language-independentness original document information author(s): will scullin last up
dated
date: september 13, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details ...
Mozilla Application Framework in Detail - Archive of obsolete content
in addition, independent software developers and corporate information technology departments now have complete access to the modular source code and freedom to freely license the source, make changes and build customized versions to accommo
date their individual needs.
...xpinstall makes it easy to write both simple installation scripts and complex installations that check versions, log installation data to the local system, execute other installers, and up
date the appropriate registry settings.
...the mozblog application hosted at mozdev.org, for example, uses xpinstall to make several different versions available simultaneously as up
dates are made and the browser itself advances versions.
... original document information author(s): myk melez, ian oeschger original document: http://www.mozilla.org/why/framework-details.html last up
dated
date: february 15, 2006 copyright information: copyright (c) myk melez, ian oeschger ...
Space Manager High Level Design - Archive of obsolete content
during reflow, the space manager stores the space taken up by floats (up
datespacemanager in nsblockframe) and provides information about the space available for other elements (getavailablespace in nsblockreflowstate).
...this happens in the method nsblockreflowstate::recoverfloats and nsblockreflowstate::flowandplacefloat (formerly this was done in nsblockframe::up
datespacemanager).
... if the block has any block children, then translate the space manager to the child block's origin and up
date the space manager in the context for the child block, recursively.
...e) nsblockframe::paint is mucking with nsblockbanddata in and #if 0 block - remove that and the include (compiles fine) nsspacemanger has no way of clearing the float damage interval set - this might be needed if the spacemanager persists beyond a reflow original document information author(s): marc attinasi other contributors: alex savulov, chris waterson, david baron, josh soref last up
dated
date: november 20, 2005 ...
The life of an HTML HTTP request - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 1999.
...this is used to create and up
date the nsiframe hierarchy.
... original document information author(s): alexander larsson last up
dated
date: october 8, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Learn XPI Installer Scripting by Example - Archive of obsolete content
mozilla cross-platform installations use the xpi format as a way to organize, compress, and automate software installations and software up
dates.
... adding files and directories (full of files) to the install once you have verified that the target can accomo
date the software to be installed and initialized the actual installation, you must add files and directories to the installation in order to have them installed.
... minimally, the installation script must: call initinstall with the name and version of the executable (the version is not optional, though you may or may not use the version in subsequent installations or up
dates) find somewhere to put the installed files.
... original document information author(s): ian oeschger last up
dated
date: 01/26/2006 copyright information: copyright (c) ian oeschger ...
Broadcasters and Observers - Archive of obsolete content
in the latter case, various user interface elements might need to up
date when the user switches from offline mode to online mode.
...if the value of the label attribute on the broadcaster changes, the observers will up
date the values of their label attributes also.
...whenever the value of any of the attributes on the broadcaster changes, the observers are all notified and they up
date their own attributes to match.
...the only attributes that are not up
dated are the id and persist attributes; these attributes are never shared.
Tree View Details - Archive of obsolete content
the view should then perform any necessary operations to retrieve the child rows and then up
date the tree with the new rows.
...ecount); this.treebox.rowcountchanged(idx + 1, -deletecount); } } else { item[2] = true; var label = this.visibledata[idx][0]; var toinsert = this.childdata[label]; for (var i = 0; i < toinsert.length; i++) { this.visibledata.splice(idx + i + 1, 0, [toinsert[i], false]); } this.treebox.rowcountchanged(idx + 1, toinsert.length); } this.treebox.invali
daterow(idx); } first we will need to check if the row is a container.
...the easiest way to do this is to invali
date the row.
...box.rowcountchanged(idx + 1, -deletecount); } } else { item[2] = true; var label = this.visibledata[idx][0]; var toinsert = this.childdata[label]; for (var i = 0; i < toinsert.length; i++) { this.visibledata.splice(idx + i + 1, 0, [toinsert[i], false]); } this.treebox.rowcountchanged(idx + 1, toinsert.length); } this.treebox.invali
daterow(idx); }, getimagesrc: function(idx, column) {}, getprogressmode : function(idx,column) {}, getcellvalue: function(idx, column) {}, cycleheader: function(col, elem) {}, selectionchanged: function() {}, cyclecell: function(idx, column) {}, performaction: function(action) {}, performactiononcell: function(action, index, column) {}, getrowproperties: function(idx, prop) {}, ...
XUL controls - Archive of obsolete content
<colorpicker type="button" color="#cc0080"/> colorpicker reference <
datepicker> a set of textboxes which may be used to allow the entry of a
date.
... <
datepicker value="2007/03/26"/>
datepicker reference <
datepicker type="grid"> a
datepicker which displays a calendar grid for selecting a
date.
... <
datepicker type="grid" value="2007/02/20"/>
datepicker reference <
datepicker type="popup" > a
datepicker which displays a set of textboxes for
date entry, but also has a button for displaying a popup calendar grid.
... <
datepicker type="popup" value="2008/08/24"/>
datepicker reference <description> the description element is used for descriptive text.
XULRunner Hall of Fame - Archive of obsolete content
version up
dates match the rapid release cycle.
...source yoono desktop win/mac application to get all your friend up
dates, up
date your status and share stuff easily across facebook, myspace, twitter, and more - all at once!
... inactive projects these projects appear to be less actively developed, with no up
dates since 2010.
...an up
dated version of "mybrowser" that works with firefox 25.0.1+ is available in matthew kastor's xulrunner examples at https://github.com/matthewkastor/xulrunner-examples/ exch a currency conversion tool using up
dated data from http://finance.yahoo.com/currency.
Extentsions FAQ - Archive of obsolete content
you must remove up
dateurl from the install.rdf and use a known to amo minversion/maxversion.
...however not all servers support user flags, in which case you get reduced functionality as follows: all flags are stored in your local cache and are lost if your cache gets invali
dated, and only "known" properties are copied when messages are copied.
... friday, september 29 - october 6, 2006 (↑ top) how can we programmatically extract the subject, sender,
date and the body of an e- mail when you are reading one (in thunderbird presumably)?
... friday, october 6 - 13, 2006 (↑ top) has anyone experienced problem with up
date that it only considers themes and extensions during the up
date check, ignoring langpacks with firefox 2.0?
2006-10-06 - Archive of obsolete content
test resumt will be found here another lightning localization up
date with some bad news difference has been located between sunbird_0_3_branch (for sunbird 0.3) and mozilla_1_8_branch.
... sunbird/lightning localization up
date you need to up
date your localization if you want your locale to ship with lightning 0.3 or sunbird 0.3.
... calendar localization up
date rc1 for sunbird 0.3 is out now and ready for testing.
... discussions status up
date fx2 status up
date for firefox 2.
2006-12-01 - Archive of obsolete content
firefox 1.5.0.9/2.0.0.1 up
date - we need help!
... jay patael calls for help getting the next up
date ff 1.5.x and 2.x.
... automatic configure up
dated back preed announces that the machine that does the automatic autoconf/configure generation (egg.build.mozilla.org) is back up.
...watch #grandparadiso for up
dates.
NPClass - Archive of obsolete content
syntax struct npclass { uint32_t structversion; npallocatefunctionptr allocate; npdeallocatefunctionptr deallocate; npinvali
datefunctionptr invali
date; nphasmethodfunctionptr hasmethod; npinvokefunctionptr invoke; npinvokedefaultfunctionptr invokedefault; nphaspropertyfunctionptr hasproperty; npgetpropertyfunctionptr getproperty; npsetpropertyfunctionptr setproperty; npremovepropertyfunctionptr removeproperty; npenumerationfunctionptr enumerate; npconstructfunctionptr construct; }; warning: don't call these routines directly.
... invali
date called on live objects that belong to a plugin instance that is being destroyed.
...any attempt to use an invali
dated object will result in undefined behavior.
... function pointer syntax typedef npobject *(*npallocatefunctionptr)(npp npp, npclass *aclass); typedef void (*npdeallocatefunctionptr)(npobject *npobj); typedef void (*npinvali
datefunctionptr)(npobject *npobj); typedef bool (*nphasmethodfunctionptr)(npobject *npobj, npidentifier name); typedef bool (*npinvokefunctionptr)(npobject *npobj, npidentifier name, const npvariant *args, uint32_t argcount, npvariant *result); typedef bool (*npinvokedefaultfunctionptr)(npobject *npobj, ...
Shipping a plugin as a Toolkit bundle - Archive of obsolete content
providing up
dates when plugins are packaged in this way they can make use of the built in add-on up
date system.
... this allows a remote up
date file to be read periodically and an up
dated version of the plugin offered to the user or to mark the plugin as compatible with a wider range of applications.
... this is performed by including an up
dateurl in the install manifest.
... this should point to an up
date.rdf file on the internet which will include the up
dated versions and version information for the plugin.
Building a Theme - Archive of obsolete content
introduction this tutorial will take you through the steps required to build a very basic theme - one which up
dates the background color of the toolbars in firefox.
... for this tutorial, we're going to up
date the background color of the toolbars.
... you can now go back and make additional changes to your css files, close and restart firefox, and see the up
dates.
... on mac os or linux, you can use the command-line zip tool: zip -r my_theme.xpi install.rdf chrome.manifest browser communicator global mozapps or, if you have 7-zip installed, you can use that for zipping it up: 7z a -tzip my_theme.xpi chrome chrome.manifest note: the command-line tool will up
date an existing zip file, not replace it - so if you have files you've deleted from your theme, be sure to remove the .xpi file before running the zip command again.
Archived JavaScript Reference - Archive of obsolete content
it's equivalent to object.observe() invoked with the accept type list ["add", "up
date", "delete", "splice"].
...this operation leaves oldbuffer in a detached state.
date.prototype.tolocaleformat()the non-standard tolocaleformat() method converts a
date to a string using the specified formatting.
... intl.
datetimeformat is an alternative to format
dates in a standards-compliant way.
... see also the newer version of
date.prototype.tolocale
datestring().ecmascript 2016 to es.next support in mozillaexpression closuresexpression closures are a shorthand function syntax for writing simple functions.for each...inthe for each...in statement iterates a specified variable over all values of object's properties.
Bounding volume collision detection with THREE.js - Game development
so if we apply transformations or change the position of the mesh, we need to manually up
date the bounding sphere.
... the advantages of using this helper are: it has an up
date() method that will resize its bounding box mesh if the linked mesh rotates or changes its dimensions, and up
date its position.
...we need to call the up
date() method so the boxhelper instance matches its linked mesh.
... knot.position.set(-3, 2, 1); knot.rotation.x = -math.pi / 4; // up
date the bounding box so it stills wraps the knot knotboxhelper.up
date(); box3.setfromobject(knotboxhelper); performing collision tests is done in the same way as explained in the above section — we use our box3 object in the same way as described above.
Implementing game control mechanisms - Game development
every state has its own default methods: preload(), create(), and up
date().
... the first one is needed for preloading required assets, create() is executed once the state had started, and up
date() is executed on every frame.
...} it will be created once at the start of the game, and will execute this.clickenclave() action assigned to it when clicked, but you can also use the mouse's pointer value in the up
date() function to make an action: up
date: function() { // ...
...we'll be playing mostly with the mainmenu.js and game.js files, and we'll explain the code inside the create() and up
date() methods in much more detail in later articles.
Move the ball - Game development
now, let's draw the ball — add the following inside your draw() function: ctx.beginpath(); ctx.arc(50, 50, 10, 0, math.pi*2); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); try your up
dated code now — the ball should be repainted on every frame.
... first, add the following two lines above your draw() function, to define x and y: var x = canvas.width/2; var y = canvas.height-30; next up
date the draw() function to use the x and y variables in the arc() method, as shown in the following highlighted line: function draw() { ctx.beginpath(); ctx.arc(x, y, 10, 0, math.pi*2); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); } now comes the important part: we want to add a small value to x and y after every frame has been drawn to make it appear that the ball i...
...add the following below your x and y variable definitions: var dx = 2; var dy = -2; the last thing to do is to up
date x and y with our dx and dy variable on every frame, so the ball will be painted in the new position on every up
date.
...every 10 milliseconds the canvas is cleared, the blue circle (our ball) will be drawn on a given position and the x and y values will be up
dated for the next frame.
Initialize the framework - Game development
, and add the following code to it: <!doctype html> <html> <head> <meta charset="utf-8" /> <title>gamedev phaser workshop - lesson 01: initialize the framework</title> <style>* { padding: 0; margin: 0; }</style> <script src="js/phaser.min.js"></script> </head> <body> <script> var game = new phaser.game(480, 320, phaser.canvas, null, { preload: preload, create: create, up
date: up
date }); function preload() {} function create() {} function up
date() {} </script> </body> </html> downloading the phaser code next, we need to go through the process of downloading the phaser source code and applying it to our html document.
... up
date the src value of the first <script> element as shown above.
... the id of the <canvas> to use for rendering if one already exists on the page (we've specified null because we want phaser to create its own.) the names to use for phaser's three key functions that load and start the game, and up
date the game loop on every frame; we will use the same names to keep it clean.
... preload takes care of preloading the assets create is executed once when everything is loaded and ready up
date is executed on every frame.
Player paddle and controls - Game development
to enable collision detection between the paddle and ball, add the collide() method to the up
date() function as shown: function up
date() { game.physics.arcade.collide(ball, paddle); } the first parameter is one of the objects we are interested in — the ball — and the second is the other one, the paddle.
...add the following new line to the up
date() function, as shown: function up
date() { game.physics.arcade.collide(ball, paddle); paddle.x = game.input.x; } now on every new frame the paddle's x position will adjust accordingly to the input's x position, however when we start the game, the position of the paddle is not in the middle.
...up
date the previous line as follows: paddle.x = game.input.x || game.world.width*0.5; if you haven't already done so, reload your index.html and try it out!
...) line and up
date it to the following: ball.body.velocity.set(150, -150); now the ball will start right from the middle of the paddle.
Build your own function - Learn web development
first of all, up
date the first line of the function: function displaymessage() { to this: function displaymessage(msgtext, msgtype) { now when we call the function, we can provide two variable values inside the parentheses to specify the message to display in the message box, and the type of message it is.
... to make use of the first parameter, up
date the following line inside your function: msg.textcontent = 'this is a message box'; to msg.textcontent = msgtext; last but not least, you now need to up
date your function call to include some up
dated message text.
...first, up
date the .msgbox width from: width: 200px; to width: 242px; next, add the following lines inside the .msgbox p { ...
... let's test out our up
dated function, try updating the displaymessage() call from this: displaymessage('woo, this is a different message!'); to one of these: displaymessage('your inbox is almost full — delete some mails', 'warning'); displaymessage('brian: hi there, how are you today?','chat'); you can see how useful our (now not so) little function is becoming.
Introduction to web APIs - Learn web development
apis that fetch data from the server to up
date small sections of a webpage on their own are very commonly used.
... this seemingly small detail has had a huge impact on the performance and behaviour of sites — if you just need to up
date a stock listing or list of available new stories, doing it instantly without having to reload the whole entire page from the server can make the site or app feel much more responsive and "snappy".
... apis for drawing and manipulating graphics are now widely supported in browsers — the most popular ones are canvas and webgl, which allow you to programmatically up
date the pixel data contained in an html <canvas> element to create 2d and 3d scenes.
...examples include telling the user that a useful up
date is available on a web app via system notifications (see the notifications api) or vibration hardware (see the vibration api).
Ember app structure and componentization - Learn web development
up
date the application.hbs file again so its content looks like this: <section class="todoapp"> <h1>todos</h1> <input class="new-todo" aria-label="what needs to be done?" placeholder="what needs to be done?" autofocus > <section class="main"> <input id="mark-all-complete" class="toggle-all" type="checkbox"> <label for="mark-all-complete">mark all as complete</label> ...
... the header.hbs file should be up
dated to contain the following: <input class="new-todo" aria-label="what needs to be done?" placeholder="what needs to be done?" autofocus > todo-list.hbs should be up
dated to contain this chunk of code: <section class="main"> <input id="mark-all-complete" class="toggle-all" type="checkbox"> <label for="mark-all-complete">mark all as complete</label> <ul class="todo-list"> ...
...into the todo.hbs file: <li> <div class="view"> <input aria-label="toggle the completion of this todo" class="toggle" type="checkbox" > <label>buy movie tickets</label> <button type="button" class="destroy" title="remove this todo" ></button> </div> <input autofocus class="edit" value="todo text"> </li> footer.hbs should be up
dated to contain the following: <footer class="footer"> <span class="todo-count"> <strong>0</strong> todos left </span> <ul class="filters"> <li> <a href="#">all</a> <a href="#">active</a> <a href="#">completed</a> </li> </ul> <button type="button" class="clear-completed"> clear completed </button> </footer> finally, the contents of application.
...hbs should be up
dated so that they call the appropriate components, like so: <section class="todoapp"> <h1>todos</h1> <header /> <todolist /> <footer /> </section> with these changes made, run npm start in your terminal again, then head over to http://localhost:4200 to ensure that the todo app still looks as it did before the refactor.
Accessibility in React - Learn web development
the textbox <input> in your editing template should be up
dated like this: <input id={props.id} classname="todo-text" type="text" value={newname} onchange={handlechange} ref={editfieldref} /> the "edit" button in your view template should read like this: <button type="button" classname="btn" onclick={() => setediting(true)} ref={editbuttonref} > edit <span classname="visually-hidden">{props.name}</span> </button> focusing on our ref...
... up
date your existing useeffect() hook so that it reads like this: useeffect(() => { if (isediting) { editfieldref.current.focus(); } }, [isediting]); these changes make it so that, if isediting is true, react reads the current value of the editfieldref and moves browser focus to it.
...let's try it now — up
date your useeffect() call like so: useeffect(() => { if (isediting) { editfieldref.current.focus(); } else { editbuttonref.current.focus(); } }, [isediting]); this kind of mostly works.
...we want this constant to track the previous value of isediting, so we call useprevious with isediting as an argument: const wasediting = useprevious(isediting); with this constant, we can up
date our useeffect() hook to implement the pseudocode we discussed before — up
date it as follows: useeffect(() => { if (!wasediting && isediting) { editfieldref.current.focus(); } if (wasediting && !isediting) { editbuttonref.current.focus(); } }, [wasediting, isediting]); note that the logic of useeffect() now depends on wasediting, so we provide it in the array of dependencies.
Styling Vue components with CSS - Learn web development
up
date your app.vue file’s <style> element so it looks like so: <style> /* global styles */ .btn { padding: 0.8rem 1rem 0.7rem; border: 0.2rem solid #4d4d4d; cursor: pointer; text-transform: capitalize; } .btn__danger { color: #fff; background-color: #ca3c3c; border-color: #bd2130; } .btn__filter { border-color: lightgrey; } .btn__danger:focus { outline-color: #c82333; } .btn__prima...
... up
date your todoform template so that it looks like this: <template> <form @submit.prevent="onsubmit"> <h2 class="label-wrapper"> <label for="new-todo-input" class="label__lg"> what needs to be done?
... up
date it as follows: <ul aria-labelledby="list-summary" class="stack-large"> adding scoped styles the last component we want to style is our todoitem component.
...the up
dated template is below: the app should now have custom checkboxes.
Understanding client-side JavaScript frameworks - Learn web development
here we'll get the todo counter to up
date to show the correct number of todos still to complete, and correctly apply styling to completed todos (i.e.
...to do this, we will take advantage of vue's conditional rendering capabilities — namely v-if and v-else — to allow us to toggle between the existing todo item view and an edit view where you can up
date todo item labels.
...we'll componentize our app, then add more functionality to allow users to up
date existing components.
...that list would be very difficult to keep up-to-
date anyway, as new ones appear all the time.
Introducing a complete toolchain - Learn web development
however, bear in mind that if you want to refine and enforce a rule about how your code looks (or vali
dates), it's very likely that it can be done with the right eslint configuration.
... parcel also installs the dependencies that we will use in our code, including react, react-dom, react-async-hook,
date-fns, and format-number.
... another clever trick parcel has up its sleeve is that any changes to your source code will now trigger an up
date in the browser.
...you’ll notice that the browser has automatically refreshed, and the line “<
date> there will be <number> near misses” at the top of the page has been changed!
Client-side tooling overview - Learn web development
if you are using the npm package manager to manage your dependencies for example, it is a good idea to go to the npm homepage and search for the type of tool you are looking for, for example try searching for "
date" if you want a
date formating utility, or "formatter" if you are searching for a general code formatter.
... pay attention to the popularity, quality, and maintenance scores, and how recently the package was last up
dated.
...based on these criteria, the
date-fns library looks like a good
date formatting tool to use.
...the
date-fns docs for example are pretty good, complete, and easy to follow.
Index
685 obsolete add-ons, archive, look & feel, obsolete, themes this page contains theme documents and resources that we don't expect will ever be up
dated, but which we're keeping for the time being as potential source material for up
dated docs.
... 689 up
dates firefox supports automated up
dates to add-ons using json up
date manifests.
... add-ons hosted on amo automatically receive up
dates to new versions posted there.
... other add-ons must specify the location of their up
date manifests.
Add-on Manager
finding up
dates add-ons can be checked for up
dates using the findup
dates() method.
... it must be passed an up
datelistener to receive information about compatibility information and new up
date information.
... any available up
date is returned as an addoninstall which is ready to be downloaded and installed.
...the getstartupchanges() method lets you find out which add-ons were installed, removed, up
dated, enabled, or disabled at application startup.
Download
this value starts at zero, and may be up
dated regardless of the value of hasprogress.
... you should use the individual state properties instead, since this value may not be up
dated after the last piece of data is transferred.
... starttime read only
date indicates the start time of the download.
... when the download starts, this property is set to a valid
date object.
Release phase
if you haven't already cloned the remote repository, enter this command: hg clone ssh://hg.mozilla.org/releases/l10n-central/x-testing mercurial will let you know that it's cloning the repository: destination directory: x-testing requesting all changes adding changesets adding manifests adding file changes added 4 changesets with 242 changes to 239 files updating to branch default 239 files up
dated, 0 files merged, 0 files removed, 0 files unresolved the default push url is the same as the default pull url (i.e., ssh://hg.mozilla.org/releases/l10n-central/x-testing).
...here's how that's done: run this command to see recent commits in your local clone: $ hg log -l 3 you should a list of the most recent commits, similar to this one: changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com>
date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings now run the hg outgoing command to compare the local repository on your machine with the remote repository on hg.mozilla.org.
...the output will look something like this: comparing with ssh://hg.mozilla.org/releases/l10n-central/x-testing searching for changes changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com>
date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings make sure this output is accurate before continuing.
...the merge
date for migrating from one product release channel to the next is rapidly approaching.
NSPR Contributor Guide
if several platforms cannot be made to implement your api, then it is not a good candi
date for inclusion in nspr.
... before you begin what may be a substantial effort in making a candi
date feature for nspr, talk to us.
... we may tell you that you have a good idea; we may say that it really is not a good candi
date for inclusion in nspr; we may give you suggestions on what would make it more generalized, hence a good candi
date for inclusion in nspr.
... original document information author: reed@reedloden.com last up
dated
date: november 2, 2006 ...
Encrypt Decrypt MAC Keys As Session Objects
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macup
date(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macup
date(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
Encrypt and decrypt MAC using token
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macup
date(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macup
date(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
NSS 3.55 release notes
dtls 1.3 implementation is up
dated to draft-38.
... nspr dependency up
dated to 4.27.
... bug 1647752 - up
date dtls 1.3 implementation to draft-38.
... bug 1652331 - up
date nss 3.55 nspr version to 4.27.
NSS API Guidelines
the preferred format is: "@(#) $rcsfile: nss-guidelines.html, v $ $revision: 48936 $ $
date: 2009-08-11 07:45:57 -0700 (tue, 11 aug 2009) $ $name$" you can put the string in a comment or in a static char array.
... here is an example from lib/base/baset.h: #ifdef debug static const char baset_cvs_id[] = "@(#) $rcsfile: nss-guidelines.html, v $ $revision: 48936 $ $
date: 2009-08-11 07:45:57 -0700 (tue, 11 aug 2009) $ $name$"; #endif /* debug */ the difference, between this and id, is that id has some useless information (every file is "experimental"), and doesn't have name.
...for instance, in most ssl functions this is the nspr socket, or the ssl socket structure: up
date, final, encrypt, decrypt type functions operating on their state contexts, etc.
... all hashing up
date, macing up
date, and encrypt/decrypt functions which act like filters should have a consistent signature: secstatus pk11_digestop(pk11context *context, unsigned char *inbuf, secbufferleninlen) functions like these which have different properties, for example, additional parameters, callbacks, etc., should insert their additional parameters between th...
Encrypt Decrypt_MAC_Using Token
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing.
... */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null...
...*/ nwritten = pr_write(encfile, encbuf, encbuflen); /* pr_assert(nwritten == encbuflen); */ rv = macup
date(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...*/ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macup
date(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file.
NSS Sample Code Sample_3_Basic Encryption and MACing
null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxle...
... pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * write to header file */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = n...
...= secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macup
date(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess...
...ext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macup
date(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; br...
EncDecMAC using token object - sample 3
the symmetric key */ key = pk11_tokenkeygen(slot, mechanism, null, keysize, keyid, pr_true, pwdata); if (!key) { pr_fprintf(pr_stderr, "symmetric key generation failed \n"); } return key; } /* * macinit */ secstatus macinit(pk11context *ctx) { secstatus rv = pk11_digestbegin(ctx); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestbegin()\n"); } return rv; } /* * macup
date */ secstatus macup
date(pk11context *ctx, unsigned char *msg, unsigned int msglen) { secstatus rv = pk11_digestop(ctx, msg, msglen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : digestop()\n"); } return rv; } /* * finalize macing */ secstatus macfinal(pk11context *ctx, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = pk11_digestfinal(ctx, mac, ...
...maclen, maxlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "compute mac failed : pk11_digestfinal()\n"); } return secsuccess; } /* * compute mac */ secstatus computemac(pk11context *ctxmac, unsigned char *ptext, unsigned int ptextlen, unsigned char *mac, unsigned int *maclen, unsigned int maxlen) { secstatus rv = macinit(ctxmac); if (rv != secsuccess) return rv; rv = macup
date(ctxmac, ptext, ptextlen); if (rv != secsuccess) return rv; rv = macfinal(ctxmac, mac, maclen, maxlen); return rv; } /* * writetoheaderfile */ secstatus writetoheaderfile(const char *buf, unsigned int len, headertype type, prfiledesc *outfile) { secstatus rv; char header[40]; char trailer[40]; char *outstring = null; switch (type) { case symkey: strcpy(header, enckey_header); strcpy(trailer, enckey_trailer); break; ca...
...size; } rv = encrypt(ctxenc, encbuf, &encbuflen, sizeof(encbuf), ptext, ptextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "encrypt failure\n"); goto cleanup; } /* save the last block of ciphertext as the next iv */ iv = encbuf; ivlen = encbuflen; /* write the cipher text to intermediate file */ nwritten = pr_write(encfile, encbuf, encbuflen); /*pr_assert(nwritten == encbuflen);*/ rv = macup
date(ctxmac, ptext, ptextlen); } rv = macfinal(ctxmac, mac, &maclen, digestsize); if (rv != secsuccess) { pr_fprintf(pr_stderr, "macfinal failure\n"); goto cleanup; } if (maclen == 0) { pr_fprintf(pr_stderr, "bad mac length\n"); rv = secfailure; goto cleanup; } writetoheaderfile(mac, maclen, mac, headerfile); if (rv != secsuccess) { pr_fprintf(pr_stderr, "write mac failure\n"); goto cleanup; } pad[0] ...
...k, iv, ivlen, ckm_aes_cbc); filelength = filesize(encryptedfilename); while ((ctextlen = pr_read(infile, ctext, sizeof(ctext))) > 0) { count += ctextlen; /* decrypt cipher text buffer using cbc and iv */ rv = decrypt(ctxenc, decbuf, &decbuflen, sizeof(decbuf), ctext, ctextlen); if (rv != secsuccess) { pr_fprintf(pr_stderr, "decrypt failure\n"); goto cleanup; } if (decbuflen == 0) break; rv = macup
date(ctxmac, decbuf, decbuflen); if (rv != secsuccess) { goto cleanup; } if (count == filelength) { decbuflen = decbuflen-paddinglength; } /* write the plain text to out file */ temp = pr_write(outfile, decbuf, decbuflen); if (temp != decbuflen) { pr_fprintf(pr_stderr, "write error\n"); rv = secfailure; break; } /* save last block of ciphertext */ memcpy(iv, decbuf, decbuflen); ivlen = decbuflen; bloc...
NSS tools : certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... certutil -d -d [sql:]directory -n "nickname" for example: $ certutil -d -d sql:/home/my/sharednssdb -n "my-ssl-cert" validating certificates a certificate contains an expiration
date in itself, and expired certificates are easily rejected.
... however, certificates can also be revoked before they hit their expiration
date.
... certutil -v -n certificate-name [-b time] [-e] [-u cert-usage] -d [sql:] directory for example, to vali
date an email certificate: $ certutil -v -n "john smith's email cert" -e -u s,r -d sql:/home/my/sha rednssdb modifying certificate trust settings the trust settings (which relate to the operations that a certificate is allowed to be used for) can be changed after a certificate is created or added to the database.
certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... certutil -d -d [sql:]directory -n "nickname" for example: $ certutil -d -d sql:/home/my/sharednssdb -n "my-ssl-cert" validating certificates a certificate contains an expiration
date in itself, and expired certificates are easily rejected.
... however, certificates can also be revoked before they hit their expiration
date.
... certutil -v -n certificate-name [-b time] [-e] [-u cert-usage] -d [sql:]directory for example, to vali
date an email certificate: $ certutil -v -n "john smith's email cert" -e -u s,r -d sql:/home/my/sharednssdb modifying certificate trust settings the trust settings (which relate to the operations that a certificate is allowed to be used for) can be changed after a certificate is created or added to the database.
NSS tools : signtool
-i scriptname specifies the name of an installer script for smartup
date.
... this script installs files from the jar archive in the local system after smartup
date has vali
dated the digital signature.
...for information on using the -m option to verify fips-140-1 vali
dated mode, see "netscape signing tool and fips-140-1".
...this option is useful if you want the expiration
date of the signature checked against the current
date and time rather than the time the files were signed.
Multithreading in Necko
warning: the content of this article may be out of
date.
... it was last up
dated in 2001.
...file, finger,
datetime) do not worry about threading issues.
... original document information author(s): darin fisher last up
dated
date: december 10, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
SpiderMonkey Internals
standard library the methods for arrays, booleans,
dates, functions, numbers, and strings are implemented using the js api.
...the line-to-pc direction "rounds" toward the next bytecode generated from a line greater than or equal to the input line, and may return the pc of a for-loop up
date part, if given the line number of the loop body's closing brace.
... jsarray.*, jsbool.*, js
date.*, jsfun.*, jsmath.*, jsnum.*, jsstr.* these file pairs implement the standard classes and (where they exist) their underlying primitive types.
...to make matters worse, java (and therefore javascript) uses "local" time numbers (offsets from the epoch) in its
date class.
A Web PKI x509 certificate primer
self-sign csr (using sha256) and append the extensions described in the file "openssl x509 -req -sha256 -days 3650 -in example.csr -signkey key.pem -set_serial $any_integer -extfile openssl.ss.cnf -out example.pem" you can now use example.pem as your certfile cas included in firefox when you visit a secure website, firefox will vali
date the website’s certificate by checking that the certificate that signed it is valid, and checking that the certificate that signed the parent certificate is valid and so forth up to a root certificate that is known to be valid.
... generate your ca root up
date *.example.com and *.example.net below to match your domains.
...ertsign, crlsign extendedkeyusage =serverauth authorityinfoaccess = ocsp;uri:http://ocsp.example.com:8888/ sign the intermediate csr with the root key and the intermediate extensions "openssl x509 -req -sha256 -days 2922 -in int.csr -cakey rootkey.pem -ca root.pem -set_serial $some_large_integer -out int.pem -extfile openssl.int.cnf" generate the end entity certificate up
date www.example.com below to match your domain.
...for the end
date of the root cert created following the instructions in this page (year 2017).
AT APIs Support
but in the meantime it more up-to-
date and contains more details than existed analogues for at-spi and msaa this documentation explains how makers of screen readers, voice dictation packages, onscreen keyboards, magnification software and other assitive technologies can support gecko-based software.
...firefox extensions) gecko version for firefox and all other gecko-based products: this documentation applies to up-to-
date product builds based on gecko 1.9.2 -- currently not available on official releases.
...however it's preferable to grab the current build of firefox or any other gecko-based product to be up to
dated: firefox recent builds thunderbird recent builds seamonkey recent builds determining if accessibility is enabled in a firefox accessibility is enabled on windows and linux platforms by default.
...please note that the web docs are sometimes out of
date, and the latest at-spi is available on cvs.
imgIContainer
void frameup
dated(in unsigned long framenum, in nsintrect anewrect); native code only!
... return value missing description exceptions thrown missing exception missing description native code only!frameup
dated obsolete since gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1)this feature is obsolete.
...void frameup
dated( in unsigned long framenum, in nsintrect anewrect ); parameters framenum missing description anewrect missing description exceptions thrown missing exception missing description native code only!getcurrentframerect obsolete since gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1)this feature is obsolete.
...exceptions thrown missing exception missing description violates the xpcom interface guidelines requestrefresh() indicates that this imgicontainer has been triggered to up
date its internal animation state.
mozIAsyncHistory
mozilla.org/browser/history;1 as a service: var asynchistory = components.classes["@mozilla.org/browser/history;1"] .getservice(components.interfaces.moziasynchistory); method overview void getplacesinfo(in jsval aplaceidentifiers, in mozivisitinfocallback acallback); void isurivisited(in nsiuri auri, in mozivisitedstatuscallback acallback); void up
dateplaces(in moziplaceinfo, [optional] in mozivisitinfocallback acallback); methods getplacesinfo() starts an asynchronous request to determine whether or not a given uri has been visited; you must implement a callback to receive the result of the request.
... up
dateplaces() adds a set of visits for one or more moziplaceinfo objects, and up
dates each moziplaceinfo's title or guid.
...void up
dateplaces( in moziplaceinfo aplaceinfo, in mozivisitinfocallback acallback optional ); parameters aplaceinfo the moziplaceinfo object[s] containing the information to store or up
date.
... not providing a visit
date and transitiontype for each mozivisitinfo.
mozISpellCheckingEngine
when this attribute's value is changed, a "spellcheck-dictionary-up
date" notification is sent.
... when this changes, the spell checker sends a "spellcheck-dictionary-up
date" notification.
...when this changes, the spell checker sends a "spellcheck-dictionary-up
date" notification.
...when this changes, the spell checker sends a "spellcheck-dictionary-up
date" notification.
nsICRLInfo
lastup
date prtime the time this crl was created at.
... lastup
datelocale astring lastup
date formatted as a human readable string formatted according to the environment locale.
... nextup
date prtime the time the suggested next up
date for this crl.
... nextup
datelocale astring nextup
date formatted as a human readable string formatted according to the environment locale.
nsIDeviceMotion
methods addlistener() when called, the accelerometer support implementation must begin to notify the specified nsidevicemotionlistener by calling its nsidevicemotionlistener.onaccelerationchange() method as appropriate to share up
dated acceleration data.
... void addlistener( in nsidevicemotionlistener alistener ); parameters alistener the nsidevicemotionlistener object whose nsidevicemotionlistener.onaccelerationchange() method should be called with up
dated acceleration data.
... removelistener() tells the accelerometer to stop sending up
dates to the specified nsidevicemotionlistener.
... void removelistener( in nsidevicemotionlistener alistener ); parameters alistener the nsidevicemotionlistener object to which no further up
dates should be sent.
nsIEditorSpellCheck
g); void removewordfromdictionary(in wstring word); void replaceword(in wstring misspelledword, in wstring replaceword, in boolean alloccurrences); void savedefaultdictionary(); obsolete since gecko 9.0 void setcurrentdictionary(in astring dictionary); void setfilter(in nsitextservicesfilter filter); void uninitspellchecker(); void up
datecurrentdictionary(); methods addwordtodictionary() adds the specified word to the current personal dictionary.
...up
datecurrentdictionary() up
dates the dictionary in use to be sure it corresponds to what the editor needs.
... void up
datecurrentdictionary(); parameters none.
... remarks prior to gecko 9.0 (firefox 9.0 / thunderbird 9.0 / seamonkey 2.6), this method took one parameter, a reference to the nsieditor for which to up
date the spell checker.
nsIFile
much of the documentation has not been up
dated to reflect this change.
... note: if this method succeeds, this instance will be up
dated to point to the new file.
...[native character encoding variant] note: if this method succeeds, this instance will be up
dated to point to the new file.
... this method is identical to moveto except that if this file or directory is moved to a a different volume, it fails and if this method succeeds, this instance will not up
dated to point to the new file.
nsIGeolocationProvider
after startup() is called, any geo location change should call callback.up
date().
... the nsigeolocationprovider interface provides information about the current users location to interested parties via nsigeolocationup
date.
...method overview boolean isready(); obsolete since gecko 1.9.2 void shutdown(); void startup(); void watch(in nsigeolocationup
date callback); methods isready() obsolete since gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) reports whether or not the device is ready and has a position.
...void watch( in nsigeolocationup
date callback ); parameters callback an nsigeolocationup
date to be notified when position changes.
nsIMicrosummary
.0 inherits from: nsisupports last changed in gecko 1.9 (firefox 3) warning: microsummary support was removed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview void addobserver(in nsimicrosummaryobserver observer); boolean equals(in nsimicrosummary aother); void removeobserver(in nsimicrosummaryobserver observer); void up
date(); attributes attribute type description content astring the content of the microsummary.
... up
dateinterval long the minimum interval after which this microsummary would like to be refreshed or null if it doesn't care.
... up
date() up
date the microsummary, first loading its generator and page content as necessary.
...void up
date(); see also microsummary topics creating a microsummary ...
nsIWinAppHelper
method overview void fixreg(); obsolete since gecko 1.9 void postup
date(in nsilocalfile logfile); obsolete since gecko 1.9.2 attributes attribute type description usercanelevate boolean read only.
... postup
date() obsolete since gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) invokes helper.exe with the /postup
date parameter.
... this up
dates the uninstallation log so that the application can be uninstalled correctly after an up
date.
... void postup
date( in nsilocalfile logfile ); parameters logfile the file to use for the uninstallation log.
nsIXULAppInfo
attributes attribute type description appbuildid acstring the application's build id/
date, for example "2004051604".
...has to be defined for advanced application features such as the extension manager and up
date service.
... platformbuildid acstring the build id/
date of gecko and the xulrunner platform.
...can be an empty string, but a valid value is required for xul applications using the extension manager or up
date service.
XPCOM Interface Reference by grouping
ginmanager nsiloginmanagerstorage nsiloginmetainfo history nsiglobalhistory nsiglobalhistory2 nsiglobalhistory3 ssl nsibadcertlistener2 system action nsicancelable application application nsiapplicationup
dateservice nsiappshell nsiappshellservice nsiappstartup xul nsixulappinfo nsixulruntime nsixultemplatebuilder nsixultemplatequeryprocessor nsixultemplateresult bookmark livemark nsilivemarkserv...
...isocketproviderservice nsisockettransport nsisockettransportservice nsisupports nsiuuidgenerator debug nsistackframe device display nsiscreen nsiscreenmanager geolocation nsigeolocationprovider nsigeolocationup
date orientation nsiacceleration nsiaccelerationlistener nsiaccelerometer misc nsisound nsiwifimonitor document nsiwebnavigation environment nsienvironment event nsieventlisten...
... windows nsitaskbarpreview nsitaskbarpreviewbutton nsitaskbarpreviewcontroller nsitaskbarprogress nsitaskbartabpreview nsitaskbarwindowpreview nsiwintaskbar nsialertsservice nsiwebprogress nsiwebprogresslistener nsiwebprogresslistener2 up
date nsiup
date nsiup
datechecker nsiup
datechecklistener nsiup
dateitem nsiup
datemanager nsiup
datepatch nsiup
dateprompt nsiup
datetimermanager nsiprogramminglanguage thunderbird credentials nsimsgaccountmanagerextension element nsieditormailsupport ...
... message nsidbchangeannouncer nsidbchangelistener nsimessenger nsimsgcompfields nsimsgcustomcolumnhandler nsimsgdatabase nsimsgdbhdr nsimsgdbview nsimsgdbviewcommandup
dater nsimsgfolder nsimsgidentity nsimsgmessageservice nsimsgsendlater nsimsgthread nsimsgwindow nsimsgwindowcommands user history nsibrowserhistory nsibrowsersearchservice nsimicrosummary nsimicrosummarygenerator nsimicrosummaryobserver nsimicrosummaryservice nsimicrosummaryset ...
Mail and RDF
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 1999.
... reflecting data to rdf in order to have a dynamic ui that up
dates when the underlying content changes, a datasource must implement two key methods of reflecting data into rdf.
... content observers up
date ui.
Mail composition back end
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2000.
...od onprogress(const char *amsgid, - the message id for the message being sent pruint32 aprogress, - the progress so far pruint32 aprogressmax) = 0; - the maximum progress (aprogress should be used as a numerator and aprogressmax as a denominator for a message sent percentage) onstatus the onstatus gives the listener status up
dates for the current operation.
... ns_imethod onprogress( pruint32 acurrentmessage, - the current message being sent pruint32 atotalmessage) = 0; - the total messages to be sent createandsendmessage the onstatus gives the listener status up
dates for the current operation.
Mail event system
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2002.
...the folder pane needs to know that this changed so that it can up
date the message count so the user can see it.
...in its implementation of onintpropertychanged, it uses this information to up
date the message count in the dialog.
Demo Addon
to list some messages of the folder we use: for each (let msghdr in fixiterator(inbox.msgdatabase.enumeratemessages(), ci.nsimsgdbhdr)) { if (++i >= 10 && lastmsghdr != null) break; messages.push({ author: msghdr.mime2decodedauthor, subject: msghdr.mime2decodedsubject,
date: new
date(msghdr.
date/1000), }); //...
...we iterate over the first ten of them and extract author, subject and
date for each one.
...ylistener_onitemsremoved(aitems, acollection) { }, /* called when our database query completes */ onquerycompleted: function mylistener_onquerycompleted(acollection) { let items = acollection.items; let data = { messages: [], }; for (let i in items) { data.messages.push({ subject: items[i].subject,
date: items[i].
date, author: items[i].from.value, }); // ...
...for every gloda message subject,
date and author is extracted.
Edit fonts - Firefox Developer Tools
note: the up
dated font tools as shown in this article are available in firefox 63 onwards; if you are using an older version of firefox the tools will not look or behave quite the same, but they will be similar (most notably the font editor will not be available).
... warning: in order to use variable fonts, you need to make sure that your operating system is up to
date.
...if your operating system is not up to
date, you will not be able to use variable fonts in web pages or the firefox developer tools.
... you can adjust the axes individually or, if the font designer has included defined instances, you can select one from the "instance" drop-down list and view the up
dates live on your page.
Frame rate - Firefox Developer Tools
a frame rate of 60fps is the target for smooth performance, giving you a time budget of 16.7ms for all the up
dates needed in response to some event.
... in web performance, a frame encapsulates the work the browser needs to do in order to up
date and repaint the screen.
... similarly, if scrolling through a page involves a lot of complex page up
dates and the browser can't keep up an acceptable frame rate, scrolling the page will appear sluggish or will occasionally freeze.
... a frame rate of 60fps is reckoned to be the target for smooth performance, giving you a time budget of 16.7ms for all the up
dates that need to be made synchronously in response to some event.
Intensive JavaScript - Firefox Developer Tools
here's the code, together with its immediate caller: const iterations = 50; const multiplier = 1000000000; function calculateprimes(iterations, multiplier) { var primes = []; for (var i = 0; i < iterations; i++) { var candi
date = i * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candi
date); ++c) { if (candi
date % c === 0) { // not prime isprime = false; break; } } if (isprime) { primes.push(candi
date); } } return primes; } function dopointlesscomputationswithblocking() { var primes = calculateprimes(iterations,...
... it's pretty simple to split up calculateprimes(): we will just calculate primality for each number in a separate function: function dopointlesscomputationswithrequestanimationframe() { function testcandi
date(index) { // finishing condition if (index == iterations) { console.log(primes); pointlesscomputationsbutton.disabled = false; return; } // test this number var candi
date = index * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candi
date); ++c) { if (candi
date % c === 0) { // not prime isprime...
... = false; break; } } if (isprime) { primes.push(candi
date); } // schedule the next var testfunction = testcandi
date.bind(this, index + 1); window.requestanimationframe(testfunction); } var primes = []; var testfunction = testcandi
date.bind(this, 0); window.requestanimationframe(testfunction); } let's test this version out: select the radio button labeled "use requestanimationframe" and capture another profile.
...self.addeventlistener("message", go); function go(message) { var iterations = message.data.iterations; var multiplier = message.data.multiplier; primes = calculateprimes(iterations, multiplier); self.postmessage({ "command":"done", "primes": primes }); } function calculateprimes(iterations, multiplier) { var primes = []; for (var i = 0; i < iterations; i++) { var candi
date = i * (multiplier * math.random()); var isprime = true; for (var c = 2; c <= math.sqrt(candi
date); ++c) { if (candi
date % c === 0) { // not prime isprime = false; break; } } if (isprime) { primes.push(candi
date); } } return primes; } in the worker, we have to listen for a message telling us to start, and send a "done" messa...
AddressErrors.dependentLocality - Web APIs
an object based on addresserrors includes a dependentlocality property when the address's dependentlocality property couldn't be vali
dated.
... syntax var localityerror = addresserrors.dependentlocality; value if the value specified in the paymentaddress object's dependentlocality property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the dependentlocality value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.languageCode - Web APIs
an object based on addresserrors includes a languagecode property when the address's languagecode property couldn't be vali
dated.
... syntax var languageerror = addresserrors.languagecode; value if the value specified in the paymentaddress object's languagecode property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the languagecode value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.organization - Web APIs
an object based on addresserrors includes an organization property when the address's organization property couldn't be vali
dated.
... syntax var organizationerror = addresserrors.organization; value if the value specified in the paymentaddress object's organization property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... for example, if validation simply ensures that only permitted characters are included in the organization's name, this might return a string such as "the organization name may only contain the letters a-z, digits, spaces, and commas." if the organization value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.phone - Web APIs
an object based on addresserrors includes a phone property when the address's phone property couldn't be vali
dated.
... syntax var phoneerror = addresserrors.phone; value if the value specified in the paymentaddress object's phone property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the phone value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.postalCode - Web APIs
an object based on addresserrors includes a postalcode property when the address's postalcode property couldn't be vali
dated.
... syntax var postcodeerror = addresserrors.postcode; value if the value specified in the paymentaddress object's postalcode property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the postalcode value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.recipient - Web APIs
an object based on addresserrors includes a recipient property when the address's recipient property couldn't be vali
dated.
... syntax var recipienterror = addresserrors.recipient; value if the value specified in the paymentaddress object's recipient property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the recipient value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.region - Web APIs
an object based on addresserrors includes a region property when the address's region property couldn't be vali
dated.
... syntax var regionerror = addresserrors.region; value if the value specified in the paymentaddress object's region property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the region value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.regionCode - Web APIs
an object based on addresserrors includes a regioncode property when the address's regioncode property couldn't be vali
dated.
... syntax var regioncodeerror = addresserrors.regioncode; value if the value specified in the paymentaddress object's regioncode property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the regioncode value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AddressErrors.sortingCode - Web APIs
an object based on addresserrors includes a sortingcode property when the address's sortingcode property couldn't be vali
dated.
... syntax var sortingcodeerror = addresserrors.sortingcode; value if the value specified in the paymentaddress object's sortingcode property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the sortingcode value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
BatteryManager - Web APIs
event handlers batterymanager.onchargingchange a handler for the chargingchange event; this event is sent when the battery charging state is up
dated.
... batterymanager.onchargingtimechange a handler for the chargingtimechange event; this event is sent when the battery charging time is up
dated batterymanager.ondischargingtimechange a handler for the dischargingtimechange event; this event is sent when the battery discharging time is up
dated.
... batterymanager.onlevelchange a handler for the levelchange event; this event is sent when the battery level is up
dated.
... void seteventhandler(domstring type, eventhandler handler) eventhandler geteventhandler(domstring type) specifications specification status comment battery status api candi
date recommendation initial definition ...
HTMLKeygenElement - Web APIs
this is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... willvali
date is a boolean that is always false because keygen objects are never candi
dates for constraint validation.
... methods name & arguments return description checkvalidity() boolean always returns true because keygen objects are never candi
dates for constraint validation.
...if this message is not the empty string, then the element is suffering from a custom validity error, and does not vali
date.
HTMLSelectElement - Web APIs
this attribute is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... htmlselectelement.willvali
dateread only a boolean that indicates whether the button is a candi
date for constraint validation.
...this will tell you when the value changes, and you can then up
date anything you need to.
... it adds the autofocus, form, required, labels, selectedoptions, willvali
date, validity and validationmessage properties.
Ajax navigation example - Web APIs
function ajaxerror () { alert("unknown error."); } function ajaxload () { var vmsg, nstatus = this.status; switch (nstatus) { case 200: vmsg = json.parse(this.responsetext); document.title = opageinfo.title = vmsg.page; document.getelementbyid(stargetid).innerhtml = vmsg.content; if (bup
dateurl) { history.pushstate(opageinfo, opageinfo.title, opageinfo.url); bup
dateurl = false; } break; default: vmsg = nstatus + ": " + (ohttpstatus[nstatus] || "unknown"); switch (math.floor(nstatus / 100)) { /* case 1: // i...
... bisloading = true; oreq.onload = ajaxload; oreq.onerror = ajaxerror; if (spage) { opageinfo.url = filterurl(spage, null); } oreq.open("get", filterurl(opageinfo.url, "json"), true); oreq.send(); oloadingbox.parentnode || document.body.appendchild(oloadingbox); } function requestpage (surl) { if (history.pushstate) { bup
dateurl = true; getpage(surl); } else { /* ajax navigation is not supported */ location.assign(surl); } } function processlink () { if (this.classname === sajaxclass) { requestpage(this.href); return false; } return true; } function init () { opageinfo.title = document.title; ...
...ailable", 504: "gateway timeout", 505: "http version not supported", 506: "variant also negotiates (experimental)", 507: "insufficient storage", 508: "loop detected", 509: "unassigned", 510: "not extended", 511: "network authentication required" }; var oreq, bisloading = false, bup
dateurl = false; oloadingbox.id = "ajax-loader"; ocover.onclick = abortreq; oloadingimg.src = "data:image/gif;base64,r0lgodlheaaqapiaap///waaamlcwkjcqgaaagjiyokcgpkskih/c05fvfndqvbfmi4waweaaaah/hpdcmvhdgvkihdpdgggywphegxvywquaw5mbwah+qqjcgaaacwaaaaaeaaqaaadmwi63p4wyklre2mioggznadomgyjrbexwroumcg2lmdewnhqlvsyod2mbzkydadka+diaaah+qqjcgaaacwaaaaaeaaqaaadnai63p5ojcegg4qmu7dmikrxqlfuydezigbmrv...
...i6imkqorfjdoe82p4wgccc4ceuqradylesojembgsuc2g7sdx3lqgbmlajibufbslkaaah+qqjcgaaacwaaaaaeaaqaaadmgi63p7wcrhznfvdmghu2nfwlwci3wgc3tswhufgxtaukgcbtgenbmjaejsxgmlwzpeaach5bakkaaaalaaaaaaqabaaaamyclrc/jdksatlqtsckdcecajdii7hcq4emtcpyrcuubjcyrghvtqlaib1yhicnlsrkaaaowaaaaaaaaaaaa=="; ocover.appendchild(oloadingimg); oloadingbox.appendchild(ocover); onpopstate = function (oevent) { bup
dateurl = false; opageinfo.title = oevent.state.title; opageinfo.url = oevent.state.url; getpage(); }; window.addeventlistener ?
MouseEvent.pageX - Web APIs
see browser compatibility to learn which browsers have been up
dated to use the revised data type.
... javascript var box = document.queryselector(".box"); var pagex = document.getelementbyid("x"); var pagey = document.getelementbyid("y"); function up
datedisplay(event) { pagex.innertext = event.pagex; pagey.innertext = event.pagey; } box.addeventlistener("mousemove", up
datedisplay, false); box.addeventlistener("mouseenter", up
datedisplay, false); box.addeventlistener("mouseleave", up
datedisplay, false); the javascript code uses addeventlistener() to register the function up
datedisplay() as the event handler for the mousemove, mouseenter, and...
... up
datedisplay() simply replaces the contents of the <span> elements meant to contain the x and y coordinates with the values of pagex and pagey.
...those will be up
dated each time an event occurs to contain the latest mouse coordinates relative to the page.
PaymentDetailsBase - Web APIs
the paymentdetailsbase dictionary is a mixin used by the paymentdetailsinit and paymentdetailsup
date dictionaries.
... paymentdetailsup
date provides up
dated payment details while the payment user interface is being handled.
... this can be delivered to the payment interface using either paymentdetailsup
dateevent.up
datewith() or by returning it from the optional detailsup
date promise provided to the paymentrequest.show() call that begins the user interaction.
... candi
date recommendation initial definition.
PaymentRequest.onmerchantvalidation - Web APIs
the paymentrequest event handler onmerchantvalidation is invoked when the merchantvalidation is fired, indicating that the payment handler (e.g., apple pay) requires the merchant to vali
date themselves.
... this is usually the first event to be fired, and the user won't be able to proceed with a payment until the merchant vali
date themselves.
... syntax paymentrequest.onmerchantvalidation = eventhandlerfunction; value an event handler function which is to be called whenever the merchantvalidation event is fired at the paymentrequest, indicating that the payment handler requires the merchant to vali
date themselves as allowed to use this payment handler.
... candi
date recommendation initial definition.
PaymentRequest.shippingAddress - Web APIs
when the paymentrequest.onshippingaddresschange is called, up
datedetails() is called to up
date the details of the paymentrequest, using shippingaddress to set the correct shipping cost.
...var payment = new paymentrequest(supportedinstruments, details, options); payment.addeventlistener('shippingaddresschange', function(evt) { evt.up
datewith(new promise(function(resolve) { up
datedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function up
datedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.displayitems.splice(2, 1, shippingoption); details.shippingoptions = [shippingoption...
... candi
date recommendation initial definition.
PaymentRequest.shippingOption - Web APIs
in each calls to up
datedetails() are made, one using a promise, and the other with a plain js object.
... this demotrates synchrounous and asynchronous up
dates to a payment sheet.
... const request = new paymentrequest(methoddata, details, options); // async up
date to details request.onshippingaddresschange = ev => { ev.up
datewith(checkshipping(request)); }; // sync up
date to the total request.onshippingoptionchange = ev => { const shippingoption = shippingoptions.find( option => option.id === request.id ); const newtotal = { currency: "usd", label: "total due", value: calculatenewtotal(shippingoption), }; ev.up
datewith({ ...details, total: newtotal }); }; async function checkshipping(request) { try { const json = request.shippingaddress.tojson(); await ensurecanshipto(json); const { shippingoptions, total } = await calculateshipping(json); return { ...details, shippingoptions, total }; } catch (err) { return { ...det...
... candi
date recommendation initial definition.
PaymentResponse.onpayerdetailchange - Web APIs
examples in the example below, onpayerdetailchange is used to set up a listener for the payerdetailchange event in order to vali
date the information entered by the user, requesting that any mistakes be corrected // options for paymentrequest(), indicating that shipping address, // payer email address, name, and phone number all be collected.
... response.onpayerdetailchange = async ev => { const promisestovali
date = []; const { payername, payeremail, payerphone } = response; // vali
date each value which changed by calling a function // that vali
dates each type of data, returning a promise which // resolves if the data is valid.
... if (oldpayername !== payername) { promisestovali
date.push(vali
datename(payername)); oldpayername = payername; } if (oldpayeremail !== payeremail) { promisestovali
date.push(vali
dateemail(payeremail)); oldpayeremail = payeremail; } if (oldpayerphone !== payerphone) { promisestovali
date.push(vali
datephone(payerphone)); oldpayerphone = payerphone; } // as each validation promise resolves, add the results of the // validation to the errors list const errors = await promise.all(promisestovali
date).then(results => results.reduce((errors, result), object.assign(errors, result)) ); // if we found any errors, wait for them to be corrected if (object.getownpropertynames(errors).length) { await response.retry(errors); } else { // we have ...
... candi
date recommendation initial definition.
PaymentResponse.shippingAddress - Web APIs
when the paymentrequest.onshippingaddresschange is called, up
datedetails() is called to up
date the details of the paymentrequest, using shippingaddress to set the correct shipping cost.
... var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingaddresschange', function(evt) { evt.up
datewith(new promise(function(resolve) { up
datedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function up
datedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.displayitems.splice(2, 1, shippingoption); details.shippingoptions = [shippingoption];...
... } else { delete details.shippingoptions; } resolve(details); } specifications specification status comment payment request api candi
date recommendation initial definition.
PaymentResponse.shippingOption - Web APIs
it calls up
datedetails() to toggle the shipping method between "standard" and "express".
...var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingoptionchange', function(evt) { evt.up
datewith(new promise(function(resolve, reject) { up
datedetails(details, request.shippingoption, resolve, reject); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of brevity.
... }).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function up
datedetails(details, shippingoption, resolve, reject) { var selectedshippingoption; var othershippingoption; if (shippingoption === 'standard') { selectedshippingoption = details.shippingoptions[0]; othershippingoption = details.shippingoptions[1]; details.total.amount.value = '55.00'; } else if (shippingoption === 'express') { selectedshippingoption = details.shippingoptions[1]; othershippingoption = details.shippingoptions[0]; details.total.amount.value = '67.00'; } else { reject('unknown shipping option \'' + shippingoption + '\''); return; } selectedshippingoption.selected = true; othershippingoption.selected = false; details.displayitem...
...s.splice(2, 1, selectedshippingoption); resolve(details); } specifications specification status comment payment request api candi
date recommendation initial definition.
Payment processing concepts - Web APIs
vali
dated merchants are allowed to interface with a payment handler.
...if the merchant doesn't successfully vali
date, it's not allowed to use the payment handler.
... specifications specification status comment payment request api candi
date recommendation initial definition.
... payment method identifiers candi
date recommendation defines payment method identifiers and how they are vali
dated, and, where applicable, minted and formally registered with the w3c.
RTCIceComponent - Web APIs
these strings are mapped to corresponding numeric values as they appear in the candi
date a-line in sdp.
...an rtcicecomponent of this value corresponds to the component id field in the candi
date a-line with the value 1.
... usage notes the rtcicecomponent type is used by the component property of rtcicecandi
date and rtcicetransport objects.
... candi
date recommendation initial definition.
RTCPeerConnection.peerIdentity - Web APIs
if an error occcurs while attempting to vali
date an incoming identity assertion (that is, the information describing a peer's identity), the promise is rejected.
... note: the promise returned by setremotedescription() cannot resolve until any target peer identity that's been set is vali
dated.
... if the identity hasn't been vali
dated yet, the promise returned by setremotedescription() will be rejected.
...*/ async function getidentityassertion(pc) { try { const identity = await pc.peeridentity; return identity; } catch(err) { console.log("error identifying remote peer: ", err); return null; } } specifications specification status comment identity for webrtc candi
date recommendation initial specification.
RTCPeerConnectionIceErrorEvent.address - Web APIs
if the local ip address isn't exposed as part of a local candi
date, the value of address is null.
... examples this example creates a handler for icecandi
dateerror events which creates human readable messages describing the local network interface for the connection as well as the ice server that was being used to try to open the connection, then calls a function to display those as well as the event's errortext property's contents.
... pc.addeventlistener("icecandi
dateerror", (event) => { let networkinfo = `[local interface: ${event.address}:${event.port}`; let iceserverinfo = `[ice server: ${event.url}`; showmessage(errortext, iceserverinfo, networkinfo); }); specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcpeerconnectioniceerrorevent.address' in that specification.
... candi
date recommendation initial definition.
RTCPeerConnectionIceErrorEvent - Web APIs
the rtcpeerconnectioniceerrorevent interface—based upon the event interface—provides details pertaining to an ice error announced by sending an icecandi
dateerror event to the rtcpeerconnection object.
... properties the rtcpeerconnectioniceerrorevent interface includes the properties found on the event interface, as well as the following properties: address read only a domstring providing the local ip address used to communicate with the stun or turn server being used to negotiate the connection, or null if the local ip address has not yet been exposed as part of a local ice candi
date.
...if no host candi
date can reach the server, this property is set to the number 701, which is outside the range of valid stun error codes.
... candi
date recommendation initial definition.
Sensor APIs - Web APIs
specifications specification status comment generic sensor api candi
date recommendation initial definition.
... accelerometer candi
date recommendation defines accelerometer and linearaccerationsensor.
... ambient light sensor candi
date recommendation gyroscope candi
date recommendation initial definition.
... magnetometer candi
date recommendation orientation sensor candi
date recommendation defines absoluteorientationsensor and relativeorientationsensor.
Using server-sent events - Web APIs
the php code for the example we're using here follows:
date_default_timezone_set("america/new_york"); header("cache-control: no-cache"); header("content-type: text/event-stream"); $counter = rand(1, 10); while (true) { // every second, send a "ping" event.
... echo "event: ping\n"; $cur
date =
date(
date_iso8601); echo 'data: {"time": "' .
... $cur
date .
...$cur
date .
Multi-touch interaction - Web APIs
ev.preventdefault(); // cache the touch points for later processing of 2-touch pinch/zoom if (ev.targettouches.length == 2) { for (var i=0; i < ev.targettouches.length; i++) { tpcache.push(ev.targettouches[i]); } } if (logevents) log("touchstart", ev, true); up
date_background(ev); } touch move handler the touchmove handler calls preventdefault() for the same reason mentioned above, and invokes the pinch/zoom handler.
... // ev.preventdefault(); if (logevents) log("touchmove", ev, false); // to avoid too much color flashing many touchmove events are started, // don't up
date the background if two touch points are active if (!(ev.touches.length == 2 && ev.targettouches.length == 2)) up
date_background(ev); // set the target element's border to dashed to give a clear visual // indication the element received a move event.
... up
date background color the background color of the touch areas will change as follows: no touch is white; one touch is yellow; two simultaneous touches is pink, and three or more simultaneous touches is lightblue.
... function up
date_background(ev) { // change background color based on the number simultaneous touches // in the event's targettouches list: // yellow - one tap (or hold) // pink - two taps // lightblue - more than two taps switch (ev.targettouches.length) { case 1: // single tap` ev.target.style.background = "yellow"; break; case 2: // two simultaneous touches ev.target.style.background = "pink"; break; default: // more than two simultaneous touches ev.target.style.background = "lightblue"; } } event logging the functions are used to log event activity to the application window, to support debugging and learning about ...
WebGLRenderingContext - Web APIs
webglrenderingcontext.bufferdata() up
dates buffer data.
... webglrenderingcontext.buffersubdata() up
dates buffer data starting at a passed offset.
... webglrenderingcontext.texsubimage2d() up
dates a sub-rectangle of the current webgltexture.
... webglrenderingcontext.vali
dateprogram() vali
dates a webglprogram.
Starting up and shutting down a WebXR session - Web APIs
the polyfill is maintained alongside the specification, and is kept up to
date with the specification.
... additionally, it is up
dated to maintain compatibility with browsers as their support for webxr and other technologies related to it and to the implementation of the polyfill change over time.
... async function runsession(session) { let worlddata; session.addeventlistener("end", onsessionend); let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); // set up webgl data and such worlddata = loadglprograms(session, "worlddata.xml"); if (!worlddata) { return null; } // finish configuring webgl worlddata.session.up
daterenderstate({ baselayer: new xrwebgllayer(worlddata.session, gl) }); // start rendering the scene referencespace = await worlddata.session.requestreferencespace("unbounded"); worlddata.referencespace = referencespace.getoffsetreferencespace( new xrrigidtransform(worlddata.playerspawnposition, worlddata.playerspawnorientation)); worlddata.animationframerequestid = worlddata.
...this is done using the xrsession method up
daterenderstate() to set the render state's baselayer to a newly-created xrwebgllayer encapsulating the webgl context.
Window.devicePixelRatio - Web APIs
.font = '18px arial'; ctx.textalign = 'center'; ctx.textbaseline = 'middle'; var x = size / 2; var y = size / 2; var textstring = "i love mdn"; ctx.filltext(textstring, x, y); monitoring screen resolution or zoom level changes in this example, we'll set up a media query and watch it to see when the device resolution changes, so that we can check the value of devicepixelratio to handle any up
dates we need to.
... let pixelratiobox = document.queryselector(".pixel-ratio"); let mqstring = `(resolution: ${window.devicepixelratio}dppx)`; const up
datepixelratio = () => { let pr = window.devicepixelratio; let prstring = (pr * 100).tofixed(0); pixelratiobox.innertext = `${prstring}% (${pr.tofixed(2)})`; } up
datepixelratio(); matchmedia(mqstring).addlistener(up
datepixelratio); the string mqstring is set up to be the media query itself.
... the up
datepixelratio() function fetches the current value of devicepixelratio, then sets the innertext of the element pixelratiobox to a string which displays the ratio both as a percentage and as a raw decimal value with up to two decimal places.
... then the up
datepixelratio() function is called once to display the starting value, after which the media query is created using matchmedia() and addeventlistener() is called to set up up
datepixelratio() as a handler for the change event.
Web APIs
erventionreportbody k keyboard keyboardevent keyboardlayoutmap keyframeeffect keyframeeffectoptions l largestcontentfulpaint layoutshift layoutshiftattribution linearaccelerationsensor linkstyle localfilesystem localfilesystemsync localmediastream location lock lockmanager lockedfile m midiaccess midiconnectionevent midiinput midiinputmap midimessageevent midioutputmap mscandi
datewindowhide mscandi
datewindowshow mscandi
datewindowup
date msgestureevent msgraphicstrust msmanipulationevent msrangecollection mssitemodeevent magnetometer mathmlelement mediacapabilities mediacapabilitiesinfo mediaconfiguration mediadecodingconfiguration mediadeviceinfo mediadevices mediaelementaudiosourcenode mediaencodingconfiguration mediaerror mediaimage mediakeymessageevent medi...
...ture_float_linear oes_texture_half_float oes_texture_half_float_linear oes_vertex_array_object ovr_multiview2 offlineaudiocompletionevent offlineaudiocontext offscreencanvas orientationsensor oscillatornode overconstrainederror p pagetransitionevent paintworklet pannernode parentnode passwordcredential path2d payererrors paymentaddress paymentcurrencyamount paymentdetailsbase paymentdetailsup
date paymentitem paymentmethodchangeevent paymentrequest paymentrequestevent paymentrequestup
dateevent paymentresponse paymentvalidationerrors pbkdf2params performance performanceentry performanceeventtiming performanceframetiming performancelongtasktiming performancemark performancemeasure performancenavigation performancenavigationtiming performanceobserver performanceobserverentrylist perfo...
...tion progressevent promiserejectionevent publickeycredential publickeycredentialcreationoptions publickeycredentialrequestoptions pushevent pushmanager pushmessagedata pushregistrationmanager pushsubscription r rtcansweroptions rtccertificate rtcconfiguration rtcdtmfsender rtcdtmftonechangeevent rtcdatachannel rtcdatachannelevent rtcdtlstransport rtcerror rtcerrorevent rtcicecandi
date rtcicecandi
dateinit rtcicecandi
datepair rtcicecandi
datepairstats rtcicecandi
datestats rtcicecandi
datetype rtcicecomponent rtcicecredentialtype rtcicegathererstate rtciceparameters rtciceprotocol rtcicerole rtciceserver rtcicetcpcandi
datetype rtcicetransport rtcicetransportstate rtcidentityassertion rtcidentityerrorevent rtcidentityevent rtcinboundrtpstreamstats rtcnetworktype rtcofferansw...
...es rtcrtpcodeccapability rtcrtpcodecparameters rtcrtpcontributingsource rtcrtpencodingparameters rtcrtpparameters rtcrtpreceiveparameters rtcrtpreceiver rtcrtpsendparameters rtcrtpsender rtcrtpstreamstats rtcrtpsynchronizationsource rtcrtptransceiver rtcrtptransceiverdirection rtcrtptransceiverinit rtcsctptransport rtcsessiondescription rtcsessiondescriptioncallback rtcstats rtcstatsicecandi
datepairstate rtcstatsreport rtcstatstype rtctrackevent rtctrackeventinit radionodelist range readablebytestreamcontroller readablestream readablestreambyobreader readablestreambyobrequest readablestreamdefaultcontroller readablestreamdefaultreader relativeorientationsensor renderingcontext report reportingobserver reportingobserveroptions request requestdestination resizeobserver resize...
ARIA: Comment role - Accessibility
<p>the last half of the song is a slow-rising crescendo that peaks at the <span role="mark" aria-details="thread-1">end of the guitar solo</span>, before fading away sharply.</p> <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time
datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> </div> to associate the comment with the text being commented, we need to wrap the commented text with an element containing the aria-details attribute, the value of which should be the id of the comment.
...multiple comments with the same annotation, like so: <p>the last half of the song is a slow-rising crescendo that peaks at the <mark aria-details="thread-1 thread-2">end of the guitar solo</mark>, before fading away sharply.</p> <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time
datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> </div> <div role="comment" id="thread-2" data-author="chris"> <h3>marcus said</h3> <p class="comment-text">the guitar solo could do with a touch more chorus, and a slightly lower volume.</p> <p><time
datetime="2019-03-29t15:35">march 29 2019, 15:35</time></p> </div> nested comments nested comments are also possible with aria anno...
...tations — simply nest the comments inside one another, like so: <div role="comment" id="thread-1" data-author="chris"> <h3>chris said</h3> <p class="comment-text">i really think this moment could use more cowbell.</p> <p><time
datetime="2019-03-30t19:29">march 30 2019, 19:29</time></p> <div role="comment" data-author="marcus"> <h3>marcus replied</h3> <p class="comment-text">i don't know about that.
... i think the cowbell could distract from the solo.</p> <p><time
datetime="2019-03-30t21:02">march 30 2019, 21:02</time></p> </div> </div> accessibility concerns landmark roles are intended to be used sparingly, to identify larger overall sections of the document.
An overview of accessible web applications and widgets - Accessibility
stock tickers, live twitter feed up
dates, progress indicators, and similar content modify the dom in ways that an assistive technology (at) may not be aware of.
...attribute-based selector for indicating state div.tooltip[aria-hidden="true"] { display: none; } the javascript to up
date the aria-hidden property has the form shown in example 2c.
... note that the script only up
dates the aria-hidden attribute (line 2); it does not need to also add or remove a custom classname.
...javascript to up
date the aria-checked attribute var showtip = function(el) { el.setattribute('aria-hidden', 'false'); } role changes aria allows developers to declare a semantic role for an element that otherwise offers incorrect or no semantics.
display - CSS: Cascading Style Sheets
al, sans-serif; letter-spacing: 1px; padding-top: 10px; } article { background-color: red; } article span { background-color: black; color: white; margin: 1px; } article, span { padding: 10px; border-radius: 7px; } article, div { margin: 20px; } javascript const articles = document.queryselectorall('.container'); const select = document.queryselector('select'); function up
datedisplay() { articles.foreach((article) => { article.style.display = select.value; }); } select.addeventlistener('change', up
datedisplay); up
datedisplay(); result note: you can find more examples in the pages for each separate display data type, linked above.
... candi
date recommendation added run-in, flow, flow-root, contents, and multi-keyword values.
... candi
date recommendation added the grid box model values.
... candi
date recommendation added the flexible box model values.
transition-delay - CSS: Cascading Style Sheets
-webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:0.5s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:0.5s; transition-timing-function: linear; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-delay: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...ute; -webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:1s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:1s; transition-timing-function: linear; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-delay: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...ute; -webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:2s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:2s; transition-timing-function: linear; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-delay: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .b...
...webkit-transition-property: width height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:4s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-delay' in ...
transition-duration - CSS: Cascading Style Sheets
kit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration:0.5s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top -webkit-transform transform color; -webkit-transition-duration:1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:1s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:2s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;}...
... -webkit-transition-property: width height background-color font-size left top transform -webkit-transform color; -webkit-transition-duration:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:4s; transition-timing-function: ease-in-out; } function up
datetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(up
datetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-duration' ...
Getting Started - Developer guides
ajax’s most appealing characteristic is its "asynchronous" nature, which means it can communicate with the server, exchange data, and up
date the page without having to refresh the page.
...you can see the test.xml here and the up
dated test script here.
...the idea would be that a server-side script of some kind would continually up
date the text file with new timestamps, and our xhr code would be used to report the latest timestamp on the client-side.
...l> <html> <head> <meta charset="utf-8"> <title>xhr log time</title> <style> </style> </head> <body> <p id="writedata" class="data">off-line</p> <p id="laststamp">no data yet</p> <script> const fulldata = document.getelementbyid('writedata'); const lastdata = document.getelementbyid('laststamp'); function fetchdata() { console.log('fetching up
dated data.'); let xhr = new xmlhttprequest(); xhr.open("get", "time-log.txt", true); xhr.onload = function() { up
datedisplay(xhr.response); } xhr.send(); } function up
datedisplay(text) { fulldata.textcontent = text; let timearray = text.split('\n'); // included because some file systems always include a blank line at the end of text f...
Cross-browser audio basics - Developer guides
timeup
date the timeup
date event is triggered every time the currenttime property changes.
... myaudio.addeventlistener("timeup
date", function() { //up
date something related to playback progress }); playing the playing event is initiated when playback is ready to start after having being paused due to lack of media data.
... displaycontrols(); }); } play.addeventlistener('click', function() { myaudio.play(); play.style.display = "none"; pause.style.display = "block"; }); pause.addeventlistener('click', function() { myaudio.pause(); pause.style.display = "none"; play.style.display = "block"; }); // display progress myaudio.addeventlistener('timeup
date', function() { //sets the percentage bar.style.width = parseint(((myaudio.currenttime / myaudio.duration) * 100), 10) + "%"; }); } you should end up with something like this: seeking using the seek bar this is a good start, but it would be nice to be able to navigate the audio using the progress bar.
... first of all, we apply a quick up
date to the progress bar css to display the hand pointer on hover: #progress { margin-left: 80px; border: 1px solid black; cursor: pointer; } then we add the code that detects the click and moves the 'playhead' to the correct position: var progress = document.getelementbyid('progress'); progress.addeventlistener('click', function(e) { // calculate the normalized position clicked var clickposition = (e.pagex - this.offsetleft) / this.offsetwidth; var clicktime = clickposition * myaudio.duration; // move the playhead to the correct position myaudio.currenttime = clicktime; }); buffering ok, we're getting there, but there is another piece of useful information we can display: the amou...
HTML attribute: min - HTML: Hypertext Markup Language
valid for the numeric input types, including the
date, month, week, time,
datetime-local, number and range types, and the <meter> element, the min attribute is a number that specifies the most negative value a form control to be considered valid.
... syntax if any is not explicity set, valid values for the number,
date/time input types, and range input types are equal to the basis for stepping - the min value and increments of the step value, up to the max value, if specified.
...for 4.2 to be valid, step would have had to be set to any, 0.1, 0.2, or any the min value would have had to be a number ending in .2, such as <input type="number" min="-5.2"> syntax for min values by input type input type example example
date yyyy-mm-dd <input type="
date" min="2019-12-25" step="1"> month yyyy-mm <input type="month" min="2019-12" step="12"> week yyyy-w## <input type="week" min="2019-w23" step=""> time hh:mm <input type="time" min="09:00" step="900">
datetime-local yyyy-mm-ddthh:mm <input type="
datetime-local" min="2019-12-25t19:30"> number <n...
... if not explicitly included, step defaults to 1 for number and range, and 1 unit type (second, week, month, day) for the
date/time input types.
<del>: The Deleted Text element - HTML: Hypertext Markup Language
datetime this attribute indicates the time and
date of the change and must be a valid
date string with an optional time.
... if the value cannot be parsed as a
date with an optional time string, the element does not have an associated time stamp.
... for the format of the string without a time, see
date strings.
... the format of the string if it includes both
date and time is covered in local
date and time strings.
<hgroup> - HTML: Hypertext Markup Language
ry heading (and with the same or similar punctuation before any other secondary headings an <hgroup> might be shown in a rendered outline in with the primary heading followed by parentheses around the secondary heading(s) consider the following html document: <!doctype html> <title>html standard</title> <body> <hgroup id="document-title"> <h1>html</h1> <h2>living standard — last up
dated 12 august 2016</h2> </hgroup> <p>some intro to the document.</p> <h2>table of contents</h2> <ol id=toc>...</ol> <h2>first section</h2> <p>some intro to the first section.</p> </body> a rendered outline for that document might look like the following: that is, the rendered outline might show the primary title, html, followed by a colon and space, followed by the secondary title, l...
...iving standard — last up
dated 12 august 2016.
... or, the rendered outline for that document might instead look like the following: that is, the rendered outline might show the primary title, html, followed by the secondary title shown in parentheses: (living standard — last up
dated 12 august 2016).
... examples <hgroup id="document-title"> <h1>html</h1> <h2>living standard — last up
dated 12 august 2016</h2> </hgroup> specifications specification status comment html living standardthe definition of '<hgroup>' in that specification.
<img>: The Image Embed element - HTML: Hypertext Markup Language
on browsers supporting srcset, src is treated like a candi
date image with a pixel density descriptor 1x, unless an image with this pixel density descriptor is already defined in srcset, or unless srcset contains w descriptors.
...the image referenced in the src attribute is counted as a 1x candi
date in user agents that support srcset.
... using the html title attribute – up
dated | the paciello group technical summary content categories flow content, phrasing content, embedded content, palpable content.
... candi
date recommendation added the referrerpolicy attribute.
<input type="number"> - HTML: Hypertext Markup Language
for example, let's give our example a minimum of 0, and a maximum of 100: <input type="number" placeholder="multiple of 10" step="10" min="0" max="100"> in this up
dated version, you should find that the up and down step buttons will not allow you to go below 0 or above 100.
... validation we have already mentioned a number of validation features of number inputs, but let's review them now: <input type="number"> elements automatically invali
date any entry that isn't a number (or empty, unless required is specified).
...(read, for example, the section on <input type="
date"> validation.) important: html form validation is not a substitute for server-side scripts that ensure that the entered data is in the proper format!
... if your server-side code fails to vali
date the data it receives, disaster could strike when improperly-formatted data is submitted (or data which is too large, is of the wrong type, and so forth).
<input type="range"> - HTML: Hypertext Markup Language
note: the following input attributes do not apply to the input range: accept, alt, checked, dirname, formaction, formenctype, formmethod, formnovali
date, formtarget, height, maxlength, minlength, multiple, pattern, placeholder, readonly, required, size, src, and width.
... as a rule, if the user is more likely to be interested in the percentage of the distance between minimum and maximum values than the actual number itself, a range input is a great candi
date.
... range control mockups since browsers have this flexibility, and to
date none support all of the features html defines for range controls, here are some mockups to show you what you might get on macos in a browser which supports them.
... html the html needs to be up
dated to wrap the <input> in a <div> to let us correct the layout after the transform is performed (since transforms don't automatically affect the layout of the page): <div class="slider-wrapper"> <input type="range" min="0" max="11" value="7" step="1"> </div> css now we need some css.
<input type="tel"> - HTML: Hypertext Markup Language
unlike <input type="email"> and <input type="url"> , the input value is not automatically vali
dated to a particular format before the form can be submitted, because formats for telephone numbers vary so much around the world.
...if your server-side code fails to vali
date the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
... <input id="number2" name="number2" type="tel" required placeholder="second part" pattern="[0-9]{4}" aria-label="second part of number"> <span class="validity"></span> </span> </div> <div> <button>submit</button> </div> </form> the javascript is relatively simple — it contains an onchange event handler that, when the <select> value is changed, up
dates the <input> element's pattern, placeholder, and aria-label to suit the format of telephone numbers in that country/territory.
... it makes you wonder if it is worth going to all this trouble on the client-side, when you could just let the user enter their number in whatever format they wanted on the client-side and then vali
date and sanitize it on the server.
<ins> - HTML: Hypertext Markup Language
datetime this attribute indicates the time and
date of the change and must be a valid
date with an optional time string.
... if the value cannot be parsed as a
date with an optional time string, the element does not have an associated time stamp.
... for the format of the string without a time, see format of a valid
date string.
... the format of the string if it includes both
date and time is covered in format of a valid local
date and time string.
<video>: The Video Embed element - HTML: Hypertext Markup Language
the getstart
date() method can be used to determine the beginning point of the media timeline's reference frame.
... durationchange the duration attribute has been up
dated.
... timeup
date the time indicated by the currenttime attribute has been up
dated.
... addtype video/webm .webm your web host may provide an easy interface to mime type configuration changes for new technologies until a global up
date naturally occurs.
If-Modified-Since - HTTP
the if-modified-since request http header makes the request conditional: the server will send back the requested resource, with a 200 status, only if it has been last modified after the given
date.
... if the request has not been modified since, the response will be a 304 without any body; the last-modified response header of a previous request will contain the
date of last modification.
... the most common use case is to up
date a cached entity that has no associated etag.
...http
dates are always expressed in gmt, never in local time.
If-None-Match - HTTP
note that the server generating a 304 response must generate any of the following header fields that would have been sent in a 200 (ok) response to the same request: cache-control, content-location,
date, etag, expires, and vary.
...for example, two pages that differ by the
date of generation in the footer would still be considered as identical.
... there are two common use cases: for get and head methods, to up
date a cached entity that has an associated etag.
... for other methods, and in particular for put, if-none-match used with the * value can be used to save a file not known to exist, guaranteeing that another upload didn't happen before, losing the data of the previous put; this problem is a variation of the lost up
date problem.
Intl.DisplayNames.supportedLocalesOf() - JavaScript
the intl.displaynames.supportedlocalesof() method returns an array containing those of the provided locales that are supported in
date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in
date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in
date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in
date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to
date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Intl.ListFormat.supportedLocalesOf() - JavaScript
the intl.listformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in
date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in
date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in
date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in
date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to
date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Intl.RelativeTimeFormat.supportedLocalesOf() - JavaScript
the intl.relativetimeformat.supportedlocalesof() method returns an array containing those of the provided locales that are supported in
date and time formatting without having to fall back to the runtime's default locale.
... return value an array of strings representing a subset of the given locale tags that are supported in
date and time formatting without having to fall back to the runtime's default locale.
...the language tags returned are those for which the runtime supports a locale in
date and time formatting that the locale matching algorithm used considers a match, so that it wouldn't have to fall back to the default locale.
... examples using supportedlocalesof assuming a runtime that supports indonesian and german but not balinese in
date and time formatting, supportedlocalesof returns the indonesian and german language tags unchanged, even though pinyin collation is neither relevant to
date and time formatting nor used with indonesian, and a specialized german for indonesia is unlikely to be supported.
Web video codec guide - Web media technologies
motion compression of video typically works by comparing frames, finding where they differ, and constructing records containing enough information to up
date the previous frame to approximate the appearance of the following frame.
...looking closely, we can see that the majority of these differences come from a horizontal camera move, making this a good candi
date for motion compensation.
...this makes vp8 a good candi
date for your content, although vp9 is an even better choice if available to you.
...vp9 is one of the two video codecs man
dated by webm (the other being vp8).
Animation performance and frame rate - Web Performance
for a rate of 60 frames per second, the browser has 16.7 milliseconds to execute scripts, recalculate styles and layout if needed, and repaint the area being up
dated.
... the process a browser uses to paint up
dated changes to a canvas element is different.
... when a canvas is animating a drawing, the canvas animation can be described as a waterfall consisting of the following steps: these sequenced need to fit into a single frame, since the screen isn't up
dated until it is complete.
... color properties that are rendered in their own layer don't even trigger a repaint, because the up
date is handled in composition.
x - SVG: Scalable Vector Graphics
candi
date recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candi
date recommendation definition for <pattern> scalable vector graphics (svg) 2the definition of 'x' in that specification.
... candi
date recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x' in that specification.
y - SVG: Scalable Vector Graphics
candi
date recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candi
date recommendation definition for <pattern> scalable vector graphics (svg) 2the definition of 'y' in that specification.
... candi
date recommendation definition for <text> and <tspan> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y' in that specification.
Example - SVG: Scalable Vector Graphics
lns="http://www.w3.org/1999/xhtml" xmlns:svg="http://www.w3.org/2000/svg"> <head> <title>a swarm of motes</title> <style type='text/css'> <![cdata[ label, input { width: 150px; display: block; float: left; margin-bottom: 10px; } label { text-align: right; width: 75px; padding-right: 20px; } br { clear: left; } ]]> </style> </head> <body onload='up
date()'> <svg:svg id='display' width='400' height='300'> <svg:circle id='cursor' cx='200' cy='150' r='7' fill='#0000ff' fill-opacity='0.5'/> </svg:svg> <p>a swarm of motes, governed by two simple principles.
... mote.prototype.capposition = function() { var dims = dimensions(); if( this.x < 0 ) this.x = 0; else if( this.x >= dims[0] ) this.x = dims[0]-1; if( this.y < 0 ) this.y = 0; else if( this.y >= dims[1] ) this.y = dims[1]-1; } // mote::move() -- move a mote, up
date the screen.
...t.setattributens(null,'stroke','green'); this.elt.setattributens(null,'stroke-width','3'); this.elt.setattributens(null,'stroke-opacity','0.5'); display().appendchild( this.elt ); } this.elt.setattributens(null,'x1',old_x); this.elt.setattributens(null,'y1',old_y); this.elt.setattributens(null,'x2',this.x); this.elt.setattributens(null,'y2',this.y); } function up
date() { // first call?
... if( num == 0 ) motes = []; else if( motes.length > num ) motes = motes.slice(0,num-1); // move a random mote if( motes.length > 0 ) motes[ rand( motes.length ) ].move(); // and do this again in 1/100 sec settimeout('up
date()', 10); } ]]> </script> </body> </html> ...
Using custom elements - Web Components
ustom-square> the class constructor is really simple — here we attach a shadow dom to the element, then attach empty <div> and <style> elements to the shadow root: const shadow = this.attachshadow({mode: 'open'}); const div = document.createelement('div'); const style = document.createelement('style'); shadow.appendchild(style); shadow.appendchild(div); the key function in this example is up
datestyle() — this takes an element, gets its shadow root, finds its <style> element, and adds width, height, and background-color to the style.
... function up
datestyle(elem) { const shadow = elem.shadowroot; shadow.queryselector('style').textcontent = ` div { width: ${elem.getattribute('l')}px; height: ${elem.getattribute('l')}px; background-color: ${elem.getattribute('c')}; } `; } the actual up
dates are all handled by the life cycle callbacks, which are placed inside the class definition as methods.
... the connectedcallback() runs each time the element is added to the dom — here we run the up
datestyle() function to make sure the square is styled as defined in its attributes: connectedcallback() { console.log('custom square element added to page.'); up
datestyle(this); } the disconnectedcallback() and adoptedcallback() callbacks log simple messages to the console to inform us when the element is either removed from the dom, or moved to a different page: disconnectedcallback() { console.log('custom square element removed from page.'); } adoptedcallback() { console.log('custom square element moved to new page.'); } the attributechangedcallback() callback is run whenever one of the element's attributes is changed in some way.
...in this case however, we are just running the up
datestyle() function again to make sure that the square's style is up
dated as per the new values: attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); up
datestyle(this); } note that to get the attributechangedcallback() callback to fire when an attribute changes, you have to observe the attributes.
Caching compiled WebAssembly modules - WebAssembly
if the wasm module code is up
dated, or its url changes, you will need to up
date dbversion.
... any subsequent call to instantiatecachedurl() will then clear out the entire cache, allowing you to avoid using out-of-
date modules.
...off by defining some necessary constants: function instantiatecachedurl(dbversion, url, importobject) { const dbname = 'wasm-cache'; const storename = 'wasm-cache'; setting up the database the first helper function contained inside instantiatecachedurl() — opendatabase() — creates an object store for storing wasm modules, and also handles clearing out the database if the dbversion is up
dated; it returns a promise resolving to the new database.
...bly.instantiatestreaming(fetch(url)).then(results => { return results.instance }); }); } caching a wasm module with the above library function defined, getting a wasm module instance and using its exported features (while handling caching in the background) is as simple as calling it with the following parameters: a cache version, which — as we explained above — you need to up
date when any wasm module is up
dated or moved to a different url.
XUL Migration Guide - Archive of obsolete content
first we'll outline how to decide whether your add-on is a good candi
date for migration via a comparison of the benefits and limitations of the sdk versus xul development.
... if your add-on can accomplish everything it needs using only the supported apis, it's a good candi
date for migration.
...it's a very simple add-on and a good candi
date for porting because there are suitable sdk apis for all its features.
lang/type - Archive of obsolete content
is
date(value) returns true if value is a
date, false otherwise.
... let { is
date } = require('sdk/lang/type'); is
date(new
date()); // true is
date('3/1/2013'); // false parameters value : mixed the variable to check.
... returns boolean : boolean indicating if value is a
date.
places/history - Archive of obsolete content
// we'd compose the query with the following options let lastweek =
date.now - (1000*60*60*24*7); search( // first query looks for all entries before last week with 'ruby' [{ query: "ruby", to: lastweek }, // second query searches all entries after last week with 'javascript' { query: "javascript", from: lastweek }], // we want to order chronologically by visit
date { sort: "
date" } ).on("end", function (results) { // results is an array of objects cont...
...aining visit data, // sorted by visit
date, with all entries from more than a week ago // that contain 'ruby', *in addition to* entries from this last week // that contain 'javascript' }); globals functions search(queries, options) queries can be performed on history entries by passing in one or more query options.
...possible options are 'title', '
date', 'url', 'visitcount', 'keyword', '
dateadded' and 'lastmodified'.
platform/xpcom - Archive of obsolete content
however, the components.classes object commonly used to look up factories by contract id will not be up
dated at run time.
...rvice using the getservice() api: var { class } = require('sdk/core/heritage'); var { unknown, service } = require('sdk/platform/xpcom'); var { cc, ci } = require('chrome'); var contractid = '@me.org/timestampedlogger'; // implement the service by subclassing unknown var timestampedlogger = class({ extends: unknown, get wrappedjsobject() this, log: function(message) { console.log(new
date().gettime() + ' : ' + message); } }); // register the service using the contract id var service = service({ contract: contractid, component: timestampedlogger }); // access the service using getservice() var wrapper = cc[contractid].getservice(ci.nsisupports); var logger = wrapper.wrappedjsobject; logger.log('a timestamped message'); by default, services are registered and unregistered a...
... this function is similar to the standard components.classes[contractid] with one significant difference: that components.classes is not up
dated at runtime.
Displaying annotations - Archive of obsolete content
then in the module's scope implement a function to up
date the matcher's workers, and edit handlenewannotation to call this new function when the user enters a new annotation: function up
datematchers() { matchers.foreach(function (matcher) { matcher.postmessage(simplestorage.storage.annotations); }); } function handlenewannotation(annotationtext, anchor) { var newannotation = new annotation(annotationtext, anchor); simplestorage.storage.ann...
...otations.push(newannotation); up
datematchers(); } annotation panel the annotation panel just shows the content of an annotation.
... updating main.js finally, up
date main.js with the code to construct the annotation panel: var annotation = panels.panel({ width: 200, height: 180, contenturl: data.url('annotation/annotation.html'), contentscriptfile: [data.url('jquery-1.4.2.min.js'), data.url('annotation/annotation.js')], onshow: function() { this.postmessage(this.content); } }); execute cfx run one last time.
Multiple item extension packaging - Archive of obsolete content
<rdf xmlns="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:nc="http://home.netscape.com/nc-rdf#" xmlns:em="http://www.mozilla.org/2004/em-rdf#"> <description about="urn:mozilla:install-manifest"> <!-- nsiup
dateitem type for a multiple item package --> <em:type nc:parsetype="integer">32</em:type> ...
...<rdf xmlns="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:em="http://www.mozilla.org/2004/em-rdf#"> <description about="urn:mozilla:install-manifest"> <!-- nsiup
dateitem type for a multiple item package --> <em:type>32</em:type> ...
...if this is not done, any items that are not compatible will not be installed unless a compatibility check discovers up
dated compatibility information.
Appendix: What you should know about open-source software licenses - Archive of obsolete content
pros and cons programs that have been released under the gpl man
date that any derivative works also be released under the gpl, so the code cannot be wrapped in a proprietary program.
...this condition, which is commonly referred to as “copyleft,” man
dates that any modification to the source code, or any new code combined with the source code, must be released under the same kind of license.
...(matsumoto up
dated his free software license diagnostic for a special open-source section in the january 2007 edition of softbank’s open source magazine.) if a company is considering releasing its own software as open source, it should consider dual-licensing or the cpl.
Adding menus and submenus - Archive of obsolete content
menu items are not dynamically up
dated while they are open.
... for example, you could have a menuitem that tells you the current time and is up
dated every second.
... on other systems you would be able to see the item up
date itself without having to close the menu and then reopen.
Mozilla Documentation Roadmap - Archive of obsolete content
mozilla blogs several mozilla community members maintain blogs that are up
dated frequently, often including information on api changes, bug fixes, useful tools and future release plans.
...it can be hard to follow due of the sheer mass of information coming out of it (dozens of posts per day), but you'll certainly be up to
date with pretty much everything if you take the time to read at least part of it.
...this blog is maintained by the add-ons team at mozilla, and it's a great way to stay up to
date with amo development and add-on review policies.
Useful Mozilla Community Sites - Archive of obsolete content
one of the main advantages of using amo is that it handles up
dates automatically for published add-ons.
... you just need to upload a new version of your extension, and once it's approved it will be pushed as an up
date to all your users.
... if you decide to host your own extension, you'll have to learn about the up
date system in order to push your own up
dates.
XPCOM Objects - Archive of obsolete content
this is generated from source, and it's kept relatively up to
date.
... floating point float boolean boolean, prbool void void timestamps prtime this type is used to pass timestamps measured in milliseconds, such as the output of the gettime() method in a javascript
date object.
...the only aspects to take into account are that methods and attributes must have the same names as their idl counterparts, and that the queryinterface method is implemented: queryinterface : function(aiid) { if (!aiid.equals(ci.xsihellocounter) && !aiid.equals(ci.nsisupports)) { throw cr.ns_error_no_interface; } return this; } the method is very simple, it vali
dates that the caller is requesting a supported interface, otherwise it throws an exception.
An Interview With Douglas Bowman of Wired News - Archive of obsolete content
it was a no-brainer to us that wired news was a perfect candi
date for the total conversion to xhtml and css.
...fortunately, our chief engineer was able to write some code that scraped through the database looking for errors like this which would invali
date our markup.
...meyer last up
dated
date: october 11th, 2002 copyright information: 2001-2003 netscape ...
List of Former Mozilla-Based Applications - Archive of obsolete content
eloped name description additional information aphrodite browser inactive aol client for mac internet software no longer available beonex communicator internet software last news item on site from 2004 chameleon theme builder inactive civil netizen p2p file delivery (email attachment replacement) site not up
dated since 2006 compuserve client internet software no longer available doczilla sgml/xml/html browser last release on site from july 2005 fabula language learning application inactive galeon browser last news item on site from september 2006 gencatrss rss reader domain switched over to domain parking service ghostzil...
...t computers no longer available hp printer assistant printer utility hall of fame page mentions that this used an embedded version of mozilla at some point but i can't find reference to current status (may still be using mozilla code?) icebrowser java browser sdk uses mozilla rhino --eol'ed in 2009 (jin'sync) office app launcher download page last up
dated on 12/21/06 kylix compiler and integrated development environment borland discontinued this product.
... project pogo browser from at&t site no longer accessible as of may 2009 pyro desktop desktop environment last news item on site from july 2007 script editor editor inactive skipstone gtk+ browser last news item on site from february 2008 xabyl visual xbl editor inactive xulplayer media player last project up
date on 3/14/09 zoomcreator photo collage tool on april 29, 2010 the site announced zoomara was shutting down.
List of Mozilla-Based Applications - Archive of obsolete content
if you have information about a new project or extra information about an existing project, please feel free to up
date this page.
...amework designed for elderly people with dementia but other applications mac os x operating system makes use of some mpl files such as libsecurity_asn1 maemo browser browser for maemo internet tablet development name is microb magooclient business process management tool uses mozilla rhino mantra security tool mccoy secure up
date tool for add-ons xulrunner application mediacoder media converter transcoder for video, audio, and even devices such as zen, zune, pocketpcs, ipods, and psps mekhala browser part of the khmeros linux distro midbrowser mobile web browser mockery mockup creation tool built on xulrunner mongodb database project uses spide...
...widgets desktop widgets uses mozilla spidermonkey yoono desktop social networking app standalone version of yoono firefox add-on zap sip client status up
date from august 2008 zimbra desktop email and calendar application uses prism zinc video browser according to faq the standalone version is based on firefox zk web application framework makes use of xul zotero reference manager firefox extension and xulrunner application note: this page was previously hosted on mozpad.org and the hist...
Autodial for Windows NT - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2002.
... original document information author(s): benjamin chuang last up
dated
date: october 2, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Enabling the behavior - updating the status periodically - Archive of obsolete content
now that we have code to retrieve tinderbox status and up
date the icon, we need to run it periodically.
... function loadtinderboxstatus() { gxmlhttprequest = new xmlhttprequest(); gxmlhttprequest.onload = up
datetinderboxstatus; gxmlhttprequest.open("get", "http://tinderbox.mozilla.org/seamonkey/panel.html"); gxmlhttprequest.send(null); window.settimeout(loadtinderboxstatus, 60000); } window.settimeout(loadtinderboxstatus, 1000); window.settimeout schedules functions to run at some future time.
...this allows users to get relatively frequent up
dates about tinderbox without overloading the tinderbox server or slowing down mozilla with requests.
Creating a Mozilla Extension - Archive of obsolete content
warning: the content of this article may be out of
date.
...see building an extension for an up-to-
date tutorial (it focuses on firefox, but is also applicable to other new applications).
...he structure specifying the appearance enabling the behavior - retrieving tinderbox status enabling the behavior - updating the status bar panel enabling the behavior - updating the status periodically making it into a static overlay making it into a dynamic overlay and packaging it up for distribution conclusion next » original document information author(s): myk melez last up
dated
date: september 19, 2006 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating a hybrid CD - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2001.
... original document information author(s): dawn endico last up
dated
date: may 1, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating a Release Tag - Archive of obsolete content
warning: the content of this article may be out of
date.
... it has not been up
dated for usage of mercurial.
...-name cvs | xargs -l -p10 cvs tag -l mozilla_0_9_4_1_release >& ../taglog original document information author(s): dawn endico last up
dated
date: november 1, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Creating regular expressions for a microsummary generator - Archive of obsolete content
but to make it more robust, we should accommo
date the possibility of variation in the query parameters.
... for example, the following is an equally valid url for the same auction item: http://cgi.ebay.com/ws/ebayisapi.dll?viewitem&foo=bar&item=170019463424 to accommo
date these variations in query parameters, we can insert a period followed by an asterisk (.*) between "viewitem&" and "item=" to match any characters that might appear between those two strings: ^http://cgi\.ebay\.com/ws/ebayisapi\.dll\?viewitem&.*item= the period followed by an asterisk matches any combination of characters, including no characters at all, so it works even if "viewitem&" and "it...
...here's a url for the same item in that different style: http://cgi.ebay.com/mozilla-firefox-logo-1-inch-pin-badge-button-browser_w0qqitemz280018439106qqihz018qqcategoryz2036qqcmdzviewitem to accommo
date these urls, we can create a second regular expression that matches them.
Block and Line Layout Cheat Sheet - Archive of obsolete content
if you know the answer, please pass it along to me so i can up
date the document.
... ll_understandsnwhitespace ll_textstartswithnbsp ll_firstletterstyleok ll_istopofpage ll_up
datedband ll_impactedbyfloaters ll_lastfloaterwasletterframe ll_canplacefloater ll_knowstrictmode ll_instrictmode ll_lineendsinbr perframedata (why isn't this just stored in the frame?) mflags pfd_relativepos pfd_istextframe pfd_isnonemptytextframe pfd_isnonwhitespacetextframe pfd_isletterframe pfd_issticky pfd_isbullet perspandata in nslinelayout, a "span" is a con...
... original document information author(s): chris waterson last up
dated
date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Building Firefox with Rust code - Archive of obsolete content
if you don't have rust already, use the rustup tool to install it and up
date as new releases become available, or use the ./mach bootstrap command.
... cargo.lock files have also been checked in, so you will need to up
date those as well when appropriate.
... this works even if you use the existing vendored source location, but be aware that other vendor up
dates could clobber your patch in that case.
Document Loading - From Load Start to Finding a Handler - Archive of obsolete content
href="#nscategorymanager"> <area alt="nsdocumentopeninfo" coords="371,71,635,185" href="#nsdocumentopeninfo"> <area alt="necko" coords="721,113,821,157" href="#necko"> <area alt="nsuriloader" coords="23,335,215,455" href="#nsuriloader"> <area coords="227,515,485,575" href="#nsiuricontentlistener"> <area alt="nsdocshell" coords="47,83,203,153" href="#nsdocshell"></map> this block diagram is out of
date as of january 2012 with regard to some minor control flow shuffling in nsuriloader.
... the prose description below has been up
dated.
... original document information author(s): boris zbarsky last up
dated
date: october 24, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
HTTP Class Overview - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2002.
...derarray stores http "<header>:<value>" pairs nshttpauthcache stores authentication credentials for http auth domains nshttpbasicauth implements nsihttpauthenticator generates basic auth credentials from user:pass nshttpdigestauth implements nsihttpauthenticator generates digest auth credentials from user:pass original document information author(s): darin fisher last up
dated
date: august 5, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Helper Apps (and a bit of Save As) - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2002.
... original document information author(s): boris zbarsky last up
dated
date: september 12, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Introducing the Audio API extension - Archive of obsolete content
avoid using it and up
date existing code if possible; see the compatibility table at the bottom of this page to guide your decision.
... var prebuffersize = samplerate * 0.020; // initial buffer is 20 ms var autolatency = true, started = new
date().valueof(); ...
... // auto latency detection if (autolatency) { prebuffersize = math.floor(samplerate * (new
date().valueof() - started) / 1000); if (audio.mozcurrentsampleoffset()) { // play position moved?
Simple Storage - Archive of obsolete content
jetpack.future.import("menu");jetpack.future.import("selection");jetpack.future.import("storage.simple");// create the persistent notes array if it doesn't already exist.jetpack.storage.simple.notes = jetpack.storage.simple.notes || [];var notes = jetpack.storage.simple.notes;// up
dates the jetpack menu with the current notes.
... if there are no notes, we'll show a// disabled "(empty)" menuitem.function up
datejetpackmenu() { jetpack.menu.set({ label: "notes", menu: new jetpack.menu(notes.length > 0 ?
...:(jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); up
datejetpackmenu(); } });};// initialize the jetpack menu with the current notes.up
datejetpackmenu(); see also settings jep 11 ...
Microsummary topics - Archive of obsolete content
in the future, firefox may access source urls to download up
dated versions of generators, so unless you are installing generators which are available from urls, you should not use this form for your programmatically-installed generators.
... differentiating between user-initiated and microsummary-related requests when firefox up
dates a microsummary generated by a microsummary generator add-on, it automatically downloads the html content of the page being summarized.
... controlling the frequency of microsummary requests when firefox downloads content in order to up
date a microsummary, it honors cache-related http response headers.
Migrate apps from Internet Explorer to Mozilla - Archive of obsolete content
var elm; if (ns4) elm = document.layers["myid"]; else if (ie4) elm = document.all["myid"] the above code isn't extensible, so if you want it to support a new browser, you must up
date these blocks throughout the web application.
... javascript
date differences the only
date difference is the getyear method.
... as per the ecmascript specification (which is the specification javascript follows), running new
date().getyear() in 2004 will return "104".
File object - Archive of obsolete content
here is the original proposal for this object, and a status up
date from december 1998: http://www.mozilla.org/js/js-file-object.html created by the file constructor: new file(); new file(filename); parameters filename name of the file we want to work with.
... file.creationtime a
date object representing the time when the file was created.
... file.lastmodified a
date object representing the time when the file was last modified.
Table Layout Regression Tests - Archive of obsolete content
warning: the content of this article may be out of
date.
... up
date the rtest.lst file in the corresponding directory in order to include your file.
... original document information author(s): bernd mielke other contributors: boris zbarsky last up
dated
date: february 5, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
URIs and URLs - Archive of obsolete content
warning: the content of this article may be out of
date.
... it was last up
dated in 2002.
... original document information author(s): andreas otte last up
dated
date: january 2, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Attribute (XUL) - Archive of obsolete content
accesskeyextra1 buttonaccesskeyextra2 buttonaccesskeyhelp buttonalign buttondir buttondisabledaccept buttonlabelaccept buttonlabelcancel buttonlabeldisclosure buttonlabelextra1 buttonlabelextra2 buttonlabelhelp buttonorient buttonpack buttons checked checkstate clicktoscroll class closebutton closemenu coalesceduplicatearcs collapse collapsed color cols command commandup
dater completedefaultindex container containment contentcontextmenu contenttooltip context contextmenu control crop curpos current currentset customindex customizable cycler datasources decimalplaces default defaultbutton defaultset description dir disableautocomplete disableautoselect disableclose disabled disablehistory disablekeynavigation disablesecurity dlgtype drag...
...dpanel max maxheight maxlength maxpos maxrows maxwidth member menu menuactive min minheight minresultsforpopup minwidth mode modifiers mousethrough movetoclick multiline multiple name negate newlines next noautofocus noautohide noinitialfocus nomatch norestorefocus object observes onbeforeaccept onbookmarkgroup onchange onclick onclosetab oncommand oncommandup
date ondialogaccept ondialogcancel ondialogclosure ondialogextra1 ondialogextra2 ondialoghelp onerror onerrorcommand onextra1 onextra2 oninput onload onnewtab onpageadvanced onpagehide onpagerewound onpageshow onpaneload onpopuphidden onpopuphiding onpopupshowing onpopupshown onsearchcomplete onselect ontextcommand ontextentered ontextrevert ontextreverted onunload onwiza...
...us showcaret showcommentcolumn showpopup size sizemode sizetopopup smoothscroll sort sortactive sortdirection sortresource sortresource2 spellcheck src state statedatasource statusbar statustext style subject substate suppressonselect tabindex tabscrolling targets template timeout title toolbarname tooltip tooltiptext tooltiptextnew top type uri useraction vali
date value var visuallyselected wait-cursor width windowtype wrap wraparound ...
Introduction to XUL - Archive of obsolete content
warning: the content of this article may be out of
date.
... someday, there will be a complete description of this mechanism at packages, but for now there's a good but somewhat out of
date document at configurable chrome available for more information.
... original document information author(s): danm@netscape.com last up
dated
date: january 31, 2005 copyright information: copyright (c) danm@netscape.com ...
Adding more elements - Archive of obsolete content
first, we will add the capability to search for other information such as the file size and
date.
... <hbox> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="
date modified"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <textbox id="find-text" flex="1" style="min-width: 15em;"/> </hbox> two drop down boxes have been added to the dialog.
...<spacer style="height: 10px"/> <hbox> <menulist id="searchtype"> <menupopup> <menuitem label="name"/> <menuitem label="size"/> <menuitem label="
date modified"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <menulist id="searchmode"> <menupopup> <menuitem label="is"/> <menuitem label="is not"/> </menupopup> </menulist> <spacer style="width: 10px;"/> <textbox id="find-text" flex="1" style="min-width: 15em;"/> </hbox> <spacer style="height: 10px" flex="1"/> <hbox> now when the dialog is resized, t...
Adding Properties to XBL-defined Elements - Archive of obsolete content
for example, the following field is given a default value equal to the current time: <field name="currenttime"> new
date().gettime(); </field> properties sometimes you will want to vali
date the data that is assigned to a property.
...this script should store the value somewhere, or vali
date the value.
...use this to vali
date it or store it.
Install Scripts - Archive of obsolete content
for example, you may wish to check versions of files and only install up
dated files, or perhaps you wish to apply patches to existing files.
...when a new component is installed, the registry gets up
dated.
...that way, it is easier to check if a version of your component is already present and only up
date it if necessary.
Introduction to RDF - Archive of obsolete content
a bookmarks list contains a set of records, each with a set of data associated with it, such as a url, a bookmark title and a visited
date.
...zilla bookmark list is described by the uris below: name http://home.netscape.com/nc-rdf#name bookmark name url http://home.netscape.com/nc-rdf#url url to link to description http://home.netscape.com/nc-rdf#description bookmark description last visited http://home.netscape.com/web-rdf#lastvisit
date date of last visit these are generated by taking a namespace name and appending the field name.
...note that the last visited
date has a slightly different namespace than the other three.
menuitem - Archive of obsolete content
attributes acceltext, accesskey, allowevents, autocheck, checked, closemenu, command, crop, description, disabled, image, key, label, name, selected, tabindex, type, vali
date, value properties accessibletype, accesskey, command, control, crop, disabled, image, label, labelelement, parentcontainer, selected, tabindex, value style classes menuitem-iconic, menuitem-non-iconic examples <menulist> <menupopup> <menuitem label="option 1" value="1"/> <menuitem label="option 2" value="2"/> <menuitem label="option 3" value="3"/> <menuitem label=...
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
... more information on adding checkmarks to menus in the xul tutorial vali
date type: one of the values below this attribute indicates whether to load the image from the cache or not.
menulist - Archive of obsolete content
for example, for a menuitem in a menu you can add the following css rule when you want to use the value none: menupopup > menuitem, menupopup > menu { max-width: none; } disableautoselect type: boolean if this attribute is true or omitted, the selected item on the menu will up
date to match what the user entered in the textbox.
...if this attribute is false, the selection is never up
dated to match the text box.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
tab - Archive of obsolete content
attributes accesskey, afterselected, beforeselected, command, crop, disabled, first-tab, image, label, last-tab, linkedpanel, oncommand, pending, pinned, selected, tabindex, unread, vali
date, value properties accesskey, accessibletype, command, control, crop, disabled, image, label, linkedpanel, selected, tabindex, value examples (example needed) attributes accesskey type: character this should be set to a character that is used as a shortcut key.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
... vali
date type: one of the values below this attribute indicates whether to load the image from the cache or not.
toolbarbutton - Archive of obsolete content
attributes accesskey, autocheck, checkstate, checked, command, crop, dir, disabled, dlgtype, group, image, label, oncommand, open, orient, tabindex, title, type, vali
date properties accesskey, accessibletype, autocheck, checkstate, checked, command, crop, dir, disabled, dlgtype, group, image, label, open, orient, tabindex, type examples <toolbar id="test-toolbar"> <toolbarbutton accesskey="p" label="plain"/> <toolbarbutton accesskey="c" label="checkbox" type="checkbox"/> <toolbarbutton accesskey="b" label="menu-button" type="menu-button"> <...
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
... examples: type value <toolbarbutton > menu menu-button checkbox radio vali
date type: one of the values below this attribute indicates whether to load the image from the cache or not.
XUL Explorer - Archive of obsolete content
option to automatically up
date the preview as the editor changes.
... simple xul checker can be used to ‘vali
date’ the xul snippet.
... installs latest version: install (windows): xulexplorer-1.0a1pre.en-us.win32.exe 6.6mb install (mac): xulexplorer-1.0a1pre.en-us.mac.dmg 9.3mb install (linux): xulexplorer-1.0a1pre.en-us.linux-i686.tar.bz2 8.4mb contributing source code in svn bugzilla (for bugs and suggestions) open bugs, enter new bug blog posts xul explorer - up
dated (1.0a1pre) xul explorer 0.4 xul explorer 0.3 xul explorer 0.2 exploring xul ...
2006-10-27 - Archive of obsolete content
summary: mozilla.dev.quality - october 20-october 27, 2006 announcements firefox & thunderbird 1.5.0.8 candi
date builds available for testing!
... - with firefox 2.0 out the door, it's time to make sure that all 1.5.0.x users are up
dated with the latest and greatest in stability and security fixes!
... up
date welcome page - a bug has been discovered when updating to firefox 2.0.
NPN_ForceRedraw - Archive of obsolete content
description once a region of a windowless plugin has been invali
dated with npn_invali
daterect() or npn_invali
dateregion(), a plug-in can call npn_forceredraw() to force a paint message.
... this causes a synchronous up
date event or paint message for the plug-in.
...see also drawing and event handling npn_invali
daterect() npn_invali
dateregion() npp_handleevent() npp ...
NPRegion - Archive of obsolete content
syntax windows: typedef hrgn npregion; mac os x: typedef rgnhandle npregion; note: this may need to be up
dated for the cocoa event model.
... xwindows: typedef region npregion; description npregion defines the region of the plug-in window to be up
dated, painted, invali
dated, or clipped to.
...see also npn_forceredraw() npn_invali
daterect() npn_invali
dateregion() npwindow nprect ...
Why RSS Slash is Popular - Counting Your Comments - Archive of obsolete content
an example using the most popular element of the rss slash module is shown below: <?xml version="1.0"> <rss version="2.0" xmlns:slash="http://purl.org/rss/1.0/modules/slash/" > <channel> <title>example</title> <description>an rss example with slash</description> <lastbuild
date>sun, 15 may 2005 13:02:08 -0500</lastbuild
date> <link>http://www.example.com</link> <item> <title>review of sin city</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/114</guid> <pub
date>sun, 15 may 2005 13:02:08 -0500</lastbuild
date></pub
date> <link>http://www.example.com/blog/2005/05/15/114</link> ...
... <slash:comments>43</slash:comments> </item> <item> <title>what is the 3571st prime number</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</guid> <pub
date>sun, 15 may 2005 10:55:12 -0500</lastbuild
date></pub
date> <link>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</link> <slash:comments>72</slash:comments> </item> <item> <title>first article!</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/112</guid> <pub
date>sun, 15 may 2005 08:14:11 -0500</lastbuild
date></pub
date> <link>http://www.example.com/blog/2005/05/15/112</link> <slash:comments>118</slash:comme...
...one could assume that the comment count was acurate at the moment in time specified in the <channel>'s <lastbuild
date> element, but that is a risky assumption given that no where is that man
dated.
Digital Signatures - Archive of obsolete content
figure 1 shows a simplified view of the way a digital signature can be used to vali
date the integrity of signed data.
...to vali
date the integrity of the data, the receiving software first uses the signer's public key to decrypt the hash.
... original document information author(s): ella deon lackey last up
dated
date: 2012 copyright information: © 2012 red hat, inc.
NSPR Release Engineering Guide - Archive of obsolete content
feature complete up
date ...pr/include/prinit.h with release numbers build all targets, debug and optimized on all platforms using local directories run the test suite on all targets verify release numbers show up in binaries resolve testing anomalies tag the tree with nsprpub_release_x_y_z_beta beta release checkout a whole new tree using the tag from above build all targets, debug and optimized on all platforms using the command: gmake release mdist=<dir>/mdist build_number=vx.y.z [build_opt=1 | use_debug_rtl=1] copy the bits from mdist to /share/builds/components/nspr20/.vx.y.z 1 run e...
...xplode.pl run the test suite on all targets, using binaries & headers from shipped bits resolve testing anomalies tag the tree with nsprpub_release_x_y[_z] release candi
date checkout a whole new tree using tag (including fixes) tag the treey with nsprpub_release_x_y_z build all targets, debug and optimized on all platforms using the command: gmake release mdist=<dir>/mdist build_number=vx.y.z [build_opt=1 | use_debug_rtl=1] copy the bits from mdist to /share/builds/components/nspr20/.vx.y.z in /share/builds/components/nspr20/ run the following scripts: explode.pl rename.sh symlink.sh rtm bits rename the .vx.y.z directory to vx.y.z (remove the hidden directory 'dot').
... copy /share/builds/components/nspr20/vx.y.z/* to /share/systems/mozilla/pub/nspr/vx.y.z/ original document information author: larryh@netscape.com last up
dated
date: september 20, 2000 1 copying files to /share/builds/components requires that one be logged on to a machine named "smithers" as user "svbld".
Threats - Archive of obsolete content
original document information author(s): ella deon lackey last up
dated
date: 2012 copyright information: © 2012 red hat, inc.
... link: red hat certificate system common criteria certification 8.1: deployment, planning, and installation original document information author(s): joint task force transformation initiative title: national institute of standards and technology (nist) special publication 800-30 revision 1, guide for conducting risk assessments last up
dated
date: september 2012 copyright information: this document is not subject to copyright.
... original document information author(s): karen scarfone, wayne jansen, and miles tracy title: national institute of standards and technology (nist) special publication 800-123, guide to general server security last up
dated
date: july 2008 copyright information: this document is not subject to copyright.
Theme changes in Firefox 3 - Archive of obsolete content
this article covers the changes that need to be made to up
date a firefox theme to work properly in firefox 3.
... browser changes requiring theme up
dates there are a number of changed and deleted files in the browser that may require you to make changes to your theme.
... the table lists both the changed xul file and the theme's corresponding css file that you might need to up
date.
Processing XML with E4X - Archive of obsolete content
this node has one attribute, type, which can be accessed and up
dated in a number of ways: alert(languages.@type); // alerts "dynamic" languages.@type = "agile"; alert(languages.@type); // alerts "agile" alert(languages.tostring()); /* alerts: <languages type="agile"><lang>javascript</lang><lang>python</lang></languages> */ note that if one wishes to make comparisons of retrieved attributes with other strings, it is necessary to convert the attribute...
...syntax without needing to create a well-formed xml document, using the following syntax: var xmllist = <> <lang>javascript</lang> <lang>python</lang> </>; the += operator can be used to append new elements to an xmllist within a document: languages.lang += <lang>ruby</lang>; note that unlike node lists returned by regular dom methods, xmllists are static and are not automatically up
dated to reflect changes in the dom.
... if you create an xmllist as a subset of an existing xml object and then modify the original xml object, the xmllist will not reflect those changes; you will need to re-create it to get the most recent up
dates: var languages = <languages> <lang>javascript</lang> <lang>python</lang> </languages>; var lang = languages.lang; alert(lang.length()); // alerts 2 languages.lang += <lang>ruby</lang>; alert(lang.length()); // still alerts 2 lang = languages.lang; // re-create the xmllist alert(lang.length()); // alerts 3 searching and filtering e4x provides special operators for selecting nodes within a document that match specific criteria.
New in JavaScript 1.3 - Archive of obsolete content
--> new features in javascript 1.3 new globals nan infinity undefined new methods isfinite() function.prototype.call() function.prototype.apply()
date.utc()
date.prototype.getfullyear()
date.prototype.setfullyear()
date.prototype.getmilliseconds()
date.prototype.setmilliseconds()
date.prototype.getutcfullyear()
date.prototype.getutcmonth()
date.prototype.getutc
date()
date.prototype.getutchours()
date.prototype.getutcminutes()
date.prototype.getutcseconds()
date.prototype.getutcmilliseconds()
date.prototype.toutcstring()
date.protot...
...ype.setutcfullyear()
date.prototype.setutcmonth()
date.prototype.setutc
date()
date.prototype.setutchours()
date.prototype.setutcminutes()
date.prototype.setutcseconds()
date.prototype.setutcmilliseconds() other new features strict equality operators unicode support a javascript console was introduced.
... changed functionality in javascript 1.3 changes to
date to conform with ecma-262 new constructor
date(year, month, day, [,hours [, minutes [, seconds [, milliseconds ]]]]) additional method parameters: setmonth(month[,
date]) sethours(hours[, min[, sec[, ms]]]) setminutes(min[, sec[, ms]]) setseconds(sec[, ms]) the length of an array (property length) is now an unsigned, 32-bit integer.
Standards-Compliant Authoring Tools - Archive of obsolete content
html-kit is a full-featured, low priced editor designed to help html, xhtml and xml authors to edit, format, lookup help, vali
date, preview and publish web pages.
...always be sure to vali
date your web pages.
... original document information last up
dated
date: january 30th, 2003 copyright © 2001-2003 netscape.
XForms Select Element - Archive of obsolete content
characteristics analogous widgets are <html:select size="5" multiple="true"/> and <xul:listbox seltype="multiple"/> visual grouping by choices element isn't implemented if incremental attribute value is false, the bound node is up
dated when the select control is blurred (i.e.
... loses focus), otherwise it is up
dated upon item selection check group the select is represented as group of checkboxes (xhtml/xul).
... characteristics appearance attribute contains the value full there are no analogue widgets in xhtml or in xul visual grouping by choices element is supported if incremental attribute value is false then bound node is up
dated when item is blurred examples <xf:model> <xf:instance> <data xmlns=""> <values>g</values> </data> </xf:instance> </xf:model> <xf:select ref="/data/values" appearance="full"> <xf:choices> <xf:label>green colors</xf:label> <xf:item> <xf:label>pale green</xf:label> <xf:value>pg</xf:value> </xf:item> <xf:item> <xf:label>green</xf:label> <xf:value>g</xf:value> </xf:item> </xf:choices> <xf:choices> <xf:label>red colors</xf:label> <xf:item> <xf:label>red</xf:label> <xf:value>r</xf:va...
Fixing Incorrectly Sized List Item Markers - Archive of obsolete content
one solution is to move the rule into its own stylesheet, and accept that the stylesheet in question will never vali
date.
... this might also be a place to put any explorer-specific css-like rules (such as scrollbar styling rules), which also will not vali
date.
...meyer, netscape communications last up
dated
date: published 04 oct 2002; revised 07 mar 2003 copyright information: copyright © 2001-2003 netscape.
Windows Media in Netscape - Archive of obsolete content
in ie, a named html element such as a div may be given to the windows media player control and it will be automatically up
dated with caption data.
...fortunately, windows media player also fires a scriptcommand() event for closed captioning, which means content may up
date the caption manually with a small piece of javascript.
... original document information authors: arun ranganathan, bob clary, ian oeschger last up
dated
date: 30 jun 2003 copyright information: copyright © 2001-2003 netscape.
Archive of obsolete content
they are actually replaced by ''-(example removed)-'' the goal of this handbook is to help you up
date websites to work with standards-based browsers and properly detect gecko.
...if you have information about a new project or extra information about an existing project, please feel free to up
date this page.
... updating an extension to support multiple mozilla applications this article shows how to take an existing extension and up
date it so that it can be used in additional mozilla applications.
Building up a basic demo with PlayCanvas editor - Game development
as you can see, the file contains some boilerplate code already: pc.script.create('boxanimation', function (app) { // creates a new boxanimation instance var boxanimation = function (entity) { this.entity = entity; }; boxanimation.prototype = { // called once after all resources are loaded and before the first up
date initialize: function () { }, // called every frame, dt is time in seconds since last up
date up
date: function (dt) { } }; return boxanimation; }); the most interesting part is the up
date() function, which is where we can put any code that we want repeated on every frame.
...add this code to the initialize() function: this.timer = 0; and those two lines to the up
date() function: this.timer += dt; this.entity.setlocalscale(1, math.abs(math.sin(this.timer)), 1); the setlocalscale() method applies the given values to the x, y and z axes of the object.
... next, add the following line to the initialize() function: this.timer = 0; to move the cone up and down we will use the setposition() method — add the code below to the up
date() function: this.timer += dt; this.entity.setposition(2, math.sin(this.timer*2), 0); the position of the cone will be animated on each frame by being passed the math.sin() value of the timer at each point in time — we have doubled the this.timer value to make it move higher.
Audio for Web games - Game development
note: in many ways the concept of buffering is an out
dated one.
...if you space your individual sounds by at least 500ms then using the timeup
date event (which fires every 250ms) should be sufficient.
...work: var myaudio = document.getelementbyid('myaudio'); var buttons = document.getelementsbytagname('button'); var stoptime = 0; for (var i = 0; i < buttons.length; i++) { buttons[i].addeventlistener('click', function() { myaudio.currenttime = this.getattribute("data-start"); stoptime = this.getattribute("data-stop"); myaudio.play(); }, false); } myaudio.addeventlistener('timeup
date', function() { if (this.currenttime > stoptime) { this.pause(); } }, false); note: you can try out our audio sprite player live on jsfiddle.
Desktop mouse and keyboard controls - Game development
dkey(phaser.keycode.s); to support both the cursor and w a s d keys, we need to do this: if(this.cursors.left.isdown || this.keyleft.isdown) { // move left } else if(this.cursors.right.isdown || this.keyright.isdown) { // move right } if(this.cursors.up.isdown || this.keyup.isdown) { // move up } else if(this.cursors.down.isdown || this.keydown.isdown) { // move down } in the up
date() function we can now move the player's ship in any direction using one of the two sets of movement key options.
...for w a s d keys it can be the space bar: this.keyfire1 = this.input.keyboard.addkey(phaser.keycode.x); this.keyfire2 = this.input.keyboard.addkey(phaser.keycode.spacebar); in the up
date() function we can easily check if any of those two were pressed on each frame: if(this.keyfire1.isdown || this.keyfire2.isdown) { // fire the weapon } if yes, then it's time to shoot some bullets!
... we can even define a secret cheat button: this.keycheat = this.input.keyboard.addkey(phaser.keycode.c); and then in the up
date() function whenever c is pressed we'll do this: if(this.keycheat.isdown) { this.player.health = this.player.maxhealth; } we can set the health of the player to maximum.
Collision detection - Game development
up
date the following part of the code as indicated by the highlighted line: var bricks = []; for(var c=0; c<brickcolumncount; c++) { bricks[c] = []; for(var r=0; r<brickrowcount; r++) { bricks[c][r] = { x: 0, y: 0, status: 1 }; } } next we'll check the value of each brick's status property in the drawbricks() function before drawing it — if status is 1, then draw it, but if it's ...
...up
date your drawbricks() function as follows: function drawbricks() { for(var c=0; c<brickcolumncount; c++) { for(var r=0; r<brickrowcount; r++) { if(bricks[c][r].status == 1) { var brickx = (c*(brickwidth+brickpadding))+brickoffsetleft; var bricky = (r*(brickheight+brickpadding))+brickoffsettop; bricks[c][r].x = brickx; bricks[c][r].y = bricky; ctx.beginpath(); ctx.rect(brickx, bricky, brickwidth, brickheight); ctx.fillstyle = "#0095dd"; ctx.fill(); ctx.closepath(); } } } } tracking and updating the status in the collision detec...
...up
date your collisiondetection() function as indicated below: function collisiondetection() { for(var c=0; c<brickcolumncount; c++) { for(var r=0; r<brickrowcount; r++) { var b = bricks[c][r]; if(b.status == 1) { if(x > b.x && x < b.x+brickwidth && y > b.y && y < b.y+brickheight) { dy = -dy; b.status = 0; } } } } } activating our collision detection the last thing to do...
Move the ball - Game development
updating the ball's position on each frame remember the up
date() function and its definition?
... the code inside it is executed on every frame, so it's a perfect place to put the code that will up
date the ball's position on screen.
... add the following new lines of the code inside up
date(), as shown: function up
date() { ball.x += 1; ball.y += 1; } the code above adds 1 to the x and y properties representing the the ball coordinates on the canvas, on each frame.
Gecko FAQ - Gecko Redirect 1
: html 4.0 - full support except for: elements: bdo, basefont attributes: shape attribute on the a element, abbr, axis, headers, scope-row, scope-col, scope-rowgroup, scope-colgroup, charoff, datasrc, datafld, dataformat, datapagesize, summary, event, dir, align on table columns, label attribute of option, alternate text of area elements, longdesc various metadata attributes: cite,
datetime, lang, hreflang bidirectional text layout, which is only used in hebrew and arabic (ibm has begun work to add bidi support in a future release) style sheets css 1 - full support, except for: the application of styles to html column elements the ability to turn off author styles the names of certain mozilla extension pseudo-classes lack the moz- prefix ...
... xml 1.0: full support, except for processing to manipulate default attributes rdf: full support, except for abouteach, abouteachprefix, and parsetype javascript 1.5, including ecma-262 edition 3 (ecmascript) compliance, except for
date.to
datestring and
date.totimestring, which are not implemented transfer protocols: http 1.1 (including gzip compression), ftp ssl unicode oji (open java interface) image formats png gif jpeg, pjpeg does "full support" mean that gecko has zero bugs today or will have zero bugs at some point in the future?
...here are some links to lists of reported bugs related to the standards mentioned above; be aware that these raw lists of open in-process bugs will inevitably include some duplicate, out of
date, unreproducible, invalid, and incorrectly tagged reports: the links themselves are probably out
dated too.
Cacheable - MDN Web Docs Glossary: Definitions of Web-related terms
note that some non-cacheable requests/responses to a specific uri may invali
date previously cached responses on the same uri.
... for example, a put to pagex.html will invali
date all cached get or head requests to the same uri.
...moreover, it invali
dates cached data for request to the same uri done via head or get: put /pagex.html http/1.1 (…) 200 ok (…) a specific cache-control header in the response can prevent caching: get /pagex.html http/1.1 (…) 200 ok cache-control: no-cache (…) ...
CSS and JavaScript accessibility best practices - Learn web development
the rule of thumb is that you can up
date the styling of a page feature to fit in your design, but don't change it so much that it no longer looks or behaves as expected.
... modern javascript is a powerful language, and we can do so much with it these days, from simple content and ui up
dates to fully-fledged 2d and 3d games.
...we've used <label> elements to make sure the form labels are unambiguously linked to their inputs, so screen readers can read them out alongside: <label for="name">enter your name:</label> <input type="text" name="name" id="name"> we only do the validation when the form is submitted — this is so that we don't up
date the ui too often and potentially confuse screen reader (and possibly other) users: form.onsubmit = vali
date; function vali
date(e) { errorlist.innerhtml = ''; for(let i = 0; i < formitems.length; i++) { const testitem = formitems[i]; if(testitem.input.value === '') { errorfield.style.left = '360px'; createlink(testitem); } } if(errorlist.innerhtml !== '') { e...
Legacy layout methods - Learn web development
up
date the second css rule (with the .wrapper selector) as follows: body { width: 90%; max-width: 980px; margin: 0 auto; } .wrapper { padding-right: 2.08333333%; } not only have we given it a percentage width, we have also added a max-width property in order to stop the layout becoming too wide.
... next, up
date the fourth css rule (with the .col selector) like so: .col { float: left; margin-left: 2.08333333%; width: 6.25%; background: rgb(255, 150, 150); } now comes the slightly more laborious part — we need to up
date all our .col.span rules to use percentages rather than pixel widths.
... up
date the bottom block of css rules with the following: /* two column widths (12.5%) plus one gutter width (2.08333333%) */ .col.span2 { width: 14.58333333%; } /* three column widths (18.75%) plus two gutter widths (4.1666666) */ .col.span3 { width: 22.91666666%; } /* and so on...
Positioning - Learn web development
</p> now add the following rule to the bottom of your css: .positioned { position: static; background: yellow; } if you now save and refresh, you'll see no difference at all, except for the up
dated background color of the 2nd paragraph.
...go ahead and up
date the position declaration in your code: position: relative; if you save and refresh at this stage, you won't see a change in the result at all.
... now, up
date the body rule to remove the position: relative; declaration and add a fixed height, like so: body { width: 500px; height: 1400px; margin: 0 auto; } now we're going to give the <h1> element position: fixed;, and get it to sit at the top of the viewport.
Example 4 - Learn web development
.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.queryselector('.optlist'); optlist.classlist.toggle('hidden'); } function highlightoption(select, option) { var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function up
datevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.queryselector('.value'); var optionlist = select.queryselectorall('.option'); nativewidget.selectedindex = index; value.innerhtml = optionlist[index].innerhtml; highlightoption(select, optionlist[index]); }; function getindex(select) { var nativewidget = select.previouselementsibling; ret...
...r', function (event) { deactivateselect(select); }); }); }); window.addeventlistener('load', function () { var selectlist = document.queryselectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.queryselectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; up
datevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('click', function (event) { up
datevalue(select, index); }); }); select.addeventlistener('keyup', function (event) { var length = optionlist.length, index = getindex(select); if (event.keycode === 27) { deactivateselect(select); } if (ev...
...ent.keycode === 40 && index < length - 1) { index++; } if (event.keycode === 38 && index > 0) { index--; } up
datevalue(select, index); }); }); }); result ...
Example 5 - Learn web development
.classlist.add('active'); }; function toggleoptlist(select, show) { var optlist = select.queryselector('.optlist'); optlist.classlist.toggle('hidden'); } function highlightoption(select, option) { var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.classlist.remove('highlight'); }); option.classlist.add('highlight'); }; function up
datevalue(select, index) { var nativewidget = select.previouselementsibling; var value = select.queryselector('.value'); var optionlist = select.queryselectorall('.option'); optionlist.foreach(function (other) { other.setattribute('aria-selected', 'false'); }); optionlist[index].setattribute('aria-selected', 'true'); nativewidget.selectedindex = index; value.innerhtml = optionli...
... form.classlist.remove("no-widget"); form.classlist.add("widget"); }); window.addeventlistener('load', function () { var selectlist = document.queryselectorall('.select'); selectlist.foreach(function (select) { var optionlist = select.queryselectorall('.option'), selectedindex = getindex(select); select.tabindex = 0; select.previouselementsibling.tabindex = -1; up
datevalue(select, selectedindex); optionlist.foreach(function (option, index) { option.addeventlistener('mouseover', function () { highlightoption(select, option); }); option.addeventlistener('click', function (event) { up
datevalue(select, index); }); }); select.addeventlistener('click', function (event) { toggleoptlist(select); }); ...
...ner('blur', function (event) { deactivateselect(select); }); select.addeventlistener('keyup', function (event) { var length = optionlist.length, index = getindex(select); if (event.keycode === 27) { deactivateselect(select); } if (event.keycode === 40 && index < length - 1) { index++; } if (event.keycode === 38 && index > 0) { index--; } up
datevalue(select, index); }); }); }); result ...
How to structure a web form - Learn web development
the last one is an <input> element of type
date, for entering the expiration
date of the card; this one will come up with a
date picker widget in supporting browsers, and fall back to a normal text input in non-supporting browsers.
... <option value="visa">visa</option> <option value="mc">mastercard</option> <option value="amex">american express</option> </select> </p> <p> <label for="number"> <span>card number:</span> <strong><abbr title="required">*</abbr></strong> </label> <input type="tel" id="number" name="cardnumber"> </p> <p> <label for="
date"> <span>expiration
date:</span> <strong><abbr title="required">*</abbr></strong> <em>formatted as mm/dd/yyyy</em> </label> <input type="
date" id="
date" name="expiration"> </p> </section> the last section we'll add is a lot simpler, containing only a <button> of type submit, for submitting the form data.
... add this to the bottom of your form now: <p> <button type="submit">vali
date the payment</button> </p> you can see the finished form in action below (also find it on github — see our payment-form.html source and running live): test your skills!
Adding vector graphics to the Web - Learn web development
bel { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); let code = textarea.value; let userentry = textarea.value; function up
datecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; up
datecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution...
...'; } else { textarea.value = userentry; solution.value = 'show solution'; } up
datecode(); }); const htmlsolution = ''; let solutionentry = htmlsolution; textarea.addeventlistener('input', up
datecode); window.addeventlistener('load', up
datecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.va...
...lue = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // up
date the saved usercode every time the user up
dates the text area code textarea.onkeyup = function(){ // we only want to save the state when the user code is being shown, // not the solution, so that solution is not saved over the user code if(solution.value === 'show solution') { userentry = textarea.value; } else { solutionentry = textarea.value; } up
datecode(); }; summary this article has provided you with a quick tour of what vector graphics and svg are, why they are useful to know about, and how to include svg inside your webpages.
HTML table advanced features and accessibility - Learn web development
caption { padding: 10px; } tbody { font-size: 90%; font-style: italic; } tfoot { font-weight: bold; } </style> </head> <body> <table> <caption>how i chose to spend my money</caption> <thead> <tr> <th>purchase</th> <th>location</th> <th>
date</th> <th>evaluation</th> <th>cost (€)</th> </tr> </thead> <tfoot> <tr> <td colspan="4">sum</td> <td>118</td> </tr> </tfoot> <tbody> <tr> <td>haircut</td> <td>hairdresser</td> <td>12/09</td> <td>great idea</td> <td>30<...
...looking back to our spending record example from earlier on, you could unambiguously define the column headers as column headers like this: <thead> <tr> <th scope="col">purchase</th> <th scope="col">location</th> <th scope="col">
date</th> <th scope="col">evaluation</th> <th scope="col">cost (€)</th> </tr> </thead> and each row could have a header defined like this (if we added row headers as well as column headers): <tr> <th scope="row">haircut</th> <td>hairdresser</td> <td>12/09</td> <td>great idea</td> <td>30</td> </tr> screenreaders will recognize markup structured like this, and allow their users ...
... returning to our spending costs example, the previous two snippets could be rewritten like this: <thead> <tr> <th id="purchase">purchase</th> <th id="location">location</th> <th id="
date">
date</th> <th id="evaluation">evaluation</th> <th id="cost">cost (€)</th> </tr> </thead> <tbody> <tr> <th id="haircut">haircut</th> <td headers="location haircut">hairdresser</td> <td headers="
date haircut">12/09</td> <td headers="evaluation haircut">great idea</td> <td headers="cost haircut">30</td> </tr> ...
Choosing the right approach - Learn web development
single delayed operation repeating operation multiple sequential operations multiple simultaneous operations no yes no (unless it is the same one) no code example the following function creates a new
date() object, extracts a time string out of it using tolocaletimestring(), and then displays it in the ui.
... we then run it once per second using setinterval(), creating the effect of a digital clock that up
dates once per second (see this live, and also see the source): function displaytime() { let
date = new
date(); let time =
date.tolocaletimestring(); document.getelementbyid('demo').textcontent = time; } const createclock = setinterval(displaytime, 1000); pitfalls the frame rate isn't optimized for the system the animation is running on, and can be somewhat inefficient.
...this means millisecond precision and zero time as
date.now().
Graceful asynchronous programming with Promises - Learn web development
adevices.getusermedia({video: true, audio: true}) .then(chatstream => { selfviewelem.srcobject = chatstream; chatstream.gettracks().foreach(track => mypeerconnection.addtrack(track, chatstream)); setstatusmessage("connected"); }).catch(err => { setstatusmessage("failed to connect"); }); } this function starts by using a function called setstatusmessage() to up
date a status display with the message "calling...", indicating that a call is being attempted.
...after that, the status display is up
dated to say "connected".
...this uses setstatusmessage() to up
date the status box to indicate that an error occurred.
Working with JSON - Learn web development
you should be careful to vali
date any data you are attempting to use (although computer-generated json is less likely to include errors, as long as the generator program is working correctly).
... you can vali
date json using an application like jsonlint.
...images, text, json, even html snippets), meaning that we can up
date small sections of content without having to reload the entire page.
Object prototypes - Learn web development
you'll see other examples of prototype chain inheritance all over javascript — try looking for the methods and properties defined on the prototype of the string,
date, number, and array global objects, for example.
...this is really useful, but what is even more useful is that the whole inheritance chain has up
dated dynamically, automatically making this new method available on all object instances derived from the constructor.
...bye for now!'); }; but the farewell() method is still available on the person1 object instance — its members have been automatically up
dated to include the newly defined farewell() method.
Introduction to client-side frameworks - Learn web development
the real problem is this: every time we change our application’s state, we need to up
date the ui to match.
...if we add those features, we have to remember to up
date our ui in the right time and in the right way.
... modern web applications typically do not fetch and render new html files — they load a single html shell, and continually up
date the dom inside it (referred to as single page apps, or spas) without navigating users to new addresses on the web.
Componentizing our React app - Learn web development
once you’re done, the todo component's <input /> element will read like this: <input id="todo-0" type="checkbox" defaultchecked={props.completed} /> and your browser should up
date to show only eat being checked: if you change each <todo /> component’s completed prop, your browser will check or uncheck the equivalent rendered checkboxes accordingly.
...up
date your tasklist constant like so: const tasklist = props.tasks.map(task => ( <todo id={task.id} name={task.name} completed={task.completed} key={task.id} /> ) ); you should always pass a unique key to anything you render with iteration.
... then, up
date the return statement of app() so that it renders our components.
Creating our first Vue component - Learn web development
vue's data object if you change the value of the label prop passed into the <to-do-item></to-do-item> call in your app component, you should see it up
date.
... up
date the component object like so: export default { props: { label: { required: true, type: string }, done: { default: false, type: boolean } }, data() { return { isdone: this.done }; } }; vue does a little magic here — it binds all of your props directly to the component instance, so we don’t have to call this.props.done.
...up
date your <input> element now to replace checked="false" with :checked="isdone".
Implementing feature detection - Learn web development
up
date your <link> element in your html so it points to the correct css file (you should also up
date your <title> element to something more suitable!): <link href="modernizr-css.css" rel="stylesheet"> above this <link> element, add a <script> element to apply the modernizr library to the page, as shown below.
...if you look at the dom inspector of your browser's developer tools, you'll see that modernizr has up
dated your <html> class value like so: <html class="js no-htmlimports sizes flash transferables applicationcache blobconstructor blob-constructor cookies cors ...and loads more values!> it now contains a large number of classes that indicate the support status of different technology features.
... moving on, let's up
date our css to use modernizr rather than @supports.
Learn web development
if you prefer to copy the repo in a more flexible way that allows for automatic up
dates, you can follow the more complex instructions: install git on your machine.
... you can up
date the learning-area repository with any changes made to the master version on github with the following steps: in your command prompt/terminal, go inside the learning-area directory using cd.
... for example, if you were in the parent directory: cd learning-area up
date the repository using the following command: git pull contact us if you want to get in touch with us about anything, the best way is to drop us a message on our discourse forum.
Accessibility API cross-reference
all accessibility apis to
date define a list of possible object roles, or general types, such as button, menu item, text, etc.
...all accessibility apis to
date define a list of possible object roles, or general types, such as button, menu item, text, etc.
...ation) add missing aria properties fill out events cross reference table use this info to expand mozilla's accessibility api coverage to include mac, so that we can start to freeze them talk about the fact that msaa uses one interface (iaccessible), wherease gnome accessibility uses a lot of different interfaces depending on the type of object go through the atk info and make sure it's up-to-
date accessible roles description & notes msaa role (role_system_*) java accessibility role gnome accessibility role (atk_role_*) mac os x accessibility role aria (role=*) html tagged pdf relevant xul for alerts, in java/gnome for any alert, in msaa if no other role applies.
What to do and what not to do in Bugzilla
bugs covered by this exception should not be invali
dated by anyone other than the module owner or module peer; for bugs involving modules like layout or content, attach a test case to the bug and then cc one of the owners or peers.
... verifying wontfix or invalid bugs is relatively easy if a developer or a trusted qa person has wontfixed or invali
dated them.
... bugs that were invali
dated or wontfixed by someone else must be verified by a module owner or module peer or someone who has been explicitly told by a module owner or module peer that they are able to do so for that module.
Creating a Language Pack
this page is out of
date.
... $ cd ../../../mozilla-aurora and up
date the source code to this revision.
... $ hg up
date -r 237dccbcb967 3 files up
dated, 0 files merged, 0 files removed, 0 files unresolved the source code has been up
dated to the revision the binary was built from.
How Mozilla's build system works
the primary job of configure is to determine characteristics of the system and compiler, apply options passed into it, and vali
date everything looks ok to build.
...0 created; 1 up
dated; 2187 unchanged total wall time: 5.03s; cpu time: 3.79s; efficiency: 75% what this is saying is that a total of 1,096 moz.build files were read.
...however, one was up
dated as a result of the new configuration.
Eclipse CDT Manual Setup
whenever you create a new workspace for a mozilla source tree, you should be sure to turn off the following two settings in the workspace preferences (window > preferences, or eclipse > preferences) before creating a project in that workspace: in "general > workspace", disable "build automatically" in "c/c++ > indexer", disable "automatically up
date the index" turning off automatic indexing prevents the cpu intensive indexer from running at various stages during the steps below before we're ready.
...:-) build option discovery this section requires that you have already built your mozilla source tree (so that you have an object directory for it), and it is strongly recommended that the object directory is up to
date so that the just-print-mozilla-build.py script runs quickly.
...this script will complete in about 30 seconds on a warm tree (files cached in ram) if your object directory is up to
date, although eclipse will take several minutes to process the "build output" that it produces.
Performance
store heavyweight state once per process bad: // addon.js var main = new myaddonservice(); main.onchange(statechange); function statechange() { services.mm.broadcastasyncmessage("my-addon:up
date-configuration", {newconfig: main.serialize()}) } // framescript.js var maincopy; function onup
date(message) { maincopy = myaddonservice.deserialize(message.data.newconfig); } addmessagelistener("my-addon:up
date-configuration", onup
date) // maincopy used by other functions the main issue here is that a separate object is kept for each tab.
... better: // addon.js var main = new myaddonservice(); main.onchange(statechange); function statechange() { services.ppmm.broadcastasyncmessage("my-addon:up
date-configuration", {newconfig: main.serialize()}) } // processmodule.jsm const exported_symbols = ['getmaincopy']; var maincopy; services.cpmm.addmessagelistener("my-addon:up
date-configuration", function(message) { maincopy = message.data.newconfig; }) funtion getmaincopy() { return maincopy; } // framescript.js components.utils.import("resource://my-addon/processmodule.jsm") // getmaincopy() used by other functions don't register observers (and other callbacks to global s...
... clean up on addon unload bad: all the previous examples, *even the "better" ones* if your addon is restartless or uses the sdk then up
dates or the user turning it off and on will load to unload/reload events.
Mozilla Content Localized in Your Language
formal and informal forms, and separators (, or .)
date format what are the
date formats for weeks and months are expressed in the following forms: 1)fully spelled out, 2).
... reference material can be find here calendar calendar view: which
date is considered the first day of the week, sunday or monday?
...avoiding articles will help ensure that your translations will be accommo
dated within the user interface.
QA phase
to create and configure this file, follow these instructions: until the fix for bug 1063880 lands on mozilla-aurora and mozilla-beta when building language packs against those two trees you should: remove ac_add_options --disable-compile-environment from .mozconfig in step 3 use ./mach build config after step 4 up
date the mozilla source code: $ cd mozilla-aurora $ hg pull -u enter the following command to create the .mozconfig file: $ nano -w .mozconfig enter the following lines in your .mozconfig file: mk_add_options moz_objdir=@topsrcdir@/../firefox-build ac_add_options --disable-compile-environment ac_add_options --with-l10n-base=../l10n-central # path relative to moz_objdir ac_add_options --enable...
... enter the following command: $ hg log -l 1 you should see an output similar to the one below: changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com>
date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings now compare the local repository on your machine with the remote hg repository by entering this command: $ hg outgoing http://hg.mozilla.org/l10n-central/x-testing the hg outgoing command compares the two repositories and lists all changesets that are present locally, but not in the remote repository.
...you can expect to see output like this: comparing with http://hg.mozilla.org/l10n-central/x-testing searching for changes changeset: 0:7c543e8f3a6a tag: tip user: your name <email@example.com>
date: mon nov 23 18:08:25 2009 +0100 summary: added search bar strings let's now push this changeset.
Uplifting a localization from Central to Aurora
the releases page on wikimo has the upcoming
dates.
...you can safely push this to l10n-central already, in particular if you don't plan to do further up
dates on aurora.
...you can just throw your merge candi
date away as long as you find fixes that you've forgotten on either aurora or beta, and address those in their own repos first.
Mozilla Port Blocking
warning: the content of this article may be out of
date.
...ports enabled by protocol handlers in mozilla: protocol handler allowed ports ftp 21, 22 ldap 389, 636 nntp any port pop3 any port imap any port smtp any port finger 79
datetime 13 how to change mozilla port blocking permanently since each protocol can determine which ports are blocked, you should contact the protocol handler owner to request that a specific port be blocked or unblocked.
... more information nsioservice.cpp gbadportlist bug 83401 vulnerability note vu#476267 dougt@netscape.com original document information author(s): doug turner last up
dated
date: august 15, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla Web Developer FAQ
here’s the check list: does the html document vali
date?
...on the other hand, mozilla’s quirks mode already accommo
dates common non-standardisms that are due to the behaviors of common legacy browsers.
... comp.infosystems.www.authoring.html web authoring faq comp.infosystems.www.authoring.stylesheets faq ciwas stylesheet authoring faq comp.lang.javascript faq original document information author(s): henri sivonen (please, no authoring questions to this address.) last up
dated
date: may 12, 2007 copyright information: henri sivonen ...
A guide to searching crash reports
specifically, crash-stats offers two basic functions: searching you can search the crash reports database by over 100 criteria: crash signature,
date, platform, product, version, etc.
...as the fine print says, the default
date range is the past week.
... when a search is performed, the page's url is up
dated to include the search parameters.
L20n Javascript API
alternatively, you can register callbacks to execute when the context is ready (or when globals change and translations need to be up
dated) with ctx.localize.
... ctx.up
datedata(ctxdata: object) up
date the context data which will be available to all entities in the context.
...in other words, the following two calls: ctx.up
datedata({ user: { name: "bob" } }); ctx.up
datedata({ user: { gender: "masculine" } }); will make the internally-stored context data look like this: { "user" : { "name": "bob", "gender": "masculine" } } ctx.getsync(id: string, ctxdata: object?) retrieve a string value of an entity called id.
Optimizing Applications For NSPR
these different declarations are to accommo
date restrictions in watcom's c/c++ version 11.0 and 11.0a compiler.
...this problem has been resolved and an up
date will be appearing shortly.
... original document information author: larryh@netscape.com last up
dated
date: december 1, 2004 ...
An overview of NSS Internals
there is a classic engine that is very stable and works fine in all simple scenarios, for example if all (b) candi
date issuer certificates have the same subject and issuer names and differ by validity period; however, it works only in a limited amount of more advanced scenarios.
...as a result, when searching for a trust path from (a) to a trusted anchor (root) certificate (z), the set of candi
date issuer certificates might have different issuer names (referring to the second or higher issuer level).
...create a context handle while providing all the parameters required for the operation, then call an “up
date” function multiple times to pass subsets of the input to nss.
Cryptography functions
up
dated 3.8 with new options.
... 3.9.3 and later pk11_pubencryptraw mxr 3.2 and later pk11_pubunwrapsymkey mxr 3.2 and later pk11_pubunwrapsymkeywithflags mxr 3.6 and later pk11_pubunwrapsymkeywithflagsperm mxr 3.9 and later pk11_pubwrapsymkey mxr 3.2 and later pk11_randomup
date mxr 3.2 and later pk11_readrawattribute mxr 3.9.2 and later pk11_referencesymkey mxr 3.2 and later pk11_resettoken mxr 3.4 and later pk11_restorecontext mxr 3.2 and later pk11_savecontext mxr 3.2 and later pk11_savecontextalloc ...
... 3.2 and later pk11_traverseslotcerts mxr 3.4 and later pk11_unlinkgenericobject mxr 3.9.2 and later pk11_unwrapsymkey mxr 3.2 and later pk11_unwrapsymkeywithflags mxr 3.2 and later pk11_unwrapsymkeywithflagsperm mxr 3.9 and later pk11_up
dateslotattribute mxr 3.8 and later pk11_userenableslot mxr 3.8 and later pk11_userdisableslot mxr 3.8 and later pk11_verify mxr 3.2 and later pk11_verifykeyok mxr 3.2 and later pk11_waitfortokenevent mxr 3.7 and later pk11_wrapsymkey ...
NSS 3.12.4 release notes
1434: avoid multiple encoding/decoding of pkix_pl_oid to and from ascii string bug 405297: problems building nss/lib/ckfw/capi/ with mingw gcc bug 420991: libpkix returns wrong nss error code bug 427135: add super-h (sh3,4) architecture support bug 431958: improve des and sha512 for x86_64 platform bug 433791: win16 support should be deleted from nss bug 449332: secu_parsecommandline does not vali
date its inputs bug 453735: when using cert9 (sqlite3) db, set or change master password fails bug 463544: warning: passing enum* for an int* argument in pkix_vali
date.c bug 469588: coverity errors reported for softoken bug 470055: pkix_httpcertstore_findsocketconnection reuses closed socket bug 470070: multiple object leaks reported by tinderbox bug 470479: io timeout during cert fetching makes libpk...
...om a p12 file leaves error code set to zero bug 492385: crash freeing named crl entry on shutdown bug 493135: bltest crashes if it can't open the input file bug 493364: can't build with --disable-dbm option when not cross-compiling bug 493693: sse2 instructions for bignum are not implemented on os/2 bug 493912: sqlite3_reset should be invoked in sdb_findobjectsinit when error occurs bug 494073: up
date rsa/dsa powerupself tests to be compliant for 2011 bug 494087: passing null as the value of cert_pi_trustanchors causes a crash in cert_pkixsetparam bug 494107: during nss_nodb_init(), softoken tries but fails to load libsqlite3.so crash [@ @0x0 ] bug 495097: sdb_mapsqlerror returns signed int bug 495103: nss_initreadwrite(sql:<dbdir>) causes nss to look for sql:<dbdir>/libnssckbi.so bug 495365: ...
...sshutdownlist.lock bug 507041: invalid build options for vc6 bug 507228: coreconf.dep doesn't need to contain the nss version number bug 507422: crash [[@ port_freearena - lg_mksecretkeyrep] when port_newarena fails bug 507482: nss 3.12.3 (and later) doesn't build on aix 5.1 bug 507937: pwdecrypt program problems bug 508259: pk11mode crashed on linux2.4 bug 508467: libpkix ocsp checker should use
date argument to obtain the time for cert validity verification bug 510367: fix the utf8 characters in the nickname string for ac raíz certicamara s.a.
NSS 3.14 release notes
they should not use multi-part apis (c_encryptup
date/c_decryptup
date).
...applications may use this callback to inform libpkix whether or not candi
date certificate chains meet application-specific security policies, allowing libpkix to continue discovering certificate paths until it can find a chain that satisfies the policies.
...ck (in certt.h) certchainverifycallbackfunc (in certt.h) cert_pi_chainverifycallback, a new option for certvalparamintype (in certt.h) a new error code: sec_error_application_callback_error (in secerr.h) new for pkcs #11 pkcs #11 mechanisms: ckm_aes_cts ckm_aes_ctr ckm_aes_gcm (see warnings against using c_encryptup
date/c_decryptup
date above) ckm_sha224_key_derivation ckm_sha256_key_derivation ckm_sha384_key_derivation ckm_sha512_key_derivation changes in nss 3.14 bug 333601 - performance enhancements for intel macs when building for intel macs, nss will now take advantage of optimized assembly code for common operations.
NSS 3.18.1 release notes
this is a patch release to up
date the list of root ca certificates.
...so, to give website administrators more time to up
date their web servers, we reverted the trust bits back to being enabled.
... cn=mcsholding test, o=mcsholding, c=eg sha1 fingerprint: e1:f3:59:1e:76:98:65:c4:e4:47:ac:c3:7e:af:c9:e2:bf:e4:c5:76 the version number of the up
dated root ca list has been set to 2.4 bugs fixed in nss 3.18.1 this bugzilla query returns all the bugs fixed in nss 3.18.1: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.18.1 compatibility nss 3.18.1 shared libraries are backward compatible with all older nss 3.18 shared libraries.
NSS 3.48 release notes
bugs fixed in nss 3.48 bug 1600775 - require nspr 4.24 for nss 3.48 bug 1593401 - fix race condition in self-encrypt functions bug 1599545 - fix assertion and add test for early key up
date bug 1597799 - fix a crash in nssckfwobject_getattributesize bug 1591178 - add entrust root certification authority - g4 certificate to nss bug 1590001 - prevent negotiation of versions lower than 1.3 after helloretryrequest bug 1596450 - added a simplified and unified mac implementation for hmac and cmac behind pkcs#11 bug 1522203 - remove an old pentium pro performance workaround bug 15925...
...57 - fix prng known-answer-test scripts bug 1586176 - encryptup
date should use maxout not block size (cve-2019-11745) bug 1593141 - add `notbefore` or similar "beginning-of-validity-period" parameter to mozilla::pkix::trustdomain::checkrevocation bug 1591363 - fix a pbkdf2 memory leak in nsc_generatekey if key length > max_key_len (256) bug 1592869 - use arm neon for ctr_xor bug 1566131 - ensure sha-1 fallback disabled in tls 1.2 bug 1577803 - mark pkcs#11 token as friendly if it implements ckp_public_certificates_token bug 1566126 - power ghash vector acceleration bug 1589073 - use of new pr_assert_arg in certdb.c bug 1590495 - fix a crash in pk11_makecertfromhandle bug 1591742 - ensure des iv length is valid before usage from pkcs#11 bug 1588567 - enable mozilla::pkix gtests in ns...
...s ci bug 1591315 - up
date nsc_decrypt length in constant time bug 1562671 - increase nss mp kdf default iteration count, by default for modern key4 storage, optionally for legacy key3.db storage bug 1590972 - use -std=c99 rather than -std=gnu99 bug 1590676 - fix build if arm doesn't support neon bug 1575411 - enable tls extended master secret by default bug 1590970 - ssl_settimefunc has incomplete coverage bug 1590678 - remove -wmaybe-uninitialized warning in tls13esni.c bug 1588244 - nss changes for delegated credential key strength checks bug 1459141 - add more cbc padding tests that missed nss 3.47 bug 1590339 - fix a memory leak in btoa.c bug 1589810 - fix uninitialized variable warnings from certdata.perl bug 1573118 - enable tls 1.3 by default in nss this bugzilla query ret...
NSS 3.51.1 release notes
notable changes in nss 3.51.1 bug 1617968 - up
date delegated credentials implementation to draft-07.
... bug 1619056 - up
date readme: tls 1.3 is not experimental anymore.
... bug 1617968 - up
date delegated credentials implementation to draft-07.
NSS 3.51 release notes
notable changes in nss 3.51 up
dated dtls 1.3 implementation to draft-34.
... bugs fixed in nss 3.51 bug 1608892 - up
date dtls 1.3 implementation to draft-34.
...uaranteed to be null-terminated bug 1561337 - correct a warning for comparison of integers of different signs: 'int' and 'unsigned long' in security/nss/lib/freebl/ecl/ecp_25519.c:88 bug 1609751 - add test for mp_int clamping bug 1582169 - don't attempt to read the fips_enabled flag on the machine unless nss was built with fips enabled bug 1431940 - fix a null pointer dereference in blake2b_up
date bug 1617387 - fix compiler warning in secsign.c bug 1618400 - fix a openbsd/arm64 compilation error: unused variable 'getauxval' bug 1610687 - fix a crash on unaligned cmaccontext.aes.keyschedule when using aes-ni intrinsics this bugzilla query returns all the bugs fixed in nss 3.51: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced...
Build instructions
these instructions are out
dated.
... hg clone https://hg.mozilla.org/projects/nspr hg clone https://hg.mozilla.org/projects/nss if you want to build a releases other than the tips of these repositories, then switch to the release tags: cd nspr hg up
date nspr_4_9_5_rtm cd ../nss hg up
date nss_3_14_2_rtm cd ..
... to build with gcc on platforms other than linux and windows, you need to set two more environment variables: ns_use_gcc=1 no_mdup
date=1 for hp-ux, you must set the environment variable use_pthreads to 1.
Necko Interfaces Overview
warning: the content of this article may be out of
date.
... it was last up
dated in 2001.
...epresents a physical connection, such as a file descriptor or a socket used directly by protocol handler implementations (as well as by mailnews and chatzilla) synchronous i/o methods: openinputstream, openoutputstream asynchronous i/o methods: asyncread, asyncwrite nsitransport::asyncread takes a nsistreamlistener parameter original document information author(s): darin fisher last up
dated
date: december 10, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Rhino Debugger
when you select a stack frame the variables and watch windows are up
dated to reflect the names and values of the variables visible at that scope.
...the this table is up
dated each time control returns to the debugger or when you change the stack location in the context: window.
...the locals table is up
dated each time control returns to the debugger or when you change the stack location in the context: window watch window you may enter arbitrary javascript expressions in the watch: table located in the lower-right (dockable) pane in the debugger main window.
SpiderMonkey 1.8.7
the so-called "slow natives" are no longer supported; as such jsfastnative has been renamed to jsnative and relevant interfaces have been up
dated accordingly.
..._getsecuritycallbacks js_getstringcharsandlength js_getstringcharsz js_getstringcharszandlength js_getstringencodinglength js_haspropertybyid js_initctypesclass js_internjsstring js_isconstructing_possiblywithgiventhisobject js_isextensible js_isinrequest js_leavecrosscompartmentcall js_lookuppropertybyid js_lookuppropertywithflagsbyid js_new js_newcompartmentandglobalobject js_new
dateobject js_new
dateobjectmsec js_newfunctionbyid body new c++ helpers while jsapi remains a c api, the engine is now implemented in c++.
...the jsval_to_double and double_to_jsval macros have been up
dated to work directly on jsdoubles rather than their pointers, and the js_newdoublevalue and js_newdouble interfaces have been removed.
SpiderMonkey 24
get it here mozilla-esr24 if the download url is out
date you will find it in "firefox extended support release 24" package on hg release platform support spidermonkey 24 is supported on all the platforms where firefox 24 runs.
... new javascript language features javascript 24 includes significant up
dates to language features, yo.
... typedef changes the fixed-size integer types introduced in spidermonkey 17 are defined in one of the following ways (xxx up
date for msvc<10 deprecation): if the environment variable moz_custom_stdint_h is set, that file will be included to provide definitions for these types.
SpiderMonkey 31
the download url is out
dated and spidermonkey not release alone!
... many jsclass and js::class instances are now explicitly const, and several apis have been up
dated to use const jsclass * and const js::class * pointers.
... new javascript language features javascript 31 includes significant up
dates to language features, yo.
SpiderMonkey 38
spidermonkey 38 is out
dated and contains known security vulnerabilities.
... — sep 17, 2015 the download url is out
dated and spidermonkey not release alone!
... new javascript language features javascript 38 includes significant up
dates to language features, yo.
SpiderMonkey 45
spidermonkey 45 is out
dated and contains known security vulnerabilities.
... new javascript language features javascript 45 includes significant up
dates to its language features, yo.
...tions js_isgcmarkingtracer js_ismarkinggray js_idarraylength js_idarrayget js_destroyidarray js_defaultvalue js_getparent js_setparent js::parsepropertydescriptorobject js_deleteproperty2 js_deletepropertybyid2 js_deleteucproperty2 js_deleteelement2 js_newfunctionbyid js_bindcallable js_decompilefunctionbody js_getlatin1internedstringchars js_gettwobyteinternedstringchars js_new
dateobjectmsec js_clear
datecaches changed apis js_init has moved from jsapi.h to js/initialization.h js_shutdown has moved from jsapi.h to js/initialization.h js_initreflect is now implicit js_addweakpointercallback is replaced with js_addweakpointerzonegroupcallback and js_addweakpointercompartmentcallback js_removeweakpointercallback is replaced with js_removeweakpointerzonegroupcallback a...
TPS Formdata Lists
date: the
date the form data was used, expressed in hours from the present, so 0 means now, and -24 means 24 hours ago.
... for example: var formdata1 = [ { fieldname: "testing", value: "success",
date: -1 }, { fieldname: "testing", value: "failure",
date: -2 }, { fieldname: "username", value: "joe" } ]; formdata lists and phase actions you can use the following functions in phase actions for formdata lists: formdata.add formdata.delete formdata.verify formdata.verifynot for an example, see the tps formdata unittest: http://hg.mozilla.org/services/tps/f...st_formdata.js notes note 1, tps supports the delete action for formdata, but sync currently does not correctly sync deleted form data, see bug 564296.
... note 2, sync currently does not sync formdata
dates, so the
date field is ignored when performing verify and verify-not actions.
TPS History Lists
date: required.
... for example: var history_initial = [ { uri: "http://www.google.com/", title: "google", visits: [ { type: 1,
date: 0 }, { type: 2,
date: -1 } ] }, { uri: "http://www.cnn.com/", title: "cnn", visits: [ { type: 1,
date: -1 }, { type: 2,
date: -36 } ] }, ]; the history list used for deletions looks different.
...there are three different types: to delete all references to a specific page from history, use an object with a uri property to delete all references to all pages from a specific host, use an object with a host property to delete all history in a certain time period, use an object with begin and end properties, which should have integer values that express time since the present in hours (see
date above) for example: var history_to_delete = [ { uri: "http://www.cnn.com/" }, { begin: -24, end: -1 }, { host: "www.google.com" } ]; history lists and phase actions history lists cannot be modified, they can only be added, deleted, and verified, using the following functions: history.add history.delete history.verify history.verifynot ...
Web Replay
replaying processes preserve all the same js behavior, dom structures, graphical up
dates, and most other behaviors that occurred while recording.
... messages describe actions the child process is able to do independently from the recording; currently this includes sending graphics up
dates, taking and restoring process snapshots, and responding to debugger requests.
... a child process can only pause at breakpoints and at snapshot points (currently these only happen when graphics up
dates are performed, at which point there is no js on the stack).
Signing Mozilla apps for Mac OS X
once the application has been signed, the signature of an application bundle can be vali
dated by calling: codesign -vvvv application.app where application.app is the application bundle you wish to vali
date.
... the folder will fail to vali
date if any of these cases occur (there may be other cases not listed here): if any files that were included in the signature have been removed or modified if any files have been added to a folder that should have all files signed the coderesources file this file is located in your application's bundle at contents/_codesignature/coderesources.
...if any file is subsequently changed, the folder will no longer vali
date.
Retrieving part of the bookmarks tree
etfolders in your query object: query.setfolders([toolbarfolder], 1); run the query the executequery and executequeries functions will return an nsinavhistoryresult object containing the results of your query: var result = historyservice.executequery(query, options); get the results when you are querying for exactly one folder grouped by folder with no fancy query parameters such as keywords or
date ranges (as in this example), the root of the result will be an nsinavhistorycontainerresultnode corresponding to your folder.
...as long as the container is open, it will listen for notifications from the bookmarks system to keep itself up-to-
date.
...otherwise, it will continue to get observer notifications and up
date itself, slowing down the whole browser.
Using the Places livemark service
up
date behavior five seconds after the browser starts up, the livemark service's up
date timer is started.
... the up
date timer fires immediately, and then every 15 minutes thereafter.
... when the up
date timer fires, it iterates over the list of livemarks, and will refresh a livemark *only* if it's expired.
Observer Notifications
this is sent before browsingcontext::closed() is up
dated.
... topic data description places-autocomplete-feedback-up
dated sent when places up
dates the location bar's autocompletion display.
... lightweight-theme-styling-up
date json sent when the current theme being used is changed; this is sent even when the user is previewing a theme, not just when the theme is actually selected.
mozIRegistry
warning: the content of this article may be out of
date.
...a corollary is that the build/install process will require up
dates to user "registry" to enable new class implementations to be accessible.
... original document information author: bill law last up
dated
date: january 21, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
mozIVisitInfoCallback
toolkit/components/places/public/moziasynchistory.idlscriptable this interface provides callback handling functionality for moziasynchistory.up
dateplaces() 1.0 66 introduced gecko 2.0 inherits from: nsisupports last changed in gecko 9.0 (firefox 9.0 / thunderbird 9.0 / seamonkey 2.6) method overview void handleerror(in nsresult aresultcode, in moziplaceinfo aplaceinfo); void handleresult(in moziplaceinfo aplaceinfo); void oncomplete(in nsresult aresultcode, in moziplaceinfo aplaceinfo);obsolete since gecko 8.0 methods handleerror() called when a moziplaceinfo couldn't be processed.
... handleresult() called for each visit added, title change, or guid change when passed to moziasynchistory.up
dateplaces().
... oncomplete() obsolete since gecko 8.0 (firefox 8.0 / thunderbird 8.0 / seamonkey 2.5) called for each visit added, title change, or guid change when passed to moziasynchistory.up
dateplaces().
nsIAccessibleRole
it is used for
date xforms:input.
... role_
date_editor 69 represents control whose purpose is to allow a user to edit a
date.
... role_calendar 113 a calendar that allows the user to select a
date.
nsIAutoCompleteObserver
inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void onsearchresult(in nsiautocompletesearch search, in nsiautocompleteresult result); void onup
datesearchresult(in nsiautocompletesearch search, in nsiautocompleteresult result); methods onsearchresult() called when a search is complete and the results are ready.
... onup
datesearchresult() called to up
date with new results.
... void onup
datesearchresult( in nsiautocompletesearch search, in nsiautocompleteresult result ); parameters search the search object that processed this search.
nsIFeedEntry
published astring a string indicating the
date on which the entry was published, in rfc822 format.
... this
date is parsable by both javascript (via
date.parse()) and mail code.
... note, that the related up
dated attribute is available from the nsifeedcontainer interface.
nsIFileView
if the treecol id is "filenamecolumn" fileview will return the file name, if the id is "lastmodifiedcolumn" it will return the
date of last modification.
... sort
date 2 sort by the
date of the last modification.
...mlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <tree flex="1" id="ftree"> <treecols> <-- the default column type is size unless an appropriate id is passed, nsifileview relies on the treecols section --> <treecol id="filenamecolumn" label="name" flex="1" primary="true"/> <treecol id="lastmodifiedcolumn" label="
date" flex="1"/> <treecol id="size" label="size" flex="1"/> </treecols> <treechildren/> </tree> <script> var dir="/home/"; //the directory to be opened var ftree = document.getelementbyid("ftree"); //the xul tree element var lfile = components.classes["@mozilla.org/file/local;1"] .createinstance(components.interfaces.nsilocalfile); lfile.initwithpath(dir); // open the ...
nsIFrameLoader
void loaduri(in nsiuri auri); void sendcrossprocesskeyevent(in astring atype, in long akeycode, in long acharcode, in long amodifiers, [optional] in boolean apreventdefault); void sendcrossprocessmouseevent(in astring atype, in float ax, in float ay, in long abutton, in long aclickcount, in long amodifiers, [optional] in boolean aignorerootscrollframe); void up
datepositionandsize(in nsiframe aiframe); native code only!
... native code only!up
datepositionandsize up
dates the position and size of the subdocument loaded by this frameloader.
... void up
datepositionandsize( in nsiframe aiframe ); parameters aiframe the nsiframe for the content node that owns this frameloader.
nsIHTMLEditor
avalue); void setcaretafterelement(in nsidomelement aelement); void setcssinlineproperty(in nsiatom aproperty, in astring aattribute, in astring avalue); void setdocumenttitle(in astring atitle); void setinlineproperty(in nsiatom aproperty, in astring aattribute, in astring avalue); void setparagraphformat(in astring aparagraphformat); void up
datebaseurl(); attributes attribute type description iscssenabled boolean a boolean which is true is the htmleditor has been instantiated with css knowledge and if the css pref is currently checked.
... void setparagraphformat( in astring aparagraphformat ); parameters aparagraphformat "p", "h1" to "h6", "address", "pre", or "blockquote" up
datebaseurl() set the baseurl for the document to the current url but only if the page doesn't have a <base> tag this should be done after the document url has changed, such as after saving a file this is used as base for relativizing link and image urls.
... void up
datebaseurl(); parameters none.
nsILivemarkService
n nsiuri afeeduri); nsiuri getsiteuri(in long long container); boolean islivemark(in long long folder); void reloadalllivemarks(); void reloadlivemarkfolder(in long long folderid); void setfeeduri(in long long container, in nsiuri feeduri); void setsiteuri(in long long container, in nsiuri siteuri); void start(); void stopup
datelivemarks(); methods createlivemark() creates a new livemark.
... stopup
datelivemarks() stop the livemark refresh timer.
... void stopup
datelivemarks(); parameters none.
nsINavHistoryResultNode
dateadded prtime if the node is an item (bookmark, folder, or separator), this value is the time at which the item was created.
...note: when an item is added lastmodified is set to the same value as
dateadded.
...even if you ask for all uris for a given
date range long ago, this might contain today's
date if the uri was visited today.
nsISupports proxies
the api has changed in mozilla 1.9, but the prose below hasn't been up
dated yet.
... see xpcom/proxy/public/nsiproxyobjectmanager.idl for the up
dated interface and its documentation.
...ns_release(ptestobj); pproxy->bar(); ns_release(pproxy); original document information author: doug turner last up
dated
date: january 27, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
nsITaskbarPreview
method overview void invali
date(); attributes attribute type description active boolean indicates whether or not the preview is marked as active (currently selected) in the taskbar.
... methods invali
date() invali
dates the taskbar's cached image of the preview, forcing a redraw if necessary.
... void invali
date(); parameters none.
nsITreeColumns
in gecko 1.9 (firefox 3) inherits from: nsisupports method overview nsitreecolumn getcolumnat(in long index); nsitreecolumn getcolumnfor(in nsidomelement element); nsitreecolumn getfirstcolumn(); nsitreecolumn getkeycolumn(); nsitreecolumn getlastcolumn(); nsitreecolumn getnamedcolumn(in astring id); nsitreecolumn getprimarycolumn(); nsitreecolumn getsortedcolumn(); void invali
datecolumns(); void restorenaturalorder(); attributes attribute type description count long the number of columns.
...invali
datecolumns() this method is called whenever a treecol is added or removed and the column cache needs to be rebuilt.
... void invali
datecolumns(); parameters none.
nsITreeSelection
inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview void adjustselection(in long index, in long count); void clearrange(in long startindex, in long endindex); void clearselection(); void getrangeat(in long i, out long min, out long max); long getrangecount(); void invali
dateselection(); void invertselection(); boolean isselected(in long index); void rangedselect(in long startindex, in long endindex, in boolean augment); void select(in long index); void selectall(); void timedselect(in long index, in long delay); void toggleselect(in long index); attributes attribute type description ...
...return value long - number of selection ranges invali
dateselection() can be used to invali
date the selection.
... void invali
dateselection(); parameters none.
nsIXFormsModelElement
1.0 66 introduced gecko 1.8 obsolete gecko 1.9.1 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) method overview nsidomdocument getinstancedocument(in domstring instanceid); void rebuild(); void recalculate(); void refresh(); void revali
date(); methods getinstancedocument() nsidomdocument getinstancedocument( in domstring instanceid ); parameters instanceid the id of the instance element to be returned.
...revali
date() signals the xforms processor to perform a full revalidation of the given xforms model.
... void revali
date(); parameters none.
nsIXULRuntime
to get an instance, use: var xulruntime = components.classes["@mozilla.org/xre/app-info;1"] .getservice(components.interfaces.nsixulruntime); method overview void invali
datecachesonrestart(); attributes attribute type description accessibilityenabled boolean if true, the accessibility service is running.
... methods invali
datecachesonrestart() signal the apprunner to invali
date caches on the next restart.
... void invali
datecachesonrestart(); parameters none.
nsIXmlRpcClient
constants constant type description int unsigned long nsisupportsprint32 boolean unsigned long nsisupportsprbool string unsigned long nsisupportscstring double unsigned long nsisupportsdouble
datetime unsigned long nsisupportsprtime array readonly unsigned long nsisupportsarray struct readonly unsigned long nsisupportsdictionary methods init() set server url.
...supported arguments are: nsisupportspruint8, nsisupportspruint16, nsisupportsprint16, nsisupportsprint32: i4, nsisupportsprbool: boolean, nsisupportschar, nsisupportscstring: string, nsisupportsfloat, nsisupportsdouble: double, nsisupportsprtime:
datetime.iso8601, nsiinputstream: base64, nsisupportsarray: array, nsidictionary: struct note that both nsisupportsarray and nsidictionary can only hold any of the supported input types.
... return value will be converted as follows: i4 or int: nsisupportsprint32 boolean: nsisupportsprbool string: nsisupportscstring double: nsisupportsdouble
datetime.iso8601: nsisupportsprtime base64: nsisupportscstring array: nsisupportsarray struct: nsidictionary faults (server side errors) are indicated by returning ns_error_failure.
nsIAbCard/Thunderbird3
same as home, but with `work' instead of `home' other contact: faxnumber, faxnumbertype pagernumber, pagernumbertype cellularnumber, cellularnumbertype jobtitle, department, company _aimscreenname
dates: anniversaryyear, anniversarymonth, anniversaryday birthyear, birthmonth, birthday webpage1 (work), webpage2 (home) custom1, custom2, custom3, custom4 notes integral properties: lastmodified
date popularityindex prefermailformat (see nsiabprefermailformat) boolean properties: allowremotecontent inherits from: nsiabitem method overview ...
... this will be removed from the interface at a later
date.
... this will be removed from the interface at a later
date.
XPCOM tasks
warning: the content of this article may be out of
date.
... things we need to evangelize we need to keep up-to-
date documentation, samples, and have brown-bags to keep people informed.
... original document information author(s): unknown last up
dated
date: may 8, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
XPIDL
xpidl:syntax (now up to
date again) xpidl syntax (out of
date) xpidl author's guide (not as out of
date) explanation of idl semantics a full guide to the syntax can be found at xpidl:syntax, which is written in an abnf form.
... in addition to this list, nearly every idl file includes nsrootidl.idl in some fashion, which also defines the following types: table 2: types provided by nsrootidl.idl idl typedef c++ in parameter c++ out parameter js type notes prtime (xpidl unsigned long long typedef, 64 bits) number prtime is in microseconds, while js
date assumes time in milliseconds nsresult (xpidl unsigned long typedef, 32 bits) number nsrefcnt (xpidl unsigned long typedef, 32 bits) number size_t (xpidl unsigned long typedef, 32 bits) number voidptr void* void* not allowed charptr char* char** not allowed unicharptr char16_t* char1...
... resources (mostly out
dated) some unsorted notes including a keyword list xpidl is a tool for generating c++ headers, java interfaces, xpconnect typelibs, and html documentation from xpidl files generating xpt files on windows a google groups post with instructions on how to use variable-length argument lists using xpidl.
Address book sync client design
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2000.
... // // step 1: // when the user begins a sync, run through the local database and up
date the // sync mapping table.
Building a Thunderbird extension 5: XUL
lloworld.xul within the content folder you created earlier with the following content: <?xml version="1.0"?> <overlay id="sample" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <script type="application/javascript" src="chrome://myfirstext/content/overlay.js"/><!-- a reference to your javascript file --> <statusbar id="status-bar"> <statusbarpanel id="my-panel" label="
date"/> </statusbar> </overlay> the <statusbar> widget named status-bar specifies the merge point within the application window that we want to attach to.
...in thunderbird it will appear as a label at the right side of thunderbird's statusbar and display "
date".
...in the next section you will learn how to use javascript to modify your label so that it shows the current
date.
Plugin Roadmap for Firefox - Plugins
adobe will stop shipping security up
dates for flash at the end of 2020.
... see also mozilla firefox october 2015 - npapi plugins in firefox july 2016 - reducing adobe flash usage in firefox july 2017 - firefox roadmap for flash end-of-life adobe flash november 2015 - flash, html5 and open web standards july 2017 - flash & the future of interactive content google chrome flash roadmap sep 2013 - saying goodbye to our old friend npapi may 2014 - up
date on npapi deprecation november 2014 - the final countdown for npapi august 2016 - flash and chrome december 2016 - roll-out plan for html5 by default july 2017 - saying goodbye to flash in chrome microsoft edge and internet explorer april 2016 - putting users in control of flash december 2016 - extending user control of flash with click-to-run july 2017 - flash on windows timeline august 2...
...019 - up
date on removing flash from microsoft edge and internet explorer apple safari june 2016 - next steps for legacy plug-ins july 2017 - adobe announces flash distribution and up
dates to end ...
Debugging service workers - Firefox Developer Tools
that last time the service worker was up
dated (if the service has not been up
dated, this is when it was first installed).
...this is very useful because, once registered, the service worker will not necessarily up
date to the new version immediately, which can make debugging a pain.
... these options make it much easier to remove a cache if it is required for testing a code up
date.
Migrating from Firebug - Firefox Developer Tools
try out css selectors firebug's selectors side panel provides a way to vali
date a css selector.
...the name, value, domain, path, expiration
date and whether the cookie is http-only.
...additionally, the devtools allow to display the creation
date of a cookie as well as when it was last accessed and whether it is host-only.
Animating CSS properties - Firefox Developer Tools
the css rendering waterfall the process the browser uses to up
date the page when a css property has changed can be described as a waterfall consisting of the following steps: recalculate style: every time a css property for an element changes, the browser must recalculate computed styles.
... this sequence needs to fit into a single frame, since the screen isn't up
dated until it is complete.
... color properties that are rendered in their own layer don't even trigger a repaint, because the up
date is handled in composition.
AddressErrors.city - Web APIs
syntax var cityerror = addresserrors.city; value if the value specified in the paymentaddress object's city property could not be vali
dated, this property contains a domstring offering a human-readable explanation of the validation error and offers suggestions for correcting it.
... if the city value was vali
dated successfully, this property is not included in the addresserrors object.
... candi
date recommendation initial definition.
AudioParam.value - Web APIs
this is reflected by the value getter, which returns the value of the parameter as of the audio rendering engine's most recent render quantum, or moment at which audio buffers are processed and up
dated.
... in addition to processing audio buffers, each render quantum up
dates the value of each audioparam as needed given the current time and any established time-based parameter value changes.
... if any gradiated or ramped value changing methods have been called and the current time is within the time range over which the graduated change should occur, the value is up
dated based on the appropriate algorithm.
Battery Status API - Web APIs
navigator.getbattery().then(function(battery) { function up
dateallbatteryinfo(){ up
datechargeinfo(); up
datelevelinfo(); up
datecharginginfo(); up
datedischarginginfo(); } up
dateallbatteryinfo(); battery.addeventlistener('chargingchange', function(){ up
datechargeinfo(); }); function up
datechargeinfo(){ console.log("battery charging?
..."yes" : "no")); } battery.addeventlistener('levelchange', function(){ up
datelevelinfo(); }); function up
datelevelinfo(){ console.log("battery level: " + battery.level * 100 + "%"); } battery.addeventlistener('chargingtimechange', function(){ up
datecharginginfo(); }); function up
datecharginginfo(){ console.log("battery charging time: " + battery.chargingtime + " seconds"); } battery.addeventlistener('dischargingtimechange', function(){ up
datedischarginginfo(); }); function up
datedischarginginfo(){ console.log("battery discharging time: " + battery.dischargingtime + " seconds"); } }); see also the example in the specification.
... specifications specification status comment battery status api candi
date recommendation initial definition.
CSSRule - Web APIs
13 cssdocumentrule cssrule.font_feature_values_rule 14 cssfontfeaturevaluesrule cssrule.viewport_rule 15 cssviewportrule cssrule.region_style_rule 16 cssregionstylerule cssrule.unknown_rule 0 cssunknownrule cssrule.charset_rule 2 csscharsetrule (removed in most browsers.) an up-to-
date informal list of constants can be found on the csswg wiki.
... candi
date recommendation added value counter_style_rule.
... candi
date recommendation added value supports_rule.
Using the CSS properties and values API - Web APIs
the first is that, once a property is registered, there's no way to up
date it, and trying to re-register it with javascript will throw an error indicating it's already been defined.
... second, unlike standard properties, registered properties aren't vali
dated when they're parsed.
... rather, they're vali
dated when they're computed.
Cache - Web APIs
in a serviceworker) handles cache up
dates.
... items in a cache do not get up
dated unless explicitly requested; they don’t expire unless deleted.
... console.log('deleting out of
date cache:', cachename); return caches.delete(cachename); } }) ); }) ); }); self.addeventlistener('fetch', function(event) { console.log('handling fetch event for', event.request.url); event.respondwith( caches.open(current_caches.font).then(function(cache) { return cache.match(event.request).then(function(response) { if (response) { ...
A basic ray-caster - Web APIs
after every interval an up
date function will repaint the canvas showing the current view.
... so every up
date, the raycaster looks to see if you've pressed any keys lately, to conserve calculations by not casting if you're idle.
... if you have, then the canvas is cleared, the ground and sky are drawn, the camera position and/or orientation are up
dated, and the rays are cast out.
Document - Web APIs
document.lastmodifiedread only returns the
date on which the document was last modified.
... globaleventhandlers.ontimeup
date is an eventhandler representing the code to be called when the timeup
date event is raised.
... candi
date recommendation extend the document interface page visibility (second edition)the definition of 'document' in that specification.
Element.shadowRoot - Web APIs
inside the <custom-square> element's class definition we include some life cycle callbacks that make a call to an external function, up
datestyle(), which actually applies the size and color to the element.
... connectedcallback() { console.log('custom square element added to page.'); up
datestyle(this); } attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); up
datestyle(this); } in the up
datestyle() function itself, we get a reference to the shadow dom using element.shadowroot.
... from here we use standard dom traversal techniques to find the <style> element inside the shadow dom and then up
date the css found inside it: function up
datestyle(elem) { const shadow = elem.shadowroot; const childnodes = array.from(shadow.childnodes); childnodes.foreach(childnode => { if (childnode.nodename === 'style') { childnode.textcontent = ` div { width: ${elem.getattribute('l')}px; height: ${elem.getattribute('l')}px; background-color: ${elem.getattribute('c')}; } `; } }); } specifications specification status comment domthe definition of 'shadowroot' in that specification.
Gamepad.timestamp - Web APIs
the gamepad.timestamp property of the gamepad interface returns a domhighrestimestamp representing the last time the data for this gamepad was up
dated.
... the idea behind this is to allow developers to determine if the axes and button data have been up
dated from the hardware.
...values are monotonically increasing, meaning that they can be compared to determine the ordering of up
dates, as newer values will always be greater than or equal to older values.
Using the Geolocation API - Web APIs
this initiates an asynchronous request to detect the user's position, and queries the positioning hardware to get up-to-
date information.
... watching the current position if the position data changes (either by device movement or if more accurate geo information arrives), you can set up a callback function that is called with that up
dated position information.
...the callback function is called multiple times, allowing the browser to either up
date your location as you move, or provide a more accurate location as different techniques are used to geolocate you.
HTMLDialogElement.close() - Web APIs
syntax dialoginstance.close(returnvalue); parameters returnvalue optional a domstring representing an up
dated value for the htmldialogelement.returnvalue of the dialog.
...d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // up
date button opens a modal dialog up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLInputElement.stepDown() - Web APIs
valid on all numeric,
date, and time input types that support the step attribute, including
date, month, week, time,
datetime-local, number, and range.
... <!-- decrements by intervals of 900 seconds (15 minute) --> <input type="time" max="17:00" step="900"> <!-- decrements by intervals of 7 days (one week) --> <input type="
date" max="2019-12-25" step="7"> <!-- decrements by intervals of 12 months (one year) --> <input type="month" max="2019-12" step="12"> the method, when invoked, changes the form control's value by the value given in the step attribute, multiplied by the parameter, within the constraints set within the form control.
... if the form control is non time,
date, or numeric in nature, and therefore does not support the step attribute (see the list of supported input types in the the table above), or if the step value is set to any, an invalidstateerror exception is thrown.
HTMLInputElement.stepUp() - Web APIs
input type default step value example step declaration
date 1 (day) 7 day (one week) increments: <input type="
date" min="2019-12-25" step="7"> month 1 (month) 12 month (one year) increments: <input type="month" min="2019-12" step="12"> week 1 (week) two week increments: <input type="week" min="2019-w23" step="2"> time 60 (seconds) 900 second (15 minute) increments: <input type="time" min="...
...09:00" step="900">
datetime-local 1 (day) same day of the week: <input type="
datetime-local" min="019-12-25t19:30" step="7"> number 1 0.1 increments <input type="number" min="0" step="0.1" max="10"> range 1 increments by 2: <input type="range" min="0" step="2" max="10"> the method, when invoked, changes the form control's value by the value given in the step attribute, multiplied by the parameter, within the constraints set on the form control.
... if the form control is non time,
date, or numeric in nature, and therefore does not support the step attribute (see the list of supported input types in the the table above), or if the step value is set to any, an invalidstateerror exception is thrown.
HTMLOutputElement - Web APIs
this is the empty string if the control is not a candi
date for constraint validation (willvali
date is false), or it satisfies its constraints.
... htmloutputelement.willvali
dateread only a boolean indicating whether the element is a candi
date for constraint validation.
...if this message is not the empty string, then the element is suffering from a custom validity error, and does not vali
date.
HTMLSourceElement - Web APIs
note: if the src property is up
dated (along with any siblings), the parent htmlmediaelement's load method should be called when done, since <source> elements are not re-scanned automatically.
... htmlsourceelement.srcset is a domstring reflecting the srcset html attribute, containing a list of candi
date images, separated by a comma (',', u+002c comma).
... a candi
date image is a url followed by a 'w' with the width of the images, or an 'x' followed by the pixel density.
IDBRequest.readyState - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store in another request.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var up
datetitlerequest = objectstore.put(data); // log the source of this request console.log("the readystate of this request is " + up
datetitlerequest.readystate); // when this new request succeeds, run the displaydata() // function again t...
...o up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; specifications specification status comment indexed database api 2.0the definition of 'readystate' in that specification.
IDBRequest.source - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store in another request.
...walk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as its title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var up
datetitlerequest = objectstore.put(data); // log the source of this request console.log("the source of this request is " + up
datetitlerequest.source); // when this new request succeeds, run the displaydata() // function again to up
date ...
...the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; specifications specification status comment indexed database api 2.0the definition of 'source' in that specification.
IDBRequest.transaction - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store in another request.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var up
datetitlerequest = objectstore.put(data); // log the transaction that originated this request console.log("the transaction that originated this request is " + up
datetitlerequest.transaction); // when this new request succeeds, run the di...
...splaydata() // function again to up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; this example shows how a the transaction property can be used during a version upgrade to access existing object stores:​ var openrequest = indexeddb.open('db', 2); console.log(openrequest.transaction); // will log "null".
KeyboardEvent.code - Web APIs
let shipsize = { width: 30, height: 30 }; let position = { x: 200, y: 200 }; let moverate = 9; let turnrate = 5; let angle = 0; let spaceship = document.getelementbyid("spaceship"); next comes the function up
dateposition().
... function up
dateposition(offset) { let rad = angle * (math.pi/180); position.x += (math.sin(rad) * offset); position.y -= (math.cos(rad) * offset); if (position.x < 0) { position.x = 399; } else if (position.x > 399) { position.x = 0; } if (position.y < 0) { position.y = 399; } else if (position.y > 399) { position.y = 0; } } the refresh() function handles applying the rotation and position ...
... window.addeventlistener("keydown", function(event) { if (event.defaultprevented) { return; // do nothing if event already handled } switch(event.code) { case "keys": case "arrowdown": // handle "back" up
dateposition(-moverate); break; case "keyw": case "arrowup": // handle "forward" up
dateposition(moverate); break; case "keya": case "arrowleft": // handle "turn left" angle -= turnrate; break; case "keyd": case "arrowright": // handle "turn right" angle += turnrate; break; } refresh(); // consume the event so i...
MerchantValidationEvent.complete() - Web APIs
the merchantvalidationevent method complete() takes merchant-specific information previously received from the validationurl and uses it to vali
date the merchant.
...another payment request is currently being processed, the current payment request is not currently being displayed to the user, or payment information is currently being up
dated.
... candi
date recommendation initial definition.
MerchantValidationEvent - Web APIs
constructor merchantvalidationevent() secure context creates a new merchantvalidationevent object describing a merchantvalidation event that will be sent to the payment handler to request that it vali
date the merchant.
...once this data is retrieved, the data (or a promise resolving to the validation data) should be passed into complete() to vali
date that the payment request is coming from an authorized merchant.
... candi
date recommendation initial definition.
Metadata.modificationTime - Web APIs
the read-only modificationtime property of the metadata interface is a
date object which specifies the
date and time the file system entry (or the data referenced by the entry) was last modified.a file system entry is considered to have been modified if the metadata or the contents of the referenced file (or directory, or whatever other kind of file system entry might exist on the platform in use) has changed.
... syntax var modificationtime = metadata.modificationtime; value a
date timestamp indicating when the file system entry was last changed.
... workingdirectory.getfile("tmp/workfile.json", { create: true }, function(fileentry) { fileentry.getmetadata(function(metadata) { if ((new
date().getfullyear() - metadata.modificationtime.getfullyear()) >= 5) { fileentry.remove(function() { workingdirectory.getfile("tmp/workfile.json", { create: true }, function(newentry) { fileentry = newentry; }); }); } }); }, handleerror); this api has no official w3c or whatwg specification.
PaymentCurrencyAmount.currencySystem - Web APIs
this obsolete property was removed in the may 3, 2018 up
date of the payment request api specification.
... candi
date recommendation no longer part of the specification payment request api the definition of 'paymentcurrencyamount.currencysystem' in that specification.
... candi
date recommendation the march 20, 2018 version of the specification; the last one to include this property ...
PaymentMethodChangeEvent - Web APIs
properties in addition to the properties below, this interface includes properties inherited from paymentrequestup
dateevent.
... methods this interface includes methods inherited from paymentrequestup
dateevent.
... candi
date recommendation initial definition.
PaymentRequest.onshippingaddresschange - Web APIs
to make sure an up
dated address is included when sending payment information to the server, you should add event listeners for a paymentrequest object after instantiation, but before the call to show().
...var payment = new paymentrequest(supportedinstruments, details, options); request.addeventlistener('shippingaddresschange', function(evt) { evt.up
datewith(new promise(function(resolve) { up
datedetails(details, request.shippingaddress, resolve); })); }); payment.show().then(function(paymentresponse) { // processing of paymentresponse exerpted for the same of clarity.
... candi
date recommendation initial definition.
PaymentRequest.onshippingoptionchange - Web APIs
to make sure an up
dated option is included when sending payment information to the server, you should add event listeners for a paymentrequest object after instantiation, but before the call to show().
...var request = new paymentrequest(supportedinstruments, details, options); // when user selects a shipping address request.addeventlistener('shippingaddresschange', e => { e.up
datewith(((details, addr) => { var shippingoption = { id: '', label: '', amount: { currency: 'usd', value: '0.00' }, selected: true }; // shipping to us is supported if (addr.country === 'us') { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '0.00'; details.total.amount.value = '55.00'; // shipping to jp is supported } else if (addr.country === 'jp') { shippingoption.id = 'jp'; shippingoption.label = 'int...
... candi
date recommendation initial definition.
performance.now() - Web APIs
syntax t = performance.now(); example const t0 = performance.now(); dosomething(); const t1 = performance.now(); console.log(`call to dosomething took ${t1 - t0} milliseconds.`); unlike other timing data available to javascript (for example
date.now), the timestamps returned by performance.now() are not limited to one-millisecond resolution.
... also unlike
date.now(), the values returned by performance.now() always increase at a constant rate, independent of the system clock (which might be adjusted manually or skewed by software like ntp).
... otherwise, performance.timing.navigationstart + performance.now() will be approximately equal to
date.now().
PublicKeyCredential.response - Web APIs
in order to vali
date the creation of credentials, a relying party's server needs both: this response the extensions of the client (given by publickeycredential.getclientextensionresults()) to vali
date the demand.
... syntax response = publickeycredential.response value an authenticatorresponse object containing the data a relying party's script will receive and which should be sent to the relying party's server in order to vali
date the demand for creation or fetching.
... displayname: "john doe" }, pubkeycredparams: [ { type: "public-key", alg: -7 } ] }; navigator.credentials.create({ publickey: options }) .then(function (pubkeycredential) { var response = pubkeycredential.response; var clientextresults = pubkeycredential.getclientextensionresults(); // send response and client extensions to the server so that it can vali
date // and create credentials }).catch(function (err) { // deal with any error }); specifications specification status comment web authentication: an api for accessing public key credentials level 1the definition of 'response' in that specification.
RTCPeerConnection.createAnswer() - Web APIs
the answer contains information about any media already attached to the session, codecs and options supported by the browser, and any ice candi
dates already gathered.
...you should up
date any existing code to use the promise-based version of createanswer() instead.
... candi
date recommendation initial definition.
RTCPeerConnection.createOffer() - Web APIs
the sdp offer includes information about any mediastreamtracks already attached to the webrtc session, codec, and options supported by the browser, and any candi
dates already gathered by the ice agent, for the purpose of being sent over the signaling channel to a potential peer to request a connection or to up
date the configuration of an existing connection.
...you should up
date any existing code to use the promise-based version of createoffer() instead.
... candi
date recommendation initial definition.
RTCPeerConnection.onicegatheringstatechange - Web APIs
this happens when the ice gathering state—that is, whether or not the ice agent is actively gathering candi
dates—changes.
... example this example up
dates status information presented to the user to let them know what's happening by examining the current value of the icegatheringstate property each time it changes and changing the contents of a status display based on the new information.
... candi
date recommendation initial specification.
RTCPeerConnection.restartIce() - Web APIs
the webrtc api's rtcpeerconnection interface offers the restartice() method to allow a web application to easily request that ice candi
date gathering be redone on both ends of the connection.
...restarting ice essentially resets ice so that it creates all new candi
dates using new credentials.
... candi
date recommendation initial definition.
RTCPeerConnection.signalingState - Web APIs
this provisional answer describes the supported media formats and so forth, but may not have a complete set of ice candi
dates included.
... further candi
dates will be delivered separately later.
... candi
date recommendation initial specification.
RTCPeerConnection: signalingstatechange event - Web APIs
bubbles no cancelable no interface event event handler property rtcpeerconnection.onsignalingstatechange examples given an rtcpeerconnection, pc, and an up
datestatus() function that presents status information to the user, this code sets up an event handler to let the user know when the ice negotiation process finishes up.
... pc.addeventlistener("signalingstatechange", ev => { switch(pc.signalingstate) { case "stable": up
datestatus("ice negotiation complete"); break; } }, false); using onsignalingstatechange, it looks like this: pc.onsignalingstatechange = ev => { switch(pc.signalingstate) { case "stable": up
datestatus("ice negotiation complete"); break; } }; specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'signalingstatechange' in that specification.
... candi
date recommendation ...
RTCRtpSender.setParameters() - Web APIs
in other words, setparameters() up
dates the configuration of the rtp transmission as well as the encoding configuration for a specific media track on the webrtc connection.
... return value a promise that resolves when the rtcrtpsender.track property is up
dated with the given parameters.
... candi
date recommendation initial definition.
RTCRtpStreamStats.qpSum - Web APIs
the qpsum property of the rtcrtpstreamstats dictionary is a value generated by adding the quantization parameter (qp) values for every frame sent or received to
date on the video track corresponding to this rtcrtpstreamstats object.
... candi
date recommendation initial definition.
... candi
date recommendation initial definition.
RTCRtpStreamStats - Web APIs
note: this interface was called rtcrtpstreamstats until a specification up
date in the spring of 2017.
... qpsum the sum of the quantization parameter (qp) values associated with every frame received to
date on the video track described by this rtcrtpstreamstats object.
... candi
date recommendation initial definition.
SVGLength - Web APIs
setting this attribute will cause valueinspecifiedunits and valueasstring to be up
dated automatically to reflect this setting.
...setting this attribute will cause value and valueasstring to be up
dated automatically to reflect this setting.
...setting this attribute will cause value, valueinspecifiedunits, and unittype to be up
dated automatically to reflect this setting.
SVGTransformList - Web APIs
vgtransform getitem(in unsigned long index) svgtransform insertitembefore(in svgtransform newitem, in unsigned long index) svgtransform replaceitem(in svgtransform newitem, in unsigned long index) svgtransform removeitem(in unsigned long index) svgtransform appenditem(in svgtransform newitem) svgtransform createsvgtransformfrommatrix(in svgmatrix) svgtransform consoli
date() properties readonly unsigned long numberofitems readonly unsigned long length normative document svg 1.1 (2nd edition) properties name type description numberofitems unsigned long the number of items in the list.
... consoli
date() svgtransform consoli
dates the list of separate svgtransform objects by multiplying the equivalent transformation matrices together to result in a list consisting of a single svgtransform object of type svg_transform_matrix.
... candi
date recommendation scalable vector graphics (svg) 1.1 (second edition)the definition of 'svgtransformlist' in that specification.
ServiceWorkerContainer - Web APIs
the serviceworkercontainer interface of the service worker api provides an object representing the service worker as an overall unit in the network ecosystem, including facilities to register, unregister and up
date service workers, and access the state of service workers and their registrations.
... methods serviceworkercontainer.register() creates or up
dates a serviceworkerregistration for the given scripturl.
... if (navigator.serviceworker.controller) { console.log('this page is currently controlled by:', navigator.serviceworker.controller); } // then, register a handler to detect when a new or // up
dated service worker takes control.
ShadowRoot - Web APIs
inside the <custom-square> element's class definition we include some life cycle callbacks that make a call to an external function, up
datestyle(), which actually applies the size and color to the element.
... connectedcallback() { console.log('custom square element added to page.'); up
datestyle(this); } attributechangedcallback(name, oldvalue, newvalue) { console.log('custom square element attributes changed.'); up
datestyle(this); } in the up
datestyle() function itself, we get a reference to the shadow dom using element.shadowroot.
... from here we use standard dom traversal techniques to find the <style> element inside the shadow dom and then up
date the css found inside it: function up
datestyle(elem) { var shadow = elem.shadowroot; var childnodes = shadow.childnodes; for(var i = 0; i < childnodes.length; i++) { if(childnodes[i].nodename === 'style') { childnodes[i].textcontent = 'div {' + 'width: ' + elem.getattribute('l') + 'px;' + 'height: ' + elem.getattribute('l') + 'px;' + 'background-color: ' + elem.getattribute('c') + ';' + '}'; } } } specifications specification status comment domthe definition of 'interface shadowroot' in that specification.
Visual Viewport API - Web APIs
one thing that may not be clear in this example is the use of the pendingup
date flag and the call to requestanimationframe().
... the pendingup
date flag serves to prevent multiple invocations of the transfrom that can occur when onresize and onscroll fire at the same time.
... let pendingup
date = false; function viewporthandler(event) { if (pendingup
date) return; pendingup
date = true; requestanimationframe(() => { pendingup
date = false; var layoutviewport = document.getelementbyid('layoutviewport'); // since the bar is position: fixed we need to offset it by the // visual viewport's offset from the layout viewport origin.
WebGL2RenderingContext - Web APIs
webgl2renderingcontext.buffersubdata() up
dates a subset of a buffer object's data store.
... webgl2renderingcontext.invali
dateframebuffer() invali
dates the contents of attachments in a framebuffer.
... webgl2renderingcontext.invali
datesubframebuffer() invali
dates portions of the contents of attachments in a framebuffer webgl2renderingcontext.readbuffer() selects a color buffer as the source for pixels.
WebGLRenderingContext.isEnabled() - Web APIs
gl.depth_test depth comparisons and up
dates to the depth buffer.
... gl.stencil_test stencil testing and up
dates to the stencil buffer.
... editor's draft up
dated definition for webgl 2.
Scissor animation - Web APIs
note that this time it is the position of the square (the scissoring area) that is up
dated every frame (we set frame rate to roughly one every 17ms, or roughly 60fps – frames per second).
... in contrast, the color of the square (set with clearcolor) is only up
dated when a new square is created.
...for each square, we set its color once, and then up
date only its position every frame.
Animating objects with WebGL - Web APIs
the first thing we'll need is a variable in which to track the current rotation of the square: var squarerotation = 0.0; now we need to up
date the drawscene() function to apply the current rotation to the square when drawing it.
...at the end of drawscene we add the code to up
date squarerotation.
... squarerotation += deltatime; this code uses the amount of time that's passed since the last time we up
dated the value of squarerotation to determine how far to rotate the square.
Using textures in WebGL - Web APIs
when the image has finished downloading // we'll up
date the texture with the contents of the image.
... updating the shaders the shader program also needs to be up
dated to use the textures instead of solid colors.
... the fragment shader the fragment shader likewise needs to be up
dated: const fssource = ` varying highp vec2 vtexturecoord; uniform sampler2d usampler; void main(void) { gl_fragcolor = texture2d(usampler, vtexturecoord); } `; instead of assigning a color value to the fragment's color, the fragment's color is computed by fetching the texel (that is, the pixel within the texture) based on the value of vtexturecoord which like the color...
Lifetime of a WebRTC session - Web APIs
each peer establishes a handler for icecandi
date events, which handles sending those candi
dates to the other peer over the signaling channel.
... descriptions, candi
dates, etc.
... if you need to change the configuration of the connection in some way (such as changing to a different set of ice servers), you can do so before restarting ice by calling rtcpeerconnection.setconfiguration() with an up
dated rtcconfiguration dictionary before restarting ice.
Inputs and input sources - Web APIs
it calls a function applyexternalinputs() which we'll define momentarily; it takes the avatar object and uses its information to up
date the avatar's reference frame.
... after that, everything proceeds as usual, getting the viewer's pose from the up
dated reference frame, requesting the next frame callback through requestanimationframe(), and then continuing to set up webgl and draw the scene.
... the applyexternalinputs() method takes the avatar object replaces its referencespace property with a new reference space that incorporates the up
dated deltas.
Movement, orientation, and motion: A WebXR example - Web APIs
viewmatrix: gl.getuniformlocation(shaderprogram, 'umodelviewmatrix'), normalmatrix: gl.getuniformlocation(shaderprogram, 'unormalmatrix'), usampler: gl.getuniformlocation(shaderprogram, 'usampler') }, }; buffers = initbuffers(gl); texture = loadtexture(gl, 'https://cdn.glitch.com/a9381af1-18a9-495e-ad01-afddfd15d000%2ffirefox-logo-solid.png?v=1575659351244'); xrsession.up
daterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); if (session_type == "immersive-vr") { refspacetype = "local"; } else { refspacetype = "viewer"; } mat4.fromtranslation(cubematrix, viewerstartposition); vec3.copy(cubeorientation, viewerstartorientation); xrsession.requestreferencespace(refspacetype) .then((refspace) => { xrreferencespace = refspace.ge...
...we connect the session to the webgl layer so it konws what to use as a rendering surface by calling xrsession.up
daterenderstate() with a baselayer set to a new xrwebgllayer.
...in either case, the label of the button is up
dated to indicate that a click will start a session, and then, if there is a pending request for an animation frame, we cancel it by calling cancelanimationframe once that's done, the value of xrsession is changed to null to indicate that we're done with the session.
Advanced techniques: Creating and sequencing audio - Web APIs
ol these using range inputs on the interface: <label for="attack">attack</label> <input name="attack" id="attack" type="range" min="0" max="1" value="0.2" step="0.1" /> <label for="release">release</label> <input name="release" id="release" type="range" min="0" max="1" value="0.5" step="0.1" /> now we can create some variables over in javascript and have them change when the input values are up
dated: let attacktime = 0.2; const attackcontrol = document.queryselector('#attack'); attackcontrol.addeventlistener('input', function() { attacktime = number(this.value); }, false); let releasetime = 0.5; const releasecontrol = document.queryselector('#release'); releasecontrol.addeventlistener('input', function() { releasetime = number(this.value); }, false); the final playsweep() functio...
...ll do that in the same sort of way as before: <label for="rate">rate</label> <input name="rate" id="rate" type="range" min="0.1" max="2" value="1" step="0.1" /> let playbackrate = 1; const ratecontrol = document.queryselector('#rate'); ratecontrol.addeventlistener('input', function() { playbackrate = number(this.value); }, false); the final playsample() function we'll then add a line to up
date the playbackrate property to our playsample() function.
... while (nextnotetime < audioctx.currenttime + scheduleaheadtime ) { schedulenote(currentnote, nextnotetime); nextnote(); } timerid = window.settimeout(scheduler, lookahead); } we also need a draw function to up
date the ui, so we can see when the beat progresses.
Using the Web Audio API - Web APIs
we'll use the factory method in our code: const gainnode = audiocontext.creategain(); now we have to up
date our audio graph from before, so the input is connected to the gain, then the gain node is connected to the destination: track.connect(gainnode).connect(audiocontext.destination); this will make our audio graph look like this: the default value for gain is 1; this keeps the current volume the same.
... so let's grab this input's value and up
date the gain value when the input node has its value changed by the user: const volumecontrol = document.queryselector('#volume'); volumecontrol.addeventlistener('input', function() { gainnode.gain.value = this.value; }, false); note: the values of node objects (e.g.
... great, now the user can up
date the track's volume!
Web Storage API - Web APIs
stores data with no expiration
date, and gets cleared only through javascript, or clearing the browser cache / locally stored data.
...when you choose different options, the page is instantly up
dated; in addition your choices are stored in localstorage, so that when you leave the page then load it again later on your choices are remembered.
... in addition, we have provided an event output page — if you load this page in another tab, then make changes to your choices in the landing page, you'll see the up
dated storage information outputted as the storageevent is fired.
Window.requestAnimationFrame() - Web APIs
the window.requestanimationframe() method tells the browser that you wish to perform an animation and requests that the browser calls a specified function to up
date an animation before the next repaint.
... you should call this method whenever you're ready to up
date your animation onscreen.
... syntax window.requestanimationframe(callback); parameters callback the function to call when it's time to up
date your animation for the next repaint.
XRRenderState.baseLayer - Web APIs
this property is read-only; however, you can indirectly change its value using xrsession.up
daterenderstate.
... see the examples below to see how to use up
daterenderstate() to set the current xrwebgllayer used for rendering the scene.
... examples you can set the xrwebgllayer used for rendering by calling up
daterenderstate(), like this: let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); setnewwebgllayer(); function setnewwebgllayer(gl) { if (!gl) { /* webgl not available */ return; } xrsession.up
daterenderstate({ baselayer: new xrwebgllayer(xrsession, gl); }); }; here, the canvas obtained in the first line is the canvas into which webgl is going to draw.
XRSession.requestAnimationFrame() - Web APIs
the callback takes two parameters as inputs: an xrframe describing the state of all tracked objects for the session, and a time stamp you can use to compute any animation up
dates needed.
... syntax requestid = xrsession.requestanimationframe(animationframecallback); parameters animationframecallback a function which is called before the next repaint in order to allow you to up
date and render the xr scene based on elapsed time, animation, user input changes, and so forth.
... the callback receives as input two parameters: time a domhighrestimestamp indicating the time offset at which the up
dated viewer state was received from the webxr device.
XRView.eye - Web APIs
gllayer = xrsession.renderstate.baselayer; gl.bindframebuffer(gl.framebuffer, gllayer.framebuffer); gl.clearcolor(0,0, 0, 1.0); gl.cleardepth(1.0); gl.clear(gl.color_buffer_bit, gl.depth_buffer_bit); for (let view of xrpose.views) { let skipview = false; if (view.eye == "left" && body.lefteye.injured) || skipview = up
dateinjury(body.lefteye); } else if (view.eye == "right" && body.righteye.injured) { skipview = up
dateinjury(body.righteye); } if (!skipview) { let viewport = gllayer.getviewport(view); gl.viewport(viewport.x, viewport.y, viewport.width, viewport.height); renderscene(gl, view); } } for each of the views, the value of eye is checked and if it's either left or right, we check ...
...to see if the body.lefteye.injured or body.righteye.injured property is true; if so, we call a function up
dateinjury() on that eye to do things such as allow a bit of healing to occur, track the progress of a poison effect, or the like, as appropriate for the game's needs.
... up
dateinjury() returns true if the eye is still injured or false if the eye has been restored to health by the function,.
Using the log role - Accessibility
by default up
dates contain only the changes to the live region and these are announced when the user is idle.
...to have announcements made as soon as possible and where the user may be interrupted, aria-live="assertive" can be set for more aggressive up
dates.
... screen magnifiers may visually indicate that a log up
date has occurred.
Using the slider role - Accessibility
the application will programmatically up
date the value of aria-valuenow in response to user input.
... <label for="fader">volume</label> <input type="range" id="fader" min="1" max="100" value="50" step="1" aria-valuemin="1" aria-valuemax="100" aria-valuenow="50" oninput="outputup
date(value)"> <output for="fader" id="volume">50</output> the following code snippet allows you to return the output as it is up
dated by user input: function outputup
date(vol) { document.queryselector('#volume').value = vol; } example 2: text values sometimes, a slider is used to choose a value that is not, semantically, a number.
... <label id="day-label">days</label> <div class="day-slider"> <div id="day-handle" class="day-slider-handle" role="slider" aria-labelledby="day-label" aria-valuemin="1" aria-valuemax="7" aria-valuenow="2" aria-valuetext="monday"> </div> </div> the code snippet below shows a function that responds to user input and up
dates the aria-valuenow and aria-valuetext attributes: var daynames = ["sunday", "monday", "tuesday", "wednesday", "thursday", "friday", "saturday"]; var up
dateslider = function (newvalue) { var handle = document.getelementbyid("day-handle"); handle.setattribute("aria-valuenow", newvalue.tostring()); handle.setattribute("aria-valuetext", daynames[newvalue]); }; working examples: slid...
ARIA: alert role - Accessibility
the alert role can be used to tell the user an element has been dynamically up
dated.
... screen readers will instantly start reading out the up
dated content when the role is added.
... description one of the five live region roles, the alert role is used to provide the user with important, and usually time-sensitive, information, and often to tell the user an element has been dynamically up
dated.
ARIA: feed role - Accessibility
if the addition of articles occupies the main browser thread, make sure to set aria-busy="true" on the feed itself, and make sure to set it back to false when processing ends, or the user may not see the up
dates.
... aria-busy when busy, such as when articles are being added or removed from the feed, set aria-busy="true" during the up
date operation.
...for example, setting aria-busy to true during the up
date operation if needed, and then to false upon completion.
Web accessibility for seizures and physical reactions - Accessibility
a great resource is mdn's document on window.matchmedia() media up
date feature the more often the screen is refreshed, the more stable it appears to the human eye, and the less it "flickers".
... "this effect is noticable, and documented, up to 70 hz." "these studies would seem to indicate that you should stay away from refresh rates under 70 hz, and use a rate not divisible by 10." eric bailey, of css-tricks, found an innovative use the up
date feature which, used in combination with animation-duration or transition-duration, to conclude at a rate that is imperceptible to the human eye.
... @media screen and (prefers-reduced-motion: reduce), (up
date: slow) { * { animation-duration: 0.001ms !important; animation-iteration-count: 1 !important; /* hat tip nick/cssremedy (https://css-tricks.com/revisiting-prefers-reduced-motion-the-reduced-motion-media-query/#comment-1700170) */ transition-duration: 0.001ms !important; } } from w3.org's page on media queries 4: the up
date media feature is used to query the ability of the output device to modify the appearance of content once it has been rendered.
@media - CSS: Cascading Style Sheets
up
date how frequently the output device can modify the appearance of content added in media queries level 4.
... width width of the viewport including width of scrollbar accessibility concerns to best accommo
date people who adjust a site's text size, use ems when you need a <length> for your media queries.
... adds scripting, pointer, hover, up
date, overflow-block, and overflow-inline media features.
At-rules - CSS: Cascading Style Sheets
(at the candi
date recommendation stage, but only implemented in gecko as of writing) @font-feature-values (plus @swash, @ornaments, @annotation, @stylistic, @styleset and @character-variant) — define common names in font-variant-alternates for feature activated differently in opentype.
... (at the candi
date recommendation stage, but only implemented in gecko as of writing) conditional group rules much like the values of properties, each at-rule has a different syntax.
... specifications specification status comment css conditional rules module level 3 candi
date recommendation initial definition compatibility standardthe definition of 'css at-rules' in that specification.
Variable fonts guide - CSS: Cascading Style Sheets
warning: in order to use variable fonts on your operating system, you need to make sure that it is up to
date.
...if your operating system is not up to
date, you will not be able to use variable fonts in web pages or the firefox developer tools.
...the second example uses css custom properties to set values for a font-variation-settings string, and shows how you can more easily up
date single variable values by overriding a single variable rather than rewriting the whole string.
<custom-ident> - CSS: Cascading Style Sheets
candi
date recommendation defines which values are excluded for will-change.
... candi
date recommendation uses <custom-ident> instead of a finite list of keywords.
... candi
date recommendation renames <identifier> to <custom-ident>.
Video player styling basics - Developer guides
the example in action you can find the code for the up
dated, styled example on github, and view it live.
...the internal <span> element used as the actual progressing part of the faked progress bar has its width initially set to 0% (it is up
dated via javascript) and it also has its background colour set.
...'unmute' : 'mute'); } } this function is then called by the relevant event handlers: video.addeventlistener('play', function() { changebuttonstate('playpause'); }, false); video.addeventlistener('pause', function() { changebuttonstate('playpause'); }, false); stop.addeventlistener('click', function(e) { video.pause(); video.currenttime = 0; progress.value = 0; // up
date the play/pause button's 'data-state' which allows the correct button image to be set via css changebuttonstate('playpause'); }); mute.addeventlistener('click', function(e) { video.muted = !video.muted; changebuttonstate('mute'); }); you might have noticed that there are new handlers where the play and pause events are reacted to on the video.
Using HTML sections and outlines - Developer guides
in the context of a section, a footer might contain the sectioned content's publication
date, license information, etc.
... </p> <aside> <blockquote> amazing quote from article </blockquote> </aside> <footer> <p> author info, publication
date </p> </footer> </article> nesting articles and sections articles can be nested inside of sections and sections can be nested inside of articles.
... <section> <h1>getting involved</h1> <article> <header> <h2>how to become an mdn contributor</h2> <p>do you want to help protect the web?....</p> </header> <section> <h3>steps to editing an article</h3> </section> <footer> <p>author info</p> <p>publication
date</p> </footer> </article> </section> section element the section element is used for a thematic grouping of content.
HTML attribute: readonly - HTML: Hypertext Markup Language
the readonly attribute is supported by text, search, url, tel, email, password,
date, month, week, time,
datetime-local, and number<input> types and the <textarea> form control elements.
... constraint validation if the element is readonly, then the element's value can not be up
dated by the user, and does not participate in constraint validation.
... example html <div class="group"> <input type="textbox" value="some value" readonly="readonly"/> <label>textbox</label> </div> <div class="group"> <input type="
date" value="2020-01-01" readonly="readonly"/> <label>
date</label> </div> <div class="group"> <input type="email" value="some value" readonly="readonly"/> <label>email</label> </div> <div class="group"> <input type="password" value="some value" readonly="readonly"/> <label>password</label> </div> <div class="group"> <textarea readonly="readonly">some value</textarea> <label>message</label> </div> result examples <fieldset> <legend>checkboxes buttons</legend> <p><label> <input type="checkbox" name="chbox" value="regular"> regular </label></p> <p><label> <input type="checkbox" name="chbox" va...
<dialog>: The Dialog element - HTML: Hypertext Markup Language
examples simple example <dialog open> <p>greetings, one and all!</p> </dialog> advanced example this example opens a pop-up dialog box that contains a form, when the "up
date details" button is clicked.
...ialog"> <p><label>favorite animal: <select> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button value="cancel">cancel</button> <button id="confirmbtn" value="default">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <output aria-live="polite"></output> javascript var up
datebutton = document.getelementbyid('up
datedetails'); var favdialog = document.getelementbyid('favdialog'); var outputbox = document.queryselector('output'); var selectel = document.queryselector('select'); var confirmbtn = document.getelementbyid('confirmbtn'); // "up
date details" button opens the...
... <dialog> modally up
datebutton.addeventlistener('click', function onopen() { if (typeof favdialog.showmodal === "function") { favdialog.showmodal(); } else { alert("the <dialog> api is not supported by this browser"); } }); // "favorite animal" input sets the value of the submit button selectel.addeventlistener('change', function onselect(e) { confirmbtn.value = selectel.value; }); // "confirm" button of form triggers "close" on dialog because of [method="dialog"] favdialog.addeventlistener('close', function onclose() { outputbox.value = favdialog.returnvalue + " button clicked - " + (new
date()).tostring(); }); result specifications specification status comment html living standardthe definition of '<dialog>' in that specification.
<input type="button"> - HTML: Hypertext Markup Language
gin by creating a simple button with a click event handler that starts our machine (well, it toggles the value of the button and the text content of the following paragraph): <form> <input type="button" value="start machine"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', up
datebutton); function up
datebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } the script gets a reference to the htmlinputelement object representing the <input> in the dom, saving this refence in the...
... <form> <input type="button" value="start machine" accesskey="s"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', up
datebutton); function up
datebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } note: the problem with the above example of course is that the user will not know what the access key is!
...illstyle = 'rgb(0,0,0)'; ctx.fillrect(0,0,width,height); var colorpicker = document.queryselector('input[type="color"]'); var sizepicker = document.queryselector('input[type="range"]'); var output = document.queryselector('.output'); var clearbtn = document.queryselector('input[type="button"]'); // covert degrees to radians function degtorad(degrees) { return degrees * math.pi / 180; }; // up
date sizepicker output value sizepicker.oninput = function() { output.textcontent = sizepicker.value; } // store mouse pointer coordinates, and whether the button is pressed var curx; var cury; var pressed = false; // up
date mouse pointer coordinates document.onmousemove = function(e) { curx = (window.event) ?
<input type="submit"> - HTML: Hypertext Markup Language
formnovali
date a boolean which, if present, means the form's fields will not be subjected to constraint validation before submitting the data to the server formtarget the browsing context into which to load the response returned by the server after submitting the form formaction a string indicating the url to which to submit the data.
... formnovali
date a boolean attribute which, if present, specifies that the form should not be vali
dated before submission to the server.
... this overrides the value of the novali
date attribute on the element's owning form.
<input type="text"> - HTML: Hypertext Markup Language
you should use them anywhere you want the user to enter a single-line value and there isn't a more specific input type available for collecting that value (for example, if it's a
date, url, email, or search term, you've got better options available).
...if your server-side code fails to vali
date the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
... specifying a pattern you can use the pattern attribute to specify a regular expression that the inputted value must match in order to be considered valid (see validating against a regular expression for a simple crash course on using regular expressions to vali
date inputs).
itemscope - HTML: Hypertext Markup Language
<div itemscope itemtype="http://schema.org/recipe"> <h2 itemprop="name">grandma's holiday apple pie</h2> <img itemprop="image" src="https://udn.realityripple.com/samples/60/d063c361c1.jpg" width="50" height="50" /> <p> by <span itemprop="author" itemscope itemtype="http://schema.org/person"> <span itemprop="name">carol smith</span> </span> </p> <p> published: <time
datetime="2009-11-05" itemprop="
datepublished">november 5, 2009</time> </p> <span itemprop="description">this is my grandmother's apple pie recipe.
... i like to add a dash of nutmeg.</span> <br> <span itemprop="aggregaterating" itemscope itemtype="http://schema.org/aggregaterating"> <span itemprop="ratingvalue">4.0</span> stars based on <span itemprop="reviewcount">35</span> reviews </span> <br> prep time: <time
datetime="pt30m" itemprop="preptime">30 min</time><br> cook time: <time
datetime="pt1h" itemprop="cooktime">1 hou</time>r<br> total time: <time
datetime="pt1h30m" itemprop="totaltime">1 hour 30 min</time><br> yield: <span itemprop="recipeyield">1 9" pie (8 servings)</span><br> <span itemprop="nutrition" itemscope itemtype="http://schema.org/nutritioninformation"> serving size: <span itemprop="servingsize">1 medium slice</span><br> calories per serving: <span itemprop="calories">250 cal</span><br> fa...
... structured data itemscope itemtype recipe itemprop name grandma's holiday apple pie itemprop image https://c1.staticflickr.com/1/30/42759561_8631e2f905_n.jpg itemprop
datepublished 2009-11-05 itemprop description this is my grandmother's apple pie recipe.
itemtype - HTML: Hypertext Markup Language
for example, musicevent indicates a concert performance, with start
date and location properties specifying the concert's key details.
... in this case, musicevent would be the url used by itemtype, with start
date and location as itemprop's which musicevent defines.
...ng"> rating: <span itemprop="ratingvalue">4.4</span> stars, based on <span itemprop="reviewcount">89 </span> reviews </span><p> <span itemprop="offers" itemscope itemtype="http://schema.org/offer"> regular price: $179.99<br> <meta itemprop="pricecurrency" content="usd" /> <span itemprop="price">sale price: $119.99<br></span> (sale ends <time itemprop="pricevaliduntil"
datetime="2020-11-05"> 5 november!</time>)<br> available from: <span itemprop="seller" itemscope itemtype="http://schema.org/organization"> <span itemprop="name">executive objects<br></span> </span> condition: <link itemprop="itemcondition" href="http://schema.org/usedcondition"/>previously owned, in excellent condition<br> <link itempr...
Using HTTP cookies - HTTP
an expiration
date or duration can be specified, after which the cookie is no longer sent.
... permanent cookies are deleted at a
date specified by the expires attribute, or after a period of time specified by the max-age attribute.
... for example: set-cookie: id=a3fwa; expires=wed, 31 oct 2021 07:28:00 gmt; note: when an expires
date is set, the time and
date set is relative to the client the cookie is being set on, not the server.
Expires - HTTP
the expires header contains the
date/time after which the response is considered stale.
... invalid
dates, like the value 0, represent a
date in the past and mean that the resource is already expired.
... header type response header forbidden header name no cors-safelisted response header yes syntax expires: <http-
date> directives <http-
date> an http-
date timestamp.
If-Unmodified-Since - HTTP
the if-unmodified-since request http header makes the request conditional: the server will send back the requested resource, or accept it in the case of a post or another non-safe method, only if it has not been last modified after the given
date.
... if the resource has been modified after the given
date, the response will be a 412 (precondition failed) error.
...http
dates are always expressed in gmt, never in local time.
An overview of HTTP - HTTP
http can also be used to fetch parts of documents to up
date web pages on demand.
...scripts executed by the browser can fetch more resources in later phases and the browser up
dates the web page accordingly.
...for example: get / http/1.1 host: developer.mozilla.org accept-language: fr read the response sent by the server, such as: http/1.1 200 ok
date: sat, 09 oct 2010 14:28:02 gmt server: apache last-modified: tue, 01 dec 2009 20:18:22 gmt etag: "51142bc1-7449-479b075b2891b" accept-ranges: bytes content-length: 29769 content-type: text/html <!doctype html...
Redirections in HTTP - HTTP
they imply that the original url should no longer be used, and replaced with the new one.search engine robots, rss readers, and other crawlers will up
date the original url for the resource.
... 304 not modified sent for revali
dated conditional requests.
...even if you up
date your site's links to match the new urls, you have no control over the urls used by external resources.
A typical HTTP session - HTTP
example responses successful web page response: http/1.1 200 ok content-type: text/html; charset=utf-8 content-length: 55743 connection: keep-alive cache-control: s-maxage=300, public, max-age=0 content-language: en-us
date: thu, 06 dec 2018 17:37:18 gmt etag: "2e77ad1dc6ab0b53a2996dfd4653c1c3" server: meinheld/0.6.1 strict-transport-security: max-age=63072000 x-content-type-options: nosniff x-frame-options: deny x-xss-protection: 1; mode=block vary: accept-encoding,cookie age: 7 <!doctype html> <html lang="en"> <head> <meta charset="utf-8"> <title>a simple webpage</title> </head> <body> <h1>simple html5 web...
...page</h1> <p>hello, world!</p> </body> </html> notification that the requested resource has permanently moved: http/1.1 301 moved permanently server: apache/2.4.37 (red hat) content-type: text/html; charset=utf-8
date: thu, 06 dec 2018 17:33:08 gmt location: https://developer.mozilla.org/ (this is the new link to the resource; it is expected that the user-agent will fetch it) keep-alive: timeout=15, max=98 accept-ranges: bytes via: moz-cache-zlb05 connection: keep-alive content-length: 325 (the content contains a default page to display if the user-agent is not able to follow the link) <!doctype html...
... (contains a site-customized page helping the user to find the missing resource) notification that the requested resource doesn't exist: http/1.1 404 not found content-type: text/html; charset=utf-8 content-length: 38217 connection: keep-alive cache-control: no-cache, no-store, must-revali
date, max-age=0 content-language: en-us
date: thu, 06 dec 2018 17:35:13 gmt expires: thu, 06 dec 2018 17:35:13 gmt server: meinheld/0.6.1 strict-transport-security: max-age=63072000 x-content-type-options: nosniff x-frame-options: deny x-xss-protection: 1; mode=block vary: accept-encoding,cookie x-cache: error from cloudfront <!doctype html...
HTTP response status codes - HTTP
you can find an up
dated specification in rfc 7231.
...the user-agent may up
date its cached headers for this resource with the new ones.
...this response is intended to prevent the 'lost up
date' problem, where a client gets a resource's state, modifies it, and puts it back to the server, when meanwhile a third party has modified the state on the server, leading to a conflict.
A re-introduction to JavaScript (JS tutorial) - JavaScript
the standard received a significant up
date as ecmascript edition 3 in 1999, and it has stayed pretty much stable ever since.
...and
date and regexp, which are objects that you get for free.
...so the type diagram looks more like this: number string boolean symbol (new in es2015) object function array
date regexp null undefined and there are some built-in error types as well.
JavaScript data types and data structures - JavaScript
special non-data but structural type for any constructed object instance also used as data structures: new object, new array, new map, new set, new weakmap, new set, new
date and almost everything made with new keyword; function : a non-data structure, though it also answers for typeof operator: typeof instance === "function".
...
dates when representing
dates, the best choice is to use the built-in
date utility in javascript.
...this makes arrays a perfect candi
date to represent lists or sets.
Regular expressions - JavaScript
if you use exec() or match() and if the match succeeds, these methods return an array and up
date properties of the associated regular expression object and also of the predefined regular expression object, regexp.
... (see different behaviors for further info about the different behaviors.) if you want to construct the regular expression from a string, yet another alternative is this script: var myre = new regexp('d(b+)d', 'g'); var myarray = myre.exec('cdbbdbsbz'); with these scripts, the match succeeds and returns the array and up
dates the properties shown in the following table.
...up
dated at the time that the regular expression is created, not executed.
Reflect - JavaScript
returns a boolean that is true if the up
date was successful.
...returns a boolean that is true if the up
date was successful.
...returns a boolean that is true if the up
date was successful.
Standard built-in objects - JavaScript
error aggregateerror evalerror internalerror rangeerror referenceerror syntaxerror typeerror urierror numbers and
dates these are the base objects representing numbers,
dates, and mathematical calculations.
... number bigint math
date text processing these objects represent strings and support manipulating them.
... intl intl.collator intl.
datetimeformat intl.listformat intl.numberformat intl.pluralrules intl.relativetimeformat intl.locale webassembly webassembly webassembly.module webassembly.instance webassembly.memory webassembly.table webassembly.compileerror webassembly.linkerror webassembly.runtimeerror other arguments ...
instanceof - JavaScript
examples demonstrating that string and
date are of type object and exceptional cases the following code uses instanceof to demonstrate that string and
date objects are also of type object (they are derived from object).
... let simplestr = 'this is a simple string' let mystring = new string() let newstr = new string('string created with constructor') let my
date = new
date() let myobj = {} let mynonobj = object.create(null) simplestr instanceof string // returns false, string literal is not an object mystring instanceof string // returns true newstr instanceof string // returns true mystring instanceof object // returns true myobj instanceof object // returns true, every object literal has object.prototype as prototype ({}) instanceof object // returns true, same case as above mynonobj instanceof object // returns false, prototy...
...pe is end of prototype chain (null) mystring instanceof
date // returns false my
date instanceof
date // returns true my
date instanceof object // returns true my
date instanceof string // returns false demonstrating that mycar is of type car and type object the following code creates an object type car and an instance of that object type, mycar.
MathML documentation index - MathML
3 examples beginner, example, guide, mathml, needsbeginnerup
date below you'll find some examples you can look at to help you to understand how to use mathml to display increasingly complex mathematical concepts in web content.
... 4 mathml: deriving the quadratic formula beginner, education, example, guide, html5, mathml, needsbeginnerup
date this page outlines the derivation of the quadratic formula.
... 5 proving the pythagorean theorem beginner, example, guide, html5 math, math education, mathml, needsbeginnerup
date we will now prove the pythagorean theorem: 6 mathml attribute reference mathml, mathml reference this is an alphabetical list of mathml attributes.
Web audio codec guide - Web media technologies
g.722 is primarily used with webrtc connections, as it's one of the audio codecs man
dated by the webrtc specification.
... for general music playback, the three most likely candi
dates are mp3, aac, and vorbis.
... assuming that lossless compression is our best option here (which it usually is, as long as the audio files are small), the three strongest candi
dates from a codec perspective are flac, apple lossless (alac), and mpeg-4 als.
Critical rendering path - Web Performance
any time the render tree is modified, such as by added nodes, altered content, or up
dated box model styles on a node, layout occurs.
... to reduce the frequency and duration of layout events, batch up
dates and avoid animating box model properties.
...paint time depends on what kind of up
dates are being applied to the render tree.
Introduction to progressive web apps - Progressive web apps (PWAs)
the ability to up
date only the content that has changed when an app up
date is available.
... re-engageability one major advantage of native platforms is the ease with which users can be re-engaged by up
dates and new content, even when they aren't looking at the app or using their devices.
... modern web apps can now do this too, using new technologies such as service workers for controlling pages, the web push api for sending up
dates straight from server to app via a service worker, and the notifications api for generating system notifications to help engage users when they're not actively using their web browser.
height - SVG: Scalable Vector Graphics
candi
date recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'height' in that specification.
... candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'height' in that specification.
... candi
date recommendation definition for <pattern> scalable vector graphics (svg) 1.1 (second edition)the definition of 'height' in that specification.
width - SVG: Scalable Vector Graphics
candi
date recommendation definition for <mask> scalable vector graphics (svg) 2the definition of 'width' in that specification.
... candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'width' in that specification.
... candi
date recommendation definition for <pattern> scalable vector graphics (svg) 1.1 (second edition)the definition of 'width' in that specification.
Certificate Transparency - Web security
with the latter methods, servers will need to be up
dated to send the required data.
... browser requirements google chrome requires ct log inclusion for all certificates issues with a notbefore
date of after 30 april 2018.
...in chrome, even if the certificate was issued with a notbefore
date prior to april).
panel - Archive of obsolete content
": "./icon-32.png", "64": "./icon-64.png" }, onchange: handlechange }); var mypanel = sdkpanels.panel({ contenturl: self.data.url("panel.html"), onhide: handlehide }); function handlechange(state) { if (state.checked) { mypanel.show({ position: button }); } } function handlehide() { button.state('window', {checked: false}); } updating panel content you can up
date the panel's content by: sending a message to a content script that up
dates the dom in the same document.
...setting it up
dates the panel's content immediately.
ui/frame - Archive of obsolete content
you can specify the frame's url property as the targetorigin: frame.postmessage(message, frame.url); this add-on listens for a frame script to send the "city changed" message above, and in response, up
dates all frames across all browser windows with that city's current weather (it just reads this from a dictionary, where in a real case it might ask a web service): var { frame } = require("sdk/ui/frame"); var { toolbar } = require("sdk/ui/toolbar"); var weather = { "london" : "rainy", "toronto" : "snowy", "san francisco" : "foggy" } var frame = new frame({ url: "./city-info.html", onmes...
...sage: (e) => { up
dateweather(e.data); } }); var toolbar = toolbar({ name: "city-info", title: "city info", items: [frame] }); function up
dateweather(location) { frame.postmessage(weather[location], frame.url); } to listen to these messages in the frame script, add a listener to the window's message event: window.addeventlistener("message", up
dateweather, false); function up
dateweather(message) { var label = window.document.getelementbyid("weather"); label.textcontent = message.data; } from add-on to a specific frame you can send a message from the main add-on code to the frame hosted by a particular browser window.
cfx to jpm - Archive of obsolete content
to get new up
dates of cfx you download and extract a new zip file, while to get the new version of jpm, use npm up
date.
...for example: addons.mozilla.org uses it to distinguish between new add-ons and up
dates to existing add-ons, and the simple-storage module uses it to figure out which stored data belongs to which add-on.
Creating annotations - Archive of obsolete content
its main job is to maintain a matched element: this is the page element that is the current candi
date for an annotation.
... updating main.js again now we'll up
date main.js again to create the editor and use it.
Bookmarks - Archive of obsolete content
you can use the nsinavbookmarksservice.changebookmarkuri() method to up
date the uri for a given bookmark item: var uri = ios.newuri("http://mozilla.com/", null, null); bmsvc.changebookmarkuri(newbkmkid, uri); this example changes the bookmark to refer to the mozilla web site instead of google.
... // an nsinavbookmarkobserver var myext_bookmarklistener = { onbeginup
datebatch: function() {}, onendup
datebatch: function() {}, onitemadded: function(aitemid, afolder, aindex) {}, onitemremoved: function(aitemid, afolder, aindex) {}, onitemchanged: function(abookmarkid, aproperty, aisannotationproperty, avalue) { myextension.dosomething(); }, onitemvisited: function(abookmarkid, avisitid, time) {}, onitemmoved: function(aitemid, aoldparent, aoldindex,...
JavaScript timers - Archive of obsolete content
setimmediate() calls a function immediately after the browser has completed other operations, such as events and display up
dates.
...
date.now()
date.now() returns the number of milliseconds elapsed since 1 january 1970 00:00:00 utc.
Listening to events in Firefox extensions - Archive of obsolete content
pageshoweventhandlers the pageshoweventhandlers() function is called by the pageshow event and is used to populate the character set menu and up
date the ui elements associated with any detected feeds or opensearch plugins for the website.
...it is used to up
date the ui for many different reasons: up
date the progress bar and status messages as pages load turn on and off the throbber as pages load set the site icon when available up
date the address bar as the user navigates hide notification bars when appropriate as the user navigates apply the site zoom preferences to newly loading pages up
date the bookmarking star button ui up
date the identity display as the site's security changes tabsprogresslistener this object is a tabs progress listener and receives events for all browsers in the window.
Introduction - Archive of obsolete content
this tutorial was written after firefox 3 was released, and has been up
dated with time.
... while most of it should still work for creating extensions in firefox 3 (and even firefox 2), it is strongly recommended that you aim to support modern firefox versions, to encourage users to stay up to
date with security fixes.
checking - Archive of obsolete content
the checking event is fired when the user agent is checking for an up
date, or attempting to download the cache manifest for the first time.
... related events checking noup
date downloading progress cached up
dateready obsolete error ...
downloading - Archive of obsolete content
the downloading event is fired after checking for an application cache up
date, if the user agent has found an up
date and is fetching it, or is downloading the resources listed by the cache manifest for the first time.
... related events checking noup
date progress cached up
dateready obsolete error ...
Monitoring WiFi access points - Archive of obsolete content
the onchange() method (lines 13 through 27) begins by enabling universalxpconnect privileges, then clearing out the div (d) that will receive the up
dated list of access points.
...then the c div is up
dated with the number of times the list has been refreshed.
Notes on HTML Reflow - Archive of obsolete content
dirty, when a container frame has consoli
dated several individual incremental reflows that have been targeted at its child frames.
... original document information author(s): chris waterson last up
dated
date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Bookmark Keywords - Archive of obsolete content
any web site that you commonly search is a candi
date for its own keymark.
...meyer, netscape communications last up
dated
date: published 15 mar 2002 copyright information: copyright © 2001-2003 netscape.
Building TransforMiiX standalone - Archive of obsolete content
this document is out of
date.
... original document information author: axel hecht last up
dated
date: april 5, 2004 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license ...
Enabling the behavior - updating the status bar panel - Archive of obsolete content
in order for loadtinderboxstatus() to have any effect we need to define a matching up
datetinderboxstatus() function.
... function up
datetinderboxstatus() { var icon = document.getelementbyid('tinderbox-status'); if (gxmlhttprequest.responsetext.match("ee0000")) icon.setattribute("status", "busted"); else if (gxmlhttprequest.responsetext.match("ffaa00")) icon.setattribute("status", "testfailed"); else if (gxmlhttprequest.responsetext.match("11dd11")) icon.setattribute("status", "success"); else icon.setattribute("status", ""); } up
datetinderboxstatus() retrieves a reference to the statusbarpanel element then searches through the retrieved html document (stored in the responsetext property of the xmlhttprequest instance) for one of several color references.
Getting Started - Archive of obsolete content
skin\classic\mozapps mozapps contains all the styles and icons for the browser peripherals, such as the extension manager or up
date wizard.
...you will also have to up
date the minimum and maximum compatible versions for the target application (seamonkey) in the following section: <em:targetapplication> <description> <!-- seamonkey's uuid --> <em:id>{92650c4d-4b8e-4d2a-b7eb-24ecf4f6b63a}</em:id> <em:minversion>min_sm_version</em:minversion> <em:maxversion>max_sm_version</em:maxversion> </description> </em:targetapplication> estab...
Creating a Skin for Firefox/Getting Started - Archive of obsolete content
skin\classic\mozapps mozapps contains all the styles and icons for the browser peripherals, such as the extension manager or up
date wizard.
... you will also have to up
date the minimum and maximum compatible versions for the target application (firefox) in the following section: <em:targetapplication> <description> <!-- firefox's uuid --> <em:id>{ec8030f7-c20a-464f-9b0e-13a3a9e97384}</em:id> <em:minversion>min_ff_version</em:minversion> <em:maxversion>max_ff_version</em:maxversion> </description> </em:targetapplication> establi...
Editor Embedding Guide - Archive of obsolete content
(similar to "text" but html can be inserted; intended for plaintext mail usage and handling of citations) "html" (this is the default type if no type is specified; it allows for all html tags to be inserted) "htmlmail" (this is much like "html" except there are a few editing rules/behaviors that differ such as splitting of mail quotes) editor commands you need to call commands and receive up
dates in order to make any changes to the content on the browser.
... commandparam->getbooleanvalue("state_enabled",&boolval); original document information authors: michael judge (mjudge@netscape.com) contributor: kathleen brade (brade@netscape.com) last up
dated
date: march 27, 2003 original document: a guide to embedding the gecko editor ...
Java in Firefox Extensions - Archive of obsolete content
note: the global java object has been removed in gecko 16.0, so this page is out of
date.
...the following approach is taken from the extension xquseme (note you must use the latest version, currently still in the sandbox, as prior versions only worked with liveconnect before java 6 up
date 11) which borrows some of the code of the java firefox extension in order to grant full privileges to java within a firefox extension, but it is easier to understand and doesn't require creation of a xpcom component.
Mozilla Application Framework - Archive of obsolete content
lxr a web interface to the mozilla codebase that shows you every file in the repository as well as a line-by-line breakdown of who changed which line when in each file bonsai a web interface to the checkin log that you can query for checkins between certain
dates, of certain files, or by certain developers.
... original document information author(s): myk melez last up
dated
date: march 3, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Plug-n-Hack Get Involved - Archive of obsolete content
while this project has been started by the mozilla security team and has been vali
dated with firefox and owasp zap, this is an open project and we welcome involvement from anyone, especially people working on other browsers and security tools.
...to contribute or keep up to
date with plug-n-hack changes please joion the mozilla plug-n-hack google group.
Priority Content - Archive of obsolete content
up
date: i've removed documents from this list that have been migrated into the wiki.
... original: rich-text editing in mozilla 1.3 wiki location: rich-text editing in mozilla i dropped the 1.3, as the article still applies and shouldn't sound out
dated.
Hacking wiki - Archive of obsolete content
to configure it, run <tt>up
date-devmo.php</tt> from the command line.
... the following worked for me (from the <tt>www</tt> directory): /path/to/php -f ./maintenance/up
date-devmo.php done you should have a working install of the mdc wiki now.
Frequently Asked Questions - Archive of obsolete content
note: this page is extremely out of
date.
... original document information author(s): jonathan watt last up
dated
date: november 6, 2006 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Space Manager Detailed Design - Archive of obsolete content
if the collection is too small, then an error is returned and the count is up
dated to indicate the size required.
... cross-component algorithms tech notes original document information author(s): marc attinasi other contributors: david baron, josh soref last up
dated
date: november 25, 2005 ...
Table Cellmap - Archive of obsolete content
the current solution is to use nscellmap::getdataat with a special argument aup
datezerospan to repair the cellmap if it encounters a empty cell (nsnull), by looking for a origin of a zero row- or colspan that spans the queried place in the cellmap.
... original document information author(s): bernd mielke last up
dated
date: september 27, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
The new nsString class implementation (1999) - Archive of obsolete content
the i18n team correctly points out that that anarchy will prevail if judicious control over their use is not man
dated.
... original document information author: rick gessner last up
dated
date: january 20, 1999 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Elements - Archive of obsolete content
note: prior to firefox 3, the constructor could be called at a time when reflow of the document layout was locked down, so that attempting to get layout information from within the constructor could return out of
date information.
... in firefox 3 and later, the constructor is called when reflow can take place, which results in up-to-
date information being returned.
XBL 1.0 Reference - Archive of obsolete content
ints <children> handling dom changes event flow and targeting flow and targeting across scopes focus and blur events mouseover and mouseout events anonymous content and css selectors and scopes binding stylesheets binding implementations introduction methods properties inheritance of implementations event handlers example - sticky notes up
dated and adjusted for the current firefox implementation.
... notes.html notes.xml notes.css view this example download all files (.zip archive) need to ask to adjust the server - it gives "access denied" for zip files (?) references initial xbl 1.0 proposal submitted as a note to w3c (does not reflect mozilla implementation, nor future plans) xbl 2.0 project original document information last up
dated
date: april 24, 2006 ...
XBL - Archive of obsolete content
hopefully, the reference will be up
dated to describe those differences.
... xbl 2.0 (w3c candi
date recommendation) was developed to address problems found in xbl 1.0 and to allow for implementations in a broader range of web browsers.
Windows Install - Archive of obsolete content
rpath); // convert the available disk space into kilobytes spaceavailable = parseint(spaceavailable / 1024); // do the verification if(spaceavailable < spacerequired) { logcomment("insufficient disk space: " + dirpath); logcomment(" required : " + spacerequired + " k"); logcomment(" available: " + spaceavailable + " k"); return(false); } return(true); } function up
datewinreg4ren8dot3() { var fprogram = getfolder("program"); var ftemp = getfolder("temporary"); //notes: // can't use a double backslash before subkey // - windows already puts it in.
...ot3ini != null) { for(i = 0; i < listlongfilepaths.length; i++) { flongfilepath = getfolder(fprogram, listlongfilepaths[i]); sshortfilepath = file.windowsgetshortname(flongfilepath); if(sshortfilepath) { fren8dot3ini.writestring("rename", sshortfilepath, flongfilepath); binicreated = true; } } if(binicreated) up
datewinreg4ren8dot3() ; } return(0); } // main var srdest; var err; var fprogram; srdest = 449; err = initinstall(prettyname, regname, "6.0.0.2000110801"); logcomment("initinstall: " + err); fprogram = getfolder("program"); logcomment("fprogram: " + fprogram); if(verifydiskspace(fprogram, srdest)) { setpackagefolder(fprogram); err = adddirectory("", "6.0.0.2000110801", "bin", // di...
Methods - Archive of obsolete content
mod
date returns a number representing the last modified
date of the given file.
... mod
datechanged specifies whether the last modification on a file is older than a specified
date move moves a file from one location to another.
addDirectory - Archive of obsolete content
name, string xpisourcepath, object localdirspec, string relativelocalpath); public int adddirectory ( string registryname, string version, string xpisourcepath, object localdirspec, string relativelocalpath); public int adddirectory ( string registryname, string version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceup
date); public int adddirectory ( string registryname, installversion version, string xpisourcepath, object localdirspec, string relativelocalpath, boolean forceup
date); parameters the adddirectory method has the following parameters: registryname the pathname in the client version registry for the root directory of the files that are to be installed.this parameter ca...
... xpisourcepath a string specifying the location of the directory within the xpi file.an empty string ("") causes the creation of a subdirectory node in the registry without actually unpacking any files, which may be useful when you are updating a package that contains subcomponents that could also be up
dated separately.
patch - Archive of obsolete content
summary up
dates an existing component.
... description the patch method to up
date an existing component by applying a set of differences between two known versions.
XPInstall API reference - Archive of obsolete content
file getwinregistry initinstall loadresources logcomment patch performinstall refreshplugins registerchrome reseterror setpackagefolder installtrigger no properties methods compareversion enabled getversion install installchrome startsoftwareup
date installversion properties methods compareto init tostring file no properties methods copy dircreate dirgetparent dirremove dirrename diskspaceavailable execute exists isdirectory isfile macalias mod
date mod
datechanged ...
... setrootkey setvalue setvaluenumber setvaluestring valueexists winregvalue constructor other information return codes see complete list examples trigger scripts and install scripts code samples file.macalias file.windowsshortcut install.adddirectory install.addfile installtrigger.installchrome installtrigger.startsoftwareup
date windows install ...
A XUL Bestiary - Archive of obsolete content
the w3c has standardized on a particular dom and already has a candi
date recommendation for an up
dated version.
...these three cross-platform glue technologies fit in the middle of an architecture that looks something like this: author: ian oeschger other documents: mozilla jargon file and introduction to xul original document information author(s): ian oeschger last up
dated
date: april 16, 2000 copyright information: copyright (c) ian oeschger ...
disableautoselect - Archive of obsolete content
« xul reference home disableautoselect type: boolean if this attribute is true or omitted, the selected item on the menu will up
date to match what the user entered in the textbox.
...if this attribute is false, the selection is never up
dated to match the text box.
events - Archive of obsolete content
« xul reference home events type: comma-separated list a comma-separated list of event names that the command up
dater will up
date upon.
...you can send a custom event by calling the up
datecommands method of the command dispatcher.
sizemode - Archive of obsolete content
note: when a window is minimized, the sizemode attribute is not up
dated.
... issues with this attribute (at least on firefox 3): sizemode is only up
dated when the value of the persist attribute on the root element (such as <window>) contains sizemode.
targets - Archive of obsolete content
« xul reference home targets type: comma-separated list of element ids a comma-separated list of element ids that the command up
dater will up
date upon.
...the command up
date will only occur when the event occurs to one of the specified elements.
Building accessible custom components in XUL - Archive of obsolete content
axspreadsheet" flex="1"> <rows flex="1"></rows> <columns flex="1"> <column> <description value="entry #"/> <description value="1"/> <description value="2"/> <description value="3"/> <description value="4"/> <description value="5"/> <description value="6"/> <description value="7"/> </column> <column flex="1"> <description value="
date"/> <label value="03/14/05" flex="1"/> <label value="03/15/05" flex="1"/> <label value="03/15/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> <label value="03/16/05" flex="1"/> </column> <column flex="1"> <description value="expense"/> <label value="conference fee" ...
...value="2"/> <description x2:role="wairole:rowheader" value="3"/> <description x2:role="wairole:rowheader" value="4"/> <description x2:role="wairole:rowheader" value="5"/> <description x2:role="wairole:rowheader" value="6"/> <description x2:role="wairole:rowheader" value="7"/> </column> <column flex="1"> <description x2:role="wairole:columnheader" value="
date"/> <label x2:role="wairole:gridcell" value="03/14/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/15/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/15/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05" flex="1"/> <label x2:role="wairole:gridcell" value="03/16/05"...
Deprecated and defunct markup - Archive of obsolete content
even some of the information on the tags below may be out of
date, but is provided here for historical reference and to help anyone who comes across them in old code or documentation.
...nal name for the ancestor <treechildren> element --neil 03 march 2011 <treecaption> (old/experimental and unsupported xul tags) <treecolgroup> (former name for <treecols> <treecolpicker> (internal use only; part of xbl for <tree>) <treefoot> (old/experimental and unsupported xul tags) <treeindentation> (old/experimental and unsupported xul tags) was a part of the old <tree> that pre
dated <outliner> that was not converted to <listbox>--neil 03 march 2011 <treeicon> (old/experimental and unsupported xul tags) <treerows> (internal use only; part of xbl for <tree>) attributes @debug="true" provided struts and springs around boxes to facilitate identification of flex issues but does not seem to work now you need a special debug_layout build --neil 03 march 2011 referen...
insertItemAt - Archive of obsolete content
note: you cannot insert an item to an index that does not exist, eg: trying to insert an item at the end with element.getrowcount() + 1 example <!-- this example inserts at the selected item or appends, then selects the newly created item --> <script language="javascript"> function insertitemtolist(){ var mylistbox = document.getelementbyid('mylistbox'); // create a
date to get some labels and values var some
date = new
date(); if(mylistbox.selectedindex == -1){ // no item was selected in list so append to the end mylistbox.appenditem( some
date.tolocaletimestring(), some
date.gettime() ); var newindex = mylistbox.getrowcount() -1 }else{ // item was selected so insert at the selected item var newindex = mylistbo...
...x.selectedindex; mylistbox.insertitemat(newindex, some
date.tolocaletimestring(), some
date.gettime()); } // select the newly created item mylistbox.selectedindex = newindex; } </script> <button label="insert item at selected" oncommand="insertitemtolist()"/> <listbox id="mylistbox"> <listitem label="foo"/> </listbox> see also appenditem() removeitemat() ...
PopupEvents - Archive of obsolete content
<panel id="time-panel" onpopupshowing="this.lastchild.value = (new
date()).tolocaleformat('%t')"> <label value="time:"/> <label id="time"/> </panel> <toolbarbutton label="show time" popup="time-panel"/> you can prevent a menu or popup from appearing by calling the preventdefault method of the event from within a popupshowing listener.
...the popupshown event will be fired when the ui is up
dated and the popup is visible.
Building Trees - Archive of obsolete content
here is an example (using an rdf source): <tree id="photoslist" flex="1" datasources="template-guide-photos5.rdf" ref="http://www.xulplanet.com/rdf/myphotos" flags="dont-build-content"> <treecols> <treecol id="name" label="name" flex="1"/> <treecol id="
date" label="
date" flex="1"/> </treecols> <template> <treechildren> <treeitem uri="rdf:*"> <treerow> <treecell label="rdf:http://purl.org/dc/elements/1.1/title"/> <treecell label="rdf:http://purl.org/dc/elements/1.1/
date"/> </treerow> </treeitem> </treechildren> </template> </tree> note: the tree columns (treecols) are declared outside ...
...here is an example of a tree using an sqlite datasource: <tree datasources="profile:messages.sqlite" ref="*" querytype="storage" flags="dont-build-content"> <treecols> <treecol id="subject" label="subject" flex="3"/> <treecol id="sender" label="sender" flex="2"/> <treecol id="
date" label="
date" flex="1"/> </treecols> <template> <query> select subject, sender,
date from messages </query> <action> <treechildren> <treeitem uri="?"> <treerow> <treecell label="?subject"/> <treecell label="?sender"/> <treecell label="?
date"/> </treerow> </treeitem> </treechildren> </acti...
Textbox (XPFE autocomplete) - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
...a listener for the command event should up
date search results.
Custom Tree Views - Archive of obsolete content
the following example shows this: <tree id="my-tree" flex="1"> <treecols> <treecol id="namecol" label="name" flex="1"/> <treecol id="
datecol" label="
date" flex="1"/> </treecols> <treechildren/> </tree> to assign data to be displayed in the tree, the view object needs to be created which is used to indicate the value of each cell, the total number of rows plus other optional information.
... getimagesrc: function(row,col){ return null; }, getrowproperties: function(row,props){}, getcellproperties: function(row,col,props){}, getcolumnproperties: function(colid,col,props){} }; function setview(){ document.getelementbyid('my-tree').view = treeview; } </script> <tree id="my-tree" flex="1"> <treecols> <treecol id="namecol" label="name" flex="1"/> <treecol id="
datecol" label="
date" flex="1"/> </treecols> <treechildren/> </tree> </window> in the image, you can see two columns, each with data taken from the getcelltext() function.
Focus and Selection - Archive of obsolete content
typically, you will use focus and blur events to up
date parts of the interface as the user selects elements.
... for instance, you might up
date a total as the user enters values in other fields, or use focus events to vali
date certain values.
Localization - Archive of obsolete content
<tabpanel id="searchpanel" orient="vertical" context="editpopup"> <description> &finddescription; </description> <spacer class="titlespace"/> <groupbox orient="horizontal"> <caption label="&findcriteria;"/> <menulist id="searchtype"> <menupopup> <menuitem label="&type.name;"/> <menuitem label="&type.size;"/> <menuitem label="&type.
date;"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="searchmode"> <menupopup> <menuitem label="&mode.is;"/> <menuitem label="&mode.isnot;"/> </menupopup> </menulist> <spacer class="springspace"/> <menulist id="find-text" flex="1" editable="true" datasources="file:///mozilla/recents.rdf" ...
...andkey "c"> <!entity pastecmd.commandkey "v"> <!entity opencmdtoolbar.label "open"> <!entity savecmdtoolbar.label "save"> <!entity searchtab "search"> <!entity optionstab "options"> <!entity finddescription "enter your search criteria below and select the find button to begin the search."> <!entity findcriteria "search criteria"> <!entity type.name "name"> <!entity type.size "size"> <!entity type.
date "
date modified"> <!entity mode.is "is"> <!entity mode.isnot "is not"> <!entity casesensitive "case sensitive search"> <!entity matchfilename "match entire filename"> <!entity results.filename "filename"> <!entity results.location "location"> <!entity results.size "size"> <!entity bytes.before ""> <!entity bytes.after "bytes"> <!entity button.find "find"> <!entity button.cancel "cancel"> now, to...
Modifying a XUL Interface - Archive of obsolete content
example 7 : source view <script> function up
datestate(){ var name = document.getelementbyid("name"); var sindex = document.getelementbyid("group").selectedindex; name.disabled = sindex == 0; } </script> <radiogroup id="group" onselect="up
datestate();"> <radio label="random name" selected="true"/> <hbox> <radio label="specify a name:"/> <textbox id="name" value="jim" disabled="true"/> </hbox> </radiogroup> in this example a...
... function up
datestate() is called whenever a select event is fired on the radio group.
More Event Handlers - Archive of obsolete content
here is an example which displays the current mouse coordinates: example 4 : source view <script> function up
datemousecoordinates(e){ var text = "x:" + e.clientx + " y:" + e.clienty; document.getelementbyid("xy").value = text; } </script> <label id="xy"/> <hbox width="400" height="400" onmousemove="up
datemousecoordinates(event);"/> in this example, the size of the box has been set explicitly so the effect is easier to see.
...note that the event argument must be passed to the up
datemousecoordinates function.
Skinning XUL Files by Hand - Archive of obsolete content
software components and users will be able to up
date the chrome registry and change the global skin.
... original document information author(s): ian oeschger last up
dated
date: october 3, 2004 copyright information: copyright (c) ian oeschger ...
Using Remote XUL - Archive of obsolete content
dding the menu bar into the pages; (we can use xbl to embed xul into html pages to get around the limitations of iframes.) integrating the search function into the menu bar so you don't have to go to a separate page to use it; hiding the html-based navigation for users who can see the xul-based navigation; storing the menu structure and items in a remote rdf datasource to make them easier to up
date and reuse.
... original document information last up
dated
date: december 7, 2002 ...
XUL Questions and Answers - Archive of obsolete content
some of them can be tied to a preference so that the preference is automatically up
dated as the control is manipulated.
... others, like <listbox>, cannot be so tied, but one can always write a script that up
dates preferences explicitly, via nsiprefbranch interface.
XUL Reference - Archive of obsolete content
« xul reference « alphabetical list of all xul elements action arrowscrollbox assign bbox binding bindings box broadcaster broadcasterset button browser checkbox caption clicktoscroll colorpicker column columns commandset command conditions content
datepicker deck description dialog dialogheader dropmarker editor grid grippy groupbox hbox iframe image key keyset label listbox listcell listcol listcols listhead listheader listitem member menu menubar menuitem menulist menupopup menuseparator notification notificationbox observes overlay page panel param popupset preference preferences prefpane prefwindow progressmeter query queryset radio radiogroup resizer richlistbox richlistitem row rows rule scale scri...
...zer statusbar statusbarpanel dialogheader notification notificationbox menubar menu menuitem menuseparator menupopup panel tooltip popupset toolbar toolbarbutton toolbargrippy toolbaritem toolbarpalette toolbarseparator toolbarset toolbarspacer toolbarspring toolbox tabbox tabs tab tabpanels tabpanel groupbox caption separator spacer button checkbox colorpicker
datepicker menulist progressmeter radio radiogroup scale splitter textbox textbox (firefox autocomplete) textbox (mozilla autocomplete) timepicker description label image listbox listitem listcell listcol listcols listhead listheader richlistbox richlistitem tree treecell treechildren treecol treecols treeitem treerow treeseparator box hbox vbox bbox deck stack gri...
image - Archive of obsolete content
attributes onerror, onload, src, vali
date properties accessibletype, src style classes alert-icon, error-icon, message-icon, question-icon examples <image src='firefoxlogo.png' width='135' height='130'/> attributes onerror type: script code this event is sent to an image element when an error occurs loading the image.
... vali
date type: one of the values below this attribute indicates whether to load the image from the cache or not.
preference - Archive of obsolete content
visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
... void up
dateelements(); up
date all elements that observe this preference.
splitter - Archive of obsolete content
this attribute will be up
dated automatically as the splitter is moved, and is generally used in a stylesheet to apply a different appearance for each state.
... <tree id="tree1" flex="1" height="300" enablecolumndrag="true"> <treecols> <treecol id="name" label="name" flex="1"/> <splitter class="tree-splitter"/> <treecol id="id" label="id" flex="1"/> <splitter class="tree-splitter"/> <treecol id="
date" label="
date" flex="1"/> <splitter class="tree-splitter"/> </treecols> <treechildren/> </tree> splitter resizing and overflow the degree to which a splitter will resize a box, and what happens during the resize and after the limit is reached, depends on the height (or width) specified for the box as an attribute or in css, the min-height (or min-width), the intrinsic height of the box ...
toolbar - Archive of obsolete content
the value is up
dated automatically by the toolbar customization dialog.
...be careful, as setting this property doesn't automatically up
date the currentset attribute.
tree - Archive of obsolete content
however, the content view will automatically up
date the tree if treeitems are changed.
... visible controls have a disabled property which, except for menus and menuitems, is normally preferred to use of the attribute, as it may need to up
date additional state.
CommandLine - Archive of obsolete content
for the sake of simplicity, the proposed solution involves the observer service to notify observers that the up
dated arguments are available.
...</window> original document information author: georges-etienne legendre last up
dated
date: august 21st, 2007 ...
application/http-index-format specification - Archive of obsolete content
last-modified rfc 1123
date format url encoded.
...: 200: filename content-length content-type file-type last-modified 201: foo.txt 512 text/plain file tue,%2015%20nov%201994%2008:12:31%20gmt 201: bar.html 9683 text/html file tue,%2025%20oct%201994%2008:12:31%20gmt 201: foobar 0 application/http-index-format directory tue,%2025%20oct%201994%2008:12:31%20gmt original document information author(s): christian biesinger last up
dated
date: may 10, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla.dev.apps.firefox-2006-09-29 - Archive of obsolete content
summary: mozilla.dev.apps.firefox - september 22-29, 2006 announcements bon echo 20060921 nightly to recieve "major up
date" offer mike beltnzer announced that 'users running the bon echo 20060921 nightly build will be offered the chance to upgrade to a "new version"' firefox start up performance boris zbarsky recently performed some profiling of firefox's start up - these are some of the details discussions problem handling dmg files on mac discussion about why sometimes dmg files are not mounted correctly after they are downloaded.
... firefox 2 on windows vista discussion about the "state of affairs" of firefox 2 on windows vista rc1 - up
date for rc1 listed in up
date history as 'install pending' right-click "copy email address" - bug 353102 a proposed bug fix to the 'copy email address' bug how to use the rss feeds discovery & parsing tool in another open source project?
2006-09-29 - Archive of obsolete content
up
dated l10n status for sunbird 0.3 release according to simon paquet, we now have a full l10n comparison on the trunk between en-us and all locales with a calendar localization.
...27, the meeting was cancelled and rescheduled for a later
date.
2006-09-29 - Archive of obsolete content
summary: mozilla.dev.apps.firefox - september 22-29, 2006 announcements bon echo 20060921 nightly to recieve "major up
date" offer mike beltnzer announced that 'users running the bon echo 20060921 nightly build will be offered the chance to upgrade to a "new version"' firefox start up performance boris zbarsky recently performed some profiling of firefox's start up - these are some of the details discussions problem handling dmg files on mac discussion about why sometimes dmg files are not mounted correctly after they are downloaded.
... firefox 2 on windows vista discussion about the "state of affairs" of firefox 2 on windows vista rc1 - up
date for rc1 listed in up
date history as 'install pending' right-click "copy email address" - bug 353102 a proposed bug fix to the 'copy email address' bug how to use the rss feeds discovery & parsing tool in another open source project?
2006-11-24 - Archive of obsolete content
discussions microsummary w/ script a user created patch that will allow script to run in a sandbox during the up
date of a microsummary.
... trunk builds + winxp up
date = broken?
2006-10-06 - Archive of obsolete content
a: robert helmer pointed out the mozilla.org's config file could be found here and to look for -->mozconfig<---------------------------------------- -->end mozconfig<---------------------------------------- up
dated: developer documentation issues for thunderbird 2 eric shepherd has requested feedback for any developer documentation issues that might need dealing with for thunderbird 2.
... up
dated : need ui to rearrange tags peter lairo suggested some ui should be available for rearranging tags.
2006-10-27 - Archive of obsolete content
up
date-packaging october 27: atachi.hayash wanted to know if you use msys would up
date-packaging work.
... click here to view the errorthat he receives when trying to up
date-packaging.
2006-10-27 - Archive of obsolete content
up
date check failing in firefox 2.0 if add-on type is 8 testing a custom up
date.rdf file for a langpack using the official version of firefox 2.0 rc 3.
... alternative german locale while the alternative locale is active, the auto up
date of firefox stops working.
2006-10-06 - Archive of obsolete content
summary: mozilla.dev.quality - september 30-october 6, 2006 announcements firefox 2 rc2 up
date - the minimum tests for rc2 are complete which includes smoke and bft tests.
...up
date checker was run; all failures found were expected.
NPEvent - Archive of obsolete content
values: 0 nullevent 1 mousedown 2 mouseup 3 keydown 4 keyup 5 autokey 6 up
dateevt 7 diskevt 8 activateevt 15 osevt 23 khighlevelevent getfocusevent 0, 1 (true, false) losefocusevent adjustcursorevent 0, 1 (true, false) for information about these events, see the mac os developer documentation.
... up
date events: sent if the up
date region intersects the instance's bounds.
NPRect - Archive of obsolete content
description nprect defines the bounding box of the area of the plug-in window to be up
dated, painted, invali
dated, or clipped to.
... see also npn_forceredraw() npn_invali
daterect() npn_invali
dateregion() npregion npwindow ...
NPAPI plugin reference - Archive of obsolete content
npn_invali
daterect invali
dates the specified portion of the plugin's drawing area, adding it to the region that needs to be redrawn when the plugin next repaints its contents.
... npn_invali
dateregion invali
dates the specified drawing region prior to repainting or refreshing a windowless plug-in.
Adobe Flash - Archive of obsolete content
this document is out of
date.
...when information about when this problem on mac os x will be addressed becomes available, the constant can be up
dated to reflect something less arbitrary.
Why RSS Content Module is Popular - Including HTML Contents - Archive of obsolete content
an example using the most popular element of the rss content module is shown below: <?xml version="1.0"?> <rss version="2.0" xmlns:content="http://purl.org/rss/1.0/modules/content/" > <channel> <title>example</title> <description>an rss example with slash</description> <lastbuild
date>sun, 15 may 2005 13:02:08 -0500</lastbuild
date> <link>http://www.example.com</link> <item> <title>a link in here</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/114</guid> <pub
date>sun, 15 may 2005 13:02:08 -0500</pub
date> <link>http://www.example.com/blog/2005/05/15/114</link> <content...
...:encoded><![cdata[this is a <a href="http://example.com/">link</a>.]]></content:encoded> </item> <item> <title>some italics html</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</guid> <pub
date>sun, 15 may 2005 10:55:12 -0500</pub
date> <link>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/113</link> <content:encoded><![cdata[this is <i>italics</i>.]]></content:encoded> </item> <item> <title>some bold html</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:2005/05/15/112</guid> <pub
date>sun, 15 may 2005 08:14:11 -0500</pub
date> <link>http://www.example.com/blog/2005/05/15/112</link> <c...
Why Well-Formed Web RSS Module is Popular - Syndicating Your Comments - Archive of obsolete content
an example using the most popular element of the well-formed web rss module is shown below: <?xml version="1.0"> <rss version="2.0" xmlns:wfw="http://wellformedweb.org/commentapi/" > <channel> <title>example</title> <description>an rss example with wfw</description> <lastbuild
date>sun, 15 may 2005 13:02:08 -0500</lastbuild
date> <link>http://www.example.com</link> <item> <title>i like root beer</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54321</guid> <pub
date>sun, 15 may 2005 13:02:08 -0500</pub
date> <link>http://www.example.com/article/54321</link> <wfw:commentrss>http://www.example.com/feed/rss/54321/comments</wfw:commentrss> </item> ...
... <item> <title>rain is wet</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54320</guid> <pub
date>sun, 15 may 2005 10:55:12 -0500</pub
date> <link>http://www.example.com/article/54320</link> <wfw:commentrss>http://www.example.com/feed/rss/54320/comments</wfw:commentrss> </item> <item> <title>huh?!</title> <guid>d77d2e80-0487-4e8c-a35d-a93f12a0ff7d:article:54319</guid> <pub
date>sun, 15 may 2005 08:14:11 -0500</pub
date> <link>http://www.example.com/article/54319</link> <wfw:commentrss>http://www.example.com/feed/rss/54319/comments</wfw:commentrss> </item> </channel> </rss> the <wfw:commentrss> element is the reason that the well-formed web rss module is popular.
Security Controls - Archive of obsolete content
department of commerce title: federal information processing standard publication 200, minimum security requirements for federal information and information systems last up
dated
date: march 2006 copyright information: this document is not subject to copyright.
... original document information author(s): karen scarfone, wayne jansen, and miles tracy title: nist special publication 800-123, guide to general server security last up
dated
date: july 2008 copyright information: this document is not subject to copyright.
Common Firefox theme issues and solutions - Archive of obsolete content
this guide will help you thoroughly test your theme to find and fix issues before you push up
dates to amo.
... mozillazine firefox nightly theme changes thread mozillazine's firefox nightly theme changes thread is a great resource for keeping up to
date with the latest changes to the firefox ui and contains links to the bugzilla bug reports, which detail what changes were made.
Theme changes in Firefox 3.5 - Archive of obsolete content
this article covers the changes that need to be made to up
date a firefox theme to work properly in firefox 3.5.
... core, browser and toolkit changes requiring theme up
dates there are a number of changes in the browser that may require you to make changes to your theme.
Developing cross-browser and cross-platform pages - Archive of obsolete content
as new browsers are released, it becomes necessary to make up
dates to such code which attempts to narrow down the browser and browser version and to make the appropriate switches.
... more on object/feature support detection: a strategy that works: object/feature detecting by comp.lang.javascript newsgroup faq notes browser detection - no; object detection - yes by peter-paul koch also good http://developer.mozilla.org/docs...rowser_support but out
dated in my opinion ...
Browser Feature Detection - Archive of obsolete content
therefore, given that it's also badly out of
date, it's been archived.
...port(document.body.style, 'domcss1', 'document.body.style'); generatereport(document.body.style, 'domcss2', 'document.body.style'); window.onerror = oldonerror; see also browser detection and cross browser support comparison of layout engines web specifications supported in opera 9 what's new in internet explorer 7 (script) original document information author(s): (unknown) last up
dated
date: up
dated march 16, 2003 copyright information: copyright © 2001-2003 netscape.
New in JavaScript 1.7 - Archive of obsolete content
javascript 1.7 is a language up
date introducing several new features, in particular generators, iterators, array comprehensions, let expressions, and destructuring assignment.
...in more recent firefox versions, the implementation is up
dated to work with semantics as specified in ecmascript edition 6.
New in JavaScript 1.8.5 - Archive of obsolete content
bug 510537
date.prototype.tojson() returns a json format string for a
date object.
... changed functionality in javascript 1.8.5 iso 8601 support in
date: the
date object's parse() method now supports simple iso 8601 format
date strings.
LiveConnect - Archive of obsolete content
documentation java plugin - liveconnect documentation this is likely the most up-to-
date documentation of liveconnect.
... mailing list newsgroup rss feed related topics javascript, plugins older notes (please up
date or remove as needed.) while the bloated liveconnect code in the mozilla source was removed in version 1.9.2 of the platform (see bug 442399), its former api has been restored (see also the specification and this thread) (building on npapi?), and as of java 6 up
date 12, extensions as well as applets can make use of this restored api.
XForms Output Element - Archive of obsolete content
calendar - used to represent instance data of type
date (xhtml/xul).
...characteristics the bound instance node is of type xsd:
date or a type derived from it in addition, the appearance attribute must also contain the value "full" firefox 2.0 doesn't currently have any similar widgets available for use with xhtml or xul.
XForms Range Element - Archive of obsolete content
type restrictions the range element can be bound to a node of type xsd:duration, xsd:
date, xsd:time, xsd:
datetime, xsd:gyearmonth, xsd:gyear, xsd:gmonthday, xsd:gday, xsd:gmonth, xsd:float, xsd:decimal or xsd:double or any type derived from one of these.
...characteristics analogous widget is <xul:scale/>, which is available in fx 3.0 only if the incremental attribute has the value true, the value of the bound node will be up
dated upon each movement of the slider's thumb.
RDF in Mozilla FAQ - Archive of obsolete content
statements about the same rdf resource can then be intermingled: for example, the "last visit
date" of a particular website comes from the "browser global history" datasource, and the "shortcut keyword" that you can type to reach that website comes from the "browser bookmarks" datasource.
... contributors examples section added 2002-07-02 by danbri thanks to myk melez for notes on remote xul / security policy author: chris waterson original document information author(s): chris waterson last up
dated
date: december 22, 2004 copyright information: copyright (c) chris waterson ...
The Business Benefits of Web Standards - Archive of obsolete content
happier staff good developers - both agency and inhouse - simply do not want to work using out
dated methodologies and platforms with uncertain standards, with all the consequent uncertainty in quality.
... man
dated accessibility being accessible is mandatory in many countries for government agencies (us, uk, canada), and --in some countries like australia-- for every organization.
Common causes of memory leaks in extensions - Extensions
failing to clean up event listeners extensions can be disabled and removed by user actions, but it also happens when an add-on is up
dated.
...when your add-on gets up
dated and re-enabled, the previous module version that is still loaded will be used, which might break your add-on entirely.
Game distribution - Game development
instant up
dates you don't have to wait several days to have your game's code up
dated.
... if your user finds a bug, you can quickly fix it, up
date the system and refresh the game on your server to provide players with the up
dated code almost instantly.
Bounce off the walls - Game development
add this to your code, somewhere below the existing variable declarations: var ballradius = 10; now up
date the line that draws the ball inside the drawball() function to this: ctx.arc(x, y, ballradius, 0, math.pi*2); bouncing off the top and bottom there are four walls to bounce the ball off — let's focus on the top one first.
...up
date the last code you added to this: if(x + dx > canvas.width-ballradius || x + dx < ballradius) { dx = -dx; } if(y + dy > canvas.height-ballradius || y + dy < ballradius) { dy = -dy; } when the distance between the center of the ball and the edge of the wall is exactly the same as the radius of the ball, it will change the movement direction.
Track the score and win - Game development
add the following into your javascript, after the rest of your variables: var score = 0; you also need a drawscore() function, to create and up
date the score display.
...for(var r=0; r<brickrowcount; r++) { var b = bricks[c][r]; if(b.status == 1) { if(x > b.x && x < b.x+brickwidth && y > b.y && y < b.y+brickheight) { dy = -dy; b.status = 0; score++; } } } } } calling drawscore() from the draw() function keeps the score up to
date with every new frame — add the following line inside draw(), just below the drawpaddle() call: drawscore(); displaying a winning message when all bricks have been destroyed collecting the points works well, but you won't be adding them forever — what about when all the bricks have been destroyed?
Animations and tweens - Game development
applying the animation when the ball hits the paddle in the arcade.collide() method call that handles the collision between the ball and the paddle (the first line inside up
date(), see below) we can add an extra parameter that specifies a function to be executed every time the collision happens, in the same fashion as the ballhitbrick() function.
... up
date the first line inside up
date() as shown below: function up
date() { game.physics.arcade.collide(ball, paddle, ballhitpaddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); paddle.x = game.input.x || game.world.width*0.5; } then we can create the ballhitpaddle() function (having ball and paddle as default parameters), playing the wobble animation when it is called.
Physics - Game development
add the following line, again at the bottom of create(): ball.body.velocity.set(150, 150); removing our previous up
date instructions remember to remove our old method of adding values to x and y from the up
date() function: function up
date() { ball.x += 1; ball.y += 1; } we are now handling this properly, with a physics engine.
... game.scale.pagealignhorizontally = true; game.scale.pagealignvertically = true; game.stage.backgroundcolor = '#eee'; game.load.image('ball', 'img/ball.png'); } function create() { game.physics.startsystem(phaser.physics.arcade); ball = game.add.sprite(50, 50, 'ball'); game.physics.enable(ball, phaser.physics.arcade); ball.body.velocity.set(150, 150); } function up
date() { } try reloading index.html again — the ball should now be moving constantly in the given direction.
The score - Game development
updating the score when bricks are destroyed we will increase the number of points every time the ball hits a brick and up
date the scoretext to display the current score.
... this can be done using the settext() method — add the two new lines seen below to the ballhitbrick() function: function ballhitbrick(ball, brick) { brick.kill(); score += 10; scoretext.settext('points: '+score); } that's it for now — reload your index.html and check that the score up
dates on every brick hit.
Endianness - MDN Web Docs Glossary: Definitions of Web-related terms
little-endian means storing bytes in order of least-to-most-significant (where the least significant byte takes the first or lowest address), comparable to a common european way of writing
dates (e.g., 31 december 2050).
... naturally, big-endian is the opposite order, comparable to an iso
date (2050-12-31).
JSON - MDN Web Docs Glossary: Definitions of Web-related terms
json does not natively represent more complex data types like functions, regular expressions,
dates, and so on.
... (
date objects by default serialize to a string containing the
date in iso format, so the information isn't completely lost.) if you need json to represent additional data types, transform values as they are serialized or before they are deserialized.
OTA - MDN Web Docs Glossary: Definitions of Web-related terms
all device owners receiving a given set of up
dates are on the same "channel", and each device often can access several channels (e.g.
... learn more general knowledge over-the-air programming on wikipedia creating and applying firefox os up
date packages ...
RSS - MDN Web Docs Glossary: Definitions of Web-related terms
rss (really simple syndication) refers to several xml document formats designed for publishing site up
dates.
... when you subscribe to a website's rss feed, the website sends information and up
dates to your rss reader in an rss document called a feed, so you don't need to check all your favorite websites manually.
WebDAV - MDN Web Docs Glossary: Definitions of Web-related terms
webdav (web distributed authoring and versioning) is an http extension that lets web developers up
date their content remotely from a client.
...author or creation
date) link pages of any media type to related pages create sets of documents and retrieve hierarchical list copy and move webpages lock a document from being edited by more than one person at a time learn more general knowledge webdav on wikipedia technical reference rfc 2518 rfc 3253 rfc 3744 ...
Mobile accessibility - Learn web development
it is also worth considering the use of html5 form input types such as the
date on mobile platforms as they handle them well — both android and ios, for example, display usable widgets that fit well with the device experience.
... types time and
date display suitable pickers for selecting times and
dates.
Accessible multimedia - Learn web development
last of all, add the following to the end of the code, to control the time elapsed display: player.ontimeup
date = function() { let minutes = math.floor(player.currenttime / 60); let seconds = math.floor(player.currenttime - minutes * 60); let minutevalue; let secondvalue; if (minutes<10) { minutevalue = "0" + minutes; } else { minutevalue = minutes; } if (seconds<10) { secondvalue = "0" + seconds; } else { secondvalue = seconds; } mediatime = minutevalue + ":" + sec...
...ondvalue; timelabel.textcontent = mediatime; }; each time the time up
dates (once per second), we fire this function.
Debugging CSS - Learn web development
how to access browser devtools the article what are browser developer tools is an up-to-
date guide explaining how to access the tools in various browsers and platforms.
...a color picker will open up and you can try out some different colors; these will up
date in real time on the page.
CSS values and units - Learn web development
note: at some point modern browsers were up
dated so that rgba() and rgb(), and hsl() and hsla() (see below), became pure aliases of each other and started to behave exactly the same.
...this takes a value from 0–100%, where 0 is no light (it will appear completely black) and 100% is full light (it will appear completely white) we can up
date the rgb example to use hsl colors like this: just as rgb has rgba, hsl has an hsla equivalent, which gives you the same ability to specify the alpha channel.
Responsive design - Learn web development
this meant that two separate versions of the site had to be developed and kept up-to-
date.
...the media queries level 3 specification became a candi
date recommendation in 2009, meaning that it was deemed ready for implementation in browsers.
HTML forms in legacy browsers - Learn web development
in the mobile world, when neither the browser nor the os can be up
dated such as on older android phones or iphones, the stock browsers that don't up
date are also legacy browsers.
...for example, if you declare input { font-size: 2rem; }, it will impact number,
date, and text, but not color or range.
Test your skills: HTML5 controls - Learn web development
create appropriate inputs for a user to up
date their details for: email website phone number favourite color try updating the live code below to recreate the finished example: download the starting point for this task to work in your own editor or in an online editor.
...if you do this correctly, the javascript included on the page will automatically up
date the output value when the slider is moved.
Your first form - Learn web development
forms allow users to enter data, which is generally sent to a web server for processing and storage (see sending form data later in the module), or used on the client-side to immediately up
date the interface in some way (for example, add another item to a list, or show or hide a ui feature).
...gets: <form action="/my-handling-form-page" method="post"> <ul> <li> <label for="name">name:</label> <input type="text" id="name" name="user_name"> </li> <li> <label for="mail">e-mail:</label> <input type="email" id="mail" name="user_email"> </li> <li> <label for="msg">message:</label> <textarea id="msg" name="user_message"></textarea> </li> </ul> </form> up
date your form code to look like the above.
JavaScript basics - Learn web development
placing javascript near the bottom of an html page is one way to accommo
date this dependency.
...up
date your setusername() function to this: function setusername() { let myname = prompt('please enter your name.'); if(!myname) { setusername(); } else { localstorage.setitem('name', myname); myheading.innerhtml = 'mozilla is cool, ' + myname; } } in human language, this means: if myname has no value, run setusername() again from the start.
The web and web standards - Learn web development
it'll take you a few months to really start to get into it, and then you'll need to keep learning so that your knowledge stays up-to-
date with all the new tools and features that appear on the web platform, and keep practicing and refining your craft.
... javascript is the programming language we use to add interactivity to web sites, from dynamic style switching, to fetching up
dates from the server, right through to complex 3d graphics.
Debugging HTML - Learn web development
to specify the html to vali
date, you can provide a web address, upload an html file, or directly input some html code.
... switch to the vali
date by direct input tab.
Test your skills: Functions - Learn web development
you'll want to clear the canvas before drawing, so that when the code is up
dated in the case of the live version, you don't get lots of rectangles drawn on top of one another.
... up
date the choosename() function so that it makes use of the random number function, takes the array to choose from as a parameter (making it more flexible), and returns the result.
Video and Audio APIs - Learn web development
to do this we'll run a function to up
date the time displays every time the timeup
date event is fired on the <video> element.
... add the following addeventlistener() line just below the others: media.addeventlistener('timeup
date', settime); now to define the settime() function.
JavaScript object basics - Learn web development
let's up
date the javascript object in our file to look like this: const person = { name: ['bob', 'smith'], age: 32, gender: 'male', interests: ['music', 'skiing'], bio: function() { alert(this.name[0] + ' ' + this.name[1] + ' is ' + this.age + ' years old.
... setting object members so far we've only looked at retrieving (or getting) object members — you can also set (up
date) the value of object members by simply declaring the member you want to set (using dot or bracket notation), like this: person.age = 45; person['name']['last'] = 'cratchit'; try entering the above lines, and then getting the members again to see how they've changed, like so: person.age person['name']['last'] setting members doesn't just stop at updating the values of existing properties and m...
Test your skills: Object basics - Learn web development
up
date the color property value to black.
... once you've done this, you should then write a string to the variable bandinfo, which will contain a small biography detailing their name, nationality, years active, and style, and the title and release
date of their first album.
Aprender y obtener ayuda - Learn web development
if you want to find out more about a specific technology feature, such as the html <video> element, or the css background-color or opacity properties, or the javascript
date.settime() method, you should just search for the feature's name.
... if you are looking for some more specific information, you can add other keywords as modifiers, for example "<video> element autoplay attribute", or "
date.settime parameters".
Properly configuring server MIME types - Learn web development
this article may contain out of
date information, as it has not been significantly up
dated in many years.
... related links incorrect mime type for css files iana | mime media types hypertext transfer protocol — http/1.1 microsoft - 293336 - info: webcast: mime type handling in microsoft internet explorer microsoft - appendix a: mime type detection in internet explorer microsoft - security up
date, march 29, 2001 microsoft - security up
date, december 13, 2001 original document information author: bob clary,
date: 20 feb 2003 ...
Introduction to the server side - Learn web development
it can even allow interaction with users of the site, sending notifications and up
dates via email or through other channels.
... because the information is in a database, it can also more easily be shared and up
dated with other business systems (for example, when products are sold either online or in a shop, the shop might up
date its database of inventory).
Server-side web frameworks - Learn web development
an http post request to up
date a resource on the server will instead include the up
date information as "post data" within the body of the request.
...because everything is included, it all works together, follows consistent design principles, and has extensive and up-to-
date documentation.
Ember resources and troubleshooting - Learn web development
general troubleshooting, gotchas, and misconceptions this is nowhere near an extensive list, but it is a list of things that came up around the time of writing (latest up
date, may 2020).
... with ember-set-helper: <checkbox @value={{this.somedata}} @ontoggle={{set this "somedata" (not this.somedata)}} /> with ember-box: {{#let (box this.somedata) as |somedata|}} <checkbox @value={{unwrap somedata}} @ontoggle={{up
date somedata (not this.somedata)}} /> {{/let}} note that none of these solutions are particularly common among members of the community, and as a whole, people are still trying to figure out an ergonomic and simple api for setting data in a template-only context, without backing js.
Strategies for carrying out testing - Learn web development
you probably want to just test the latest versions of the first three, as these browsers receive regular up
dates.
... there are also commercial tools available such as sauce labs, browser stack and lamb
datest that do this kind of thing for you, without you having to worry about the setup, if you wish to invest some money in your testing.
Git and GitHub - Learn web development
overview vcses are essential for software development: it is rare that you will work on a project completely on your own, and as soon as you start working with other people you start to run the risk of conflicting with each other's work — this is when both of you try to up
date the same piece of code at the same time.
... mastering issues (from github) issues are like a forum for your github project, where people can ask questions and report problems, and you can manage up
dates (for example assigning people to fix issues, clarifying the issue, letting people know things are fixed).
Command line crash course - Learn web development
it is also useful for automation — for example to write a command to up
date the titles of hundreds of files instantly, say from “ch01-xxxx.png” to “ch02-xxxx.png”.
... if you up
dated the file names using your finder or explorer gui app, it would take you a long time.
Mozilla’s UAAG evaluation report
this document is based on the september 12, 2001 candi
date recommendation of uaag 1.0.
... this may be different from the most recent version, check for up
dates on the user agent working group home page.
Adding phishing protection data providers
browser.safebrowsing.provider.idnum.up
dateurl an url used to request an up
dated list of phishing sites.
... the server either provides a full list or incremental up
dates in order to bring the client's tables up to
date.
A bird's-eye view of the Mozilla framework
tiner last up
dated
date: 11/23/05 statement of purpose the purpose of this article is to provide a high-level technical overview of the architecture of the extensible, object-based mozilla application framework.
...release() decrements the reference count and then the object becomes a candi
date for destruction.
Command line options
-show
date date show your schedule of the given
date.
... sunbird -show
date 08/04/2008 -subscribe url or -url url subscribe to the given url.
Debugging on Mac OS X
these steps were last up
dated for xcode 10.3: open xcode, and create a new project with file > new project.
...# breakpoint set --name nsthread::processnextevent --thread-index 1 --auto-continue true --one-shot true breakpoint command add -s python # this script that we run does not work if we try to use the global 'lldb' # object, since it is out of
date at the time that the script runs (for # example, `lldb.target.executable.fullpath` is empty).
Old Thunderbird build
then run "python client.py checkout" to ensure you are up-to-
date.
...to run the executable from your comm-central working directory: windows: obj-.../dist/bin/thunderbird.exe linux: obj-.../dist/bin/thunderbird os x: obj-.../dist/daily.app/contents/macos/thunderbird how to up
date and build again in your comm-central directory, run the same command as before: python client.py checkout then just re-run the mach command above.
Simple Instantbird build
then run python client.py checkout to ensure you are up-to-
date.
...to run the executable from your comm-central working directory: windows: obj-.../dist/bin/instantbird.exe linux: obj-.../dist/bin/instantbird os x: obj-.../dist/instantbird.app/contents/macos/instantbird how to up
date and build again simply re-run the mach command above.
The Firefox codebase: CSS Guidelines
it is also good practice to look at whether the rule you are overriding is still needed: maybe the ux spec for the component has changed and that rule can actually be up
dated or removed.
... when this is the case, don't be afraid to remove or up
date that rule.
Listening to events on all tabs
optional from gecko 10 onprogresschange called when up
dated progress information for the download of a document is available.
... void onprogresschange( nsidomxulelement abrowser, nsiwebprogress awebprogress, nsirequest arequest, print32 acurselfprogress, print32 amaxselfprogress, print32 acurtotalprogress, print32 amaxtotalprogress ); parameters abrowser the browser representing the tab for which up
dated progress information is being provided.
Reviewer Checklist
idl uuids are up
dated when the interface is up
dated.
... android permissions should be 'grouped' into a common release to avoid breaking auto-up
dates.
Working with Mozilla source code
interface development guide guidelines and documentation for how to create and up
date xpcom interfaces.
...this article needs to be up
dated fully for mercurial.
Multiple Firefox profiles
while using the nightly channel, you may encounter some add-ons that have become temporarily incompatible with new api changes, until the add-on developer has a chance to up
date them.
...it takes little time to set up a new profile, and once it is complete, all of your firefox versions will up
date separately and can be run simultaneously.
Using the Browser API
notice that this is also where we call the canmovebwd() and canmovefwd() functions we discussed earlier — it makes sense to up
date the status of the back and forward buttons after each page reload.
... back to the stop/reload button — updating the icon is nice, but we also need to up
date the functionality that is invoked when each icon is displayed.
MozBeforePaint
once you've called this, the mozbeforepaint event will be fired one time, when it's time for animations to be up
dated for the window's next animation frame.
...this computes the current position for the animating box and up
dates the box's position on screen, and, if the animation sequence is not yet complete, calls window.requestanimationframe() to schedule the next animation frame to be drawn.
Roll your own browser: An embedding how-to
warning: this document is out of
date.
... original document information author(s): doug turner original document: , , and last up
dated
date: december 8, 2004 copyright information: copyright (c) doug turner ...
Gecko Keypress Event
because numerals are common in short cuts, the numeral from the key should be considered as a low priority shortcut key candi
date (bug 429219).
...it is better to use the logic already in nscontentutils::getaccelkeycandi
dates() for accel key handling, and nscontentutils::getaccesskeycandi
dates() for access key handling (see nscontentutils.h and nscontentutils.cpp).
Gecko's "Almost Standards" Mode
recommendations for authors who are attempting to migrate to vali
dated markup using either html 4.01 or xhtml 1.0, and who are still using image-in-table design concepts, make sure to use a doctype that will trigger "almost standards" mode.
...meyer, netscape communications last up
dated
date: published 08 nov 2002 copyright information: copyright © 2001-2003 netscape.
Hacking with Bonsai
there is a web page, which records if the tree is open or closed what the
date stamp of the last known good tree is who is on the hook for the current tree before the tree is opened, the list of checkins that happened when the tree was closed is reviewed to insure that only build related checkins took place.
...when the tree is re-opened, the web page is up
dated and the hook is cleared.
Introduction to Layout in Mozilla
et frame child rs.reason set based on rc’s type incremental reflow propagate damage to frames later “in the flow” incremental reflow multiple reflow commands are batched nsreflowpath maintains a tree of target frames amortize state recovery and damage propagation cost painting as reflow proceeds through the frame hierarchy, areas are invali
dated via nsiviewmanager::up
dateview unless immediate, invalid areas are coalesced and processed asynchronously via os expose event native expose event dispatched to widget; widget delegates to the view manager view manager paints views back-to-front, invoking presshell’s paint method presshell::paint walks from the view to the frame; invokes nsiframe::paint for each layer incrementalism ...
... original document information author(s): chris waterson last up
dated
date: june 10, 2002 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Log.jsm
until stabilized, expect frequent up
dates, including different interfaces and behavior in different versions of the platform.
... logmessage(); length: 4 keys of prototype: leveldesc logger(); length: 2 keys of prototype: addappender(); level logstructured(); name parent removeappender(); up
dateappenders(); and the methods mentioned below: logger methods loggerrepository(); length: 0 keys of prototype: getlogger(); rootlogger storagestreamappender(); length: 1 keys of prototype: doappend(); getinputstream(); ...
PopupNotifications.jsm
this lets the notification service up
date the active notifications as appropriate.
...for most use cases, the value of this parameter should be
date.now() plus an offset indicating the amount of time the notification should be kept open (for example,
date.now() + 30000 for 30 seconds).
Bootstrapping a new locale
mkdir -p ab-cd/browser/installer ab-cd/browser/profile/chrome ab-cd/browser/searchplugins ab-cd/browser/up
dater ab-cd/toolkit cp -r mozilla-1.9.x/browser/locales/ ab-cd/browser cp -r mozilla-1.9.x/dom/locales/ ab-cd/dom cp -r mozilla-1.9.x/editor/locales/ ab-cd/editor cp -r mozilla-1.9.x/extensions/reporter/locales/chrome ab-cd/extensions cp -r mozilla-1.9.x/netwerk/locales/ ab-cd/netwerk cp -r mozilla-1.9.x/other-licenses/branding/firefox/locales/ ab-cd/other-licenses cp -r mozilla-1.9.x/security/manager...
...$ hg pull -u # to pull changes and up
date $ hg push # to push changes to this repo import existing data?
Localization technical reviews
the merge
date for migrating from one product release channel to the next (e.g., aurora to beta, or beta to release) is rapidly approaching.
...when you up
date your localization for the next release, you'll need to put it through a different form of qa review called a sign-off review.
MathML Torture Test
h { font-family: minion math; } .stixtwo math { font-family: stix two math; } .texgyrebonum math { font-family: tex gyre bonum math; } .texgyrepagella math { font-family: tex gyre pagella math; } .texgyreschola math { font-family: tex gyre schola math; } .texgyretermes math { font-family: tex gyre termes math; } .xits math { font-family: xits math; } javascript content function up
datemathfont() { var mathfont = document.getelementbyid("mathfont").value; if (mathfont == "default") { document.body.removeattribute("class"); } else { document.body.setattribute("class", mathfont); } } function load() { document.getelementbyid("mathfont").
... addeventlistener("change", up
datemathfont, false) } window.addeventlistener("load", load, false); the following test contains sample tex formulas from knuth's tex book and equivalent mathml representations.
Mozilla MathML Project
up
dates status of each tag result of the mathml 3 testsuite unofficial nightly builds with mathml patches applied (maintained by bill gianopoulos) more up
dates and archived content community view mozilla forums...
...sidje other contributors: frédéric wang last up
dated
date: april 4, 2010 copyright information: portions of this content are © 1999–2010 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla DOM Hacking Guide
i will try to up
date this guide as soon as possible.
... original document information author(s): fabian guisset last up
dated
date: september 27, 2007 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Mozilla Style System Documentation
it should be consoli
dated so that the style system code can be moved back within the layout dll and nsistylecontext can be de-com-ified.
...david baron last up
dated
date: june 6, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Scroll-linked effects
in the asynchronous scrolling model, the visual scroll position is up
dated in the compositor thread and is visible to the user before the scroll event is up
dated in the dom and fired on the main thread.
...one way to implement this without the scroll event listener is to use the css property designed for this purpose: <body style="height: 5000px"> <div id="toolbar" style="position: sticky; top: 0px; margin-top: 100px; width: 100px; height: 20px; background-color: green"></div> </body> this version works well with asynchronous scrolling because position of the "toolbar" div is up
dated by the browser as the user scrolls.
A brief guide to Mozilla preferences
ion directory: greprefs.js - preferences shared by all applications using the mozilla platform services/common/services-common.js - preferences for some shared services code, this should arguably be included in some other file defaults/pref/services-sync.js - default preferences for firefox sync, also oddly misplaced browser/app/profile/channel-prefs.js - a file indicating the user's up
date channel.
... this is kept separate from other preferences because it can affect how up
dates are applied.
Patches and pushes
review, commit, & land address any review comments made by the reviewers and up
date the patch until it receives an r+ rating.
... up
date your sign-offs on the l10n dashboard to include the change into the next release.
Profile Manager
when you restore a profile, the backup is retained, so you can restore from the same backup at a later
date.
... properties - shows a dialog that displays the profile's path and last-modified
date.
AsyncTestUtils extended framework
this specifies the time interval we should add to the
date for each message.
...because the message sets are interleaved, if you read the subject lines in the order they were added (or in
date order), you would read "foo", "bar", "foo", "bar", "foo", "bar".
PR_AtomicSet
description pr_atomicset first reads the value of var, then up
dates it with the supplied value.
... the returned value is the value that was readbefore memory was up
dated.
NSPR release process
five files need to be up
dated: configure.in, configure, repackage.sh, prinit.h, and vercheck.c.
... usually you just need to up
date prinit.h.
NSS FAQ
this section is out of
date iplanet e-commerce solutions has certified nss 3.1 on 18 platforms, including aix 4.3, hp-ux 11.0, red hat linux 6.0, solaris (2.6 or later), windows nt (4.0 or later), and windows 2000.
... this section is out of
date yes; see build instructions for nss 3.1.
JSS
the github: git clone git@github.com:dogtagpki/jss.git -- or -- git clone https://github.com/dogtagpki/jss.git all future upstream enquiries to jss should now use the pagure issue tracker system: https://pagure.io/jss/issues documentation regarding the jss project should now be viewed at: http://www.dogtagpki.org/wiki/jss note: as much of the jss documentation is sorely out-of-
date, up
dated information will be a work in progress, and many portions of any legacy documentation will be re-written over the course of time.
...if you are planning to just use jss jce provider as a bridge to nss's fips vali
dated pkcs#11 module, then the sunpkcs11 jce provider may do all that you need.
NSS 3.14.2 release notes
(https://bugzilla.mozilla.org/show_bug.cgi?id=540986) sqlite has been up
dated to 3.7.15.
... bug 618418 - c_decrypt/c_decryptfinal now correctly vali
date the pkcs #7 padding when present.
NSS 3.16.2.3 release notes
previously nss would only vali
date the peer's public key before performing ecdh key agreement.
... now ec public keys are vali
dated at import time.
NSS 3.17.2 release notes
previously nss would only vali
date the peer's public key before performing ecdh key agreement.
... now ec public keys are vali
dated at import time.
NSS 3.19.3 release notes
this is a patch release to up
date the list of root ca certificates.
...rprint: c4:18:f6:4d:46:d1:df:00:3d:27:30:13:72:43:a9:12:11:c6:75:fb cn = tÜrktrust elektronik sertifika hizmet saÄŸlayıcısı h6 sha1 fingerprint: 8a:5c:8c:ee:a5:03:e6:05:56:ba:d8:1b:d4:f6:c9:b0:ed:e5:2f:e0 cn = certinomis - root ca sha1 fingerprint: 9d:70:bb:01:a5:a4:a0:18:11:2e:f7:1c:01:b9:32:c5:34:e7:88:a8 the version number of the up
dated root ca list has been set to 2.5 bugs fixed in nss 3.19.3 this bugzilla query returns all the bugs fixed in nss 3.19.3: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.19.3 compatibility nss 3.19.3 shared libraries are backward compatible with all older nss 3.19 shared libraries.
NSS 3.21 release notes
2016-01-07, this page has been up
dated to include additional information about the release.
...sign g2 sha1 fingerprint: fb:ed:dc:90:65:b7:27:20:37:bc:55:0c:9c:56:de:bb:f2:78:94:e1 cn = ca wosign ecc root sha1 fingerprint: d2:7a:d2:be:ed:94:c0:a1:3c:c7:25:21:ea:5d:71:be:81:19:f3:2b cn = oiste wisekey global root gb ca sha1 fingerprint: 0f:f9:40:76:18:d3:d7:6a:4b:98:f0:a8:35:9e:0c:fd:27:ac:cc:ed the version number of the up
dated root ca list has been set to 2.6 bugs fixed in nss 3.21 this bugzilla query returns all the bugs fixed in nss 3.21: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.21 acknowledgements the nss development team would like to thank karthikeyan bhargavan from inria for responsibly disclosing the issue in b...
NSS 3.28.1 release notes
this is a patch release to up
date the list of root ca certificates, and address a minor tls compatibility issue, that some applications experienced with nss 3.28.
...ification authority - g4 sha-256 fingerprint: fe:86:3d:08:22:fe:7a:23:53:fa:48:4d:59:24:e8:75:65:6d:3d:c9:fb:58:77:1f:6f:61:6f:9d:57:1b:c5:92 cn = symantec class 2 public primary certification authority - g6 sha-256 fingerprint: cb:62:7d:18:b5:8a:d5:6d:de:33:1a:30:45:6b:c6:5c:60:1a:4e:9b:18:de:dc:ea:08:e7:da:aa:07:81:5f:f0 the version number of the up
dated root ca list has been set to 2.11 a misleading assertion/alert has been removed, when nss tries to flush data to the peer but the connection was already reset.
NSS 3.28.5 release notes
this is a patch release to up
date the list of root ca certificates.
...35:dd:94:57 trust flags: email cn = tubitak kamu sm ssl kok sertifikasi - surum 1 sha-256 fingerprint: 46:ed:c3:68:90:46:d5:3a:45:3f:b3:10:4a:b8:0d:ca:ec:65:8b:26:60:ea:16:29:dd:7e:86:79:90:64:87:16 trust flags: websites technically constrained to: gov.tr, k12.tr, pol.tr, mil.tr, tsk.tr, kep.tr, bel.tr, edu.tr, org.tr the version number of the up
dated root ca list has been set to 2.14.
NSS 3.30.2 release notes
this is a patch release to up
date the list of root ca certificates.
...35:dd:94:57 trust flags: email cn = tubitak kamu sm ssl kok sertifikasi - surum 1 sha-256 fingerprint: 46:ed:c3:68:90:46:d5:3a:45:3f:b3:10:4a:b8:0d:ca:ec:65:8b:26:60:ea:16:29:dd:7e:86:79:90:64:87:16 trust flags: websites technically constrained to: gov.tr, k12.tr, pol.tr, mil.tr, tsk.tr, kep.tr, bel.tr, edu.tr, org.tr the version number of the up
dated root ca list has been set to 2.14 (the version numbers 2.12 and 2.13 for the root ca list have been skipped.) bugs fixed in nss 3.30.2 bug 1350859 - march 2017 batch of root ca changes bug 1349705 - implemented domain name constraints for ca: tubitak kamu sm ssl kok sertifikasi - surum 1 compatibility nss 3.30.2 shared libraries are backward compatible with all older nss 3.x shared li...
NSS 3.37 release notes
nss 3.37 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_37_rtm/src/ notable changes in nss 3.37 the tls 1.3 implementation was up
dated to draft 28.
... the ca certificates list was up
dated to version 2.24.
NSS 3.53 release notes
(bug 1618404, bug 1621159) if a builtin certificate has a cka_nss_server_distrust_after timestamp before the sct or notbefore
date of a certificate that builtin issued, then clients can elect not to trust it.
... bug 1561331 - additional modular inverse test bug 1629553 - rework and cleanup gmake builds bug 1438431 - remove mkdepend and "depend" make target bug 290526 - support parallel building of nss when using the makefiles bug 1636206 - hacl* up
date after changes in libintvector.h bug 1636058 - fix building nss on debian s390x, mips64el, and riscv64 bug 1622033 - add option to build without seed this bugzilla query returns all the bugs fixed in nss 3.53: https://bugzilla.mozilla.org/buglist.cgi?resolution=fixed&classification=components&query_format=advanced&product=nss&target_milestone=3.53 compatibility nss 3.53 shared libraries are...
NSS 3.56 release notes
notable changes in nss 3.56 nspr dependency up
dated to 4.28.
... bug 1656519 - up
date nspr dependency to 4.28.
NSS Developer Tutorial
please up
date this list if you do.
... up
date nss in mozilla-inbound and mozilla-central the procedure is documented at https://developer.mozilla.org/docs/updating_nspr_or_nss_in_mozilla-central.
NSS Sample Code Sample_1_Hashing
hashtype hashtype; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_up
date(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...d line arguments */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and vali
date */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", ...
NSS Sample Code Utilities_1
r (;;) { /* prompt for password */ if (istty) { fprintf(output, "%s", prompt); fflush (output); echooff(infd); } fgets(phrase, sizeof(phrase), input); if (istty) { fprintf(output, "\n"); echoon(infd); } /* stomp on newline */ phrase[port_strlen(phrase)-1] = 0; /* vali
date password */ if (!(*ok)(phrase)) { if (!istty) return 0; fprintf(output, "password must be at least 8 characters long with one or more\n"); fprintf(output, "non-alphabetic characters\n"); continue; } return (char*) port_strdup(phrase); } } /* * filepasswd extracts the password from a text file * * storing passwords is ...
.../* * seedfromnoisefile */ secstatus seedfromnoisefile(const char *noisefilename) { char buf[2048]; prfiledesc *fd; print32 count; fd = pr_open(noisefilename, pr_rdonly, 0); if (!fd) { fprintf(stderr, "failed to open noise file."); return secfailure; } do { count = pr_read(fd,buf,sizeof(buf)); if (count > 0) { pk11_randomup
date(buf,count); } } while (count > 0); pr_close(fd); return secsuccess; } /* * filesize */ long filesize(const char* filename) { struct stat stbuf; stat(filename, &stbuf); return stbuf.st_size; } /* * readderfromfile */ secstatus readderfromfile(secitem *der, const char *infilename, prbool ascii) { secstatus rv = secsuccess; prfiledesc *infile = n...
NSS Sample Code sample3
0xbc, sizeof data); /* create a context for hashing (digesting) */ context = pk11_createdigestcontext(sec_oid_md5); if (!context) { cout << "createdigestcontext failed" << endl; goto done; } s = pk11_digestbegin(context); if (s != secsuccess) { cout << "digestbegin failed" << endl; goto done; } s = pk11_digestop(context, data, sizeof data); if (s != secsuccess) { cout << "digestup
date failed" << endl; goto done; } s = pk11_digestfinal(context, digest, &len, sizeof digest); if (s != secsuccess) { cout << "digestfinal failed" << endl; goto done; } /* print digest */ printdigest(digest, len); pk11_destroycontext(context, pr_true); context = 0; /* * part 2 - hashing with included secret key */ cout << "part 2 -- hashing with included secret key" << endl;...
...oparams); if (!context) { cout << "createdigestcontext failed" << endl; goto done; } s = pk11_digestbegin(context); if (s != secsuccess) { cout << "digestbegin failed" << endl; goto done; } s = pk11_digestkey(context, key); if (s != secsuccess) { cout << "digestkey failed" << endl; goto done; } s = pk11_digestop(context, data, sizeof data); if (s != secsuccess) { cout << "digestup
date failed" << endl; goto done; } s = pk11_digestfinal(context, digest, &len, sizeof digest); if (s != secsuccess) { cout << "digestfinal failed" << endl; goto done; } /* print digest */ printdigest(digest, len); pk11_destroycontext(context, pr_true); context = 0; /* * part 3 - mac (with secret key) */ cout << "part 3 -- mac (with secret key)" << endl; /* initialize data...
Hashing - sample 1
hashtype hashtype; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_up
date(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...d line arguments */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and vali
date */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", ...
Utilities for nss samples
r (;;) { /* prompt for password */ if (istty) { fprintf(output, "%s", prompt); fflush (output); echooff(infd); } fgets(phrase, sizeof(phrase), input); if (istty) { fprintf(output, "\n"); echoon(infd); } /* stomp on newline */ phrase[port_strlen(phrase)-1] = 0; /* vali
date password */ if (!(*ok)(phrase)) { if (!istty) return 0; fprintf(output, "password must be at least 8 characters long with one or more\n"); fprintf(output, "non-alphabetic characters\n"); continue; } return (char*) port_strdup(phrase); } } /* * filepasswd extracts the password from a text file * * storing passwords is ...
.../* * seedfromnoisefile */ secstatus seedfromnoisefile(const char *noisefilename) { char buf[2048]; prfiledesc *fd; print32 count; fd = pr_open(noisefilename, pr_rdonly, 0); if (!fd) { fprintf(stderr, "failed to open noise file."); return secfailure; } do { count = pr_read(fd,buf,sizeof(buf)); if (count > 0) { pk11_randomup
date(buf,count); } } while (count > 0); pr_close(fd); return secsuccess; } /* * filesize */ long filesize(const char* filename) { struct stat stbuf; stat(filename, &stbuf); return stbuf.st_size; } /* * readderfromfile */ secstatus readderfromfile(secitem *der, const char *infilename, prbool ascii) { secstatus rv = secsuccess; prfiledesc *infile = n...
sample1
type; hashcontext *hashcontext = null; hashtype = hash_gethashtypebyoidtag(hashoidtag); hashcontext = hash_create(hashtype); if (hashcontext == null) { return secfailure; } do { hash_begin(hashcontext); /* incrementally hash the file contents */ while ((nb = pr_read(infile, ibuf, sizeof(ibuf))) > 0) { hash_up
date(hashcontext, ibuf, nb); } hash_end(hashcontext, digest, &len, 64); /* normally we would write it out in binary with * nb = pr_write(outfile, digest, len); * but for illustration let's print it in hex.
...ts */ optstate = pl_createoptstate(argc, argv, "t:"); while ((status = pl_getnextopt(optstate)) == pl_opt_ok) { switch (optstate->option) { case 't': require_arg(optstate->option, optstate->value); hashname = strdup(optstate->value); break; } } if (!hashname) usage(progname); /* convert and vali
date */ hashoidtag = hashnametooidtag(hashname); if (hashoidtag == sec_oid_unknown) { fprintf(stderr, "%s: invalid digest type - %s\n", progname, hashname); usage(progname); } /* digest it and print the result */ rv = digestfile(pr_stdout, pr_stdin, hashoidtag); if (rv != secsuccess) { fprintf(stderr, "%s: problem digesting data (%d)\n", progn...
PKCS 7 functions
xr 3.2 and later sec_pkcs7createsigneddata mxr 3.2 and later sec_pkcs7decodeitem mxr 3.2 and later sec_pkcs7decoderabort mxr 3.9 and later sec_pkcs7decoderfinish mxr 3.2 and later sec_pkcs7decoderstart mxr 3.2 and later sec_pkcs7decoderup
date mxr 3.2 and later sec_pkcs7decryptcontents mxr 3.2 and later sec_pkcs7destroycontentinfo mxr 3.2 and later sec_pkcs7encode mxr 3.3 and later sec_pkcs7encodeitem mxr 3.9.3 and later sec_pkcs7encoderabort mxr 3.9 and later sec_pkcs7e...
...ncoderfinish mxr 3.2 and later sec_pkcs7encoderstart mxr 3.2 and later sec_pkcs7encoderup
date mxr 3.2 and later sec_pkcs7getcertificatelist mxr 3.2 and later sec_pkcs7getcontent mxr 3.2 and later sec_pkcs7getencryptionalgorithm mxr 3.2 and later sec_pkcs7getsignercommonname mxr 3.4 and later sec_pkcs7getsigneremailaddress mxr 3.4 and later sec_pkcs7getsigningtime mxr 3.4 and later sec_pkcs7includecertchain mxr 3.2 and later sec_pkcs7iscontentempty mxr 3.2 and later sec_pkcs7setcontent ...
Migration to HG
up
dated instructions for building nss with nspr can be found at: /docs/nss_reference/building_and_installing_nss/build_instructions it's best to refer to the above document to learn about the various environment variables that you might have to set to build on your platform (this part hasn't changed).
...karea cd workarea hg clone https://hg.mozilla.org/projects/nspr hg clone https://hg.mozilla.org/projects/nss cd nss # set use_64=1 on 64 bit architectures # set build_opt=1 to get an optimized build make nss_build_all note that the jss project has been given a private copy of the former mozilla/security/coreconf directory, allowing it to remain stable, and only up
date its build system as necessary.
NSS reference
random number generation this api consists of the two routines used for pseudorandom number generation -- pk11_generaterandomonslot and pk11_generaterandom -- and the two routines used for seeding pseudorandom number generation -- pk11_seedrandom and pk11_randomup
date.
... sec_pkcs12createexportcontext sec_pkcs12createpasswordprivsafe sec_pkcs12createunencryptedsafe sec_pkcs12addcertandkey sec_pkcs12addpasswordintegrity sec_pkcs12enablecipher sec_pkcs12encode sec_pkcs12destroyexportcontext sec_pkcs12decoderstart sec_pkcs12decoderimportbags sec_pkcs12decoderup
date sec_pkcs12decoderfinish sec_pkcs12decodervali
datebags sec_pkcs12decoderverify sec_pkcs12decodergetcerts sec_pkcs12decodersettargettokencas sec_pkcs12decoderiterateinit sec_pkcs12decoderiteratenext sec_pkcs12isencryptionallowed sec_pkcs12setpreferredcipher nspr functions a small number of nspr functions are required for using the certificate verification and ssl functions in nss.
S/MIME functions
nss_cmscontentinfo_setcontent_envelopeddata mxr 3.2 and later nss_cmscontentinfo_setcontent_signeddata mxr 3.2 and later nss_cmsdecoder_cancel mxr 3.2 and later nss_cmsdecoder_finish mxr 3.2 and later nss_cmsdecoder_start mxr 3.2 and later nss_cmsdecoder_up
date mxr 3.2 and later nss_cmsdigestcontext_cancel mxr 3.2 and later nss_cmsdigestcontext_finishmultiple mxr 3.2 and later nss_cmsdigestcontext_finishsingle mxr 3.2 and later nss_cmsdigestcontext_startmultiple mxr 3.2 and later nss_cmsdigestcontext_startsingle ...
... mxr 3.2 and later nss_cmsdigestcontext_up
date mxr 3.2 and later nss_cmsdigesteddata_create mxr 3.2 and later nss_cmsdigesteddata_destroy mxr 3.2 and later nss_cmsdigesteddata_getcontentinfo mxr 3.2 and later nss_cmsderencode mxr 3.2 and later nss_cmsencoder_cancel mxr 3.2 and later nss_cmsencoder_finish mxr 3.2 and later nss_cmsencoder_start mxr 3.2 and later nss_cmsencoder_up
date mxr 3.2 and later nss_cmsencrypteddata_create mxr 3.2 and later nss_cmsencrypteddata_destroy mxr 3.2 an...
NSS Tools certutil
-n nickname specify the nickname of a certificate or key to list, create, add to a database, modify, or vali
date.
... c6:f9:54:af:28:56:62:f4:2f:b3:9b:50:e1:c3:a2:ba:27:ee: 07:9f:89:2e:78:5c:6d:46:b6:5e:99:de:e6:9d:eb:d9:ff:b2: 5f:c6:f6:c6:52:4a:d4:67:be:8d:fc:dd:52:51:8e:a2:d7:15: 71:3e certificate trust flags: ssl flags: valid ca trusted ca email flags: valid ca trusted ca object signing flags: valid ca trusted ca validating a certificate this example vali
dates a certificate: certutil -v -n jsmith@netscape.com -b 9803201212z -u sr -e -l -d certdir the certificate database tool shows results similar to certificate:'jsmith@netscape.com' is valid.
Scripting Java
this works just as in java, with the use of the new operator: js> new java.util.
date() thu jan 24 16:18:17 est 2002 if we store the new object in a javascript variable, we can then call methods on it: js> f = new java.io.file("test.txt") test.txt js> f.exists() true js> f.getname() test.txt static methods and fields can be accessed from the class object itself: js> java.lang.math.pi 3.141592653589793 js> java.lang.math.cos(0) 1 in javascript, unlike java, the method by it...
...for example, if we call overload's method g with two integers we get an error because neither form of the method is closer to the argument types than the other: js> o.g(3,4) js:"<stdin>", line 2: the choice of java method overload.g matching javascript argument types (number,number) is ambiguous; candi
date methods are: class java.lang.string g(java.lang.string,int) class java.lang.string g(int,java.lang.string) see java method overloading and liveconnect 3 for a more precise definition of overloading semantics.
Rhino shell
js> runcommand('
date') thu jan 23 16:49:36 cet 2003 0 // using input option to provide process input js> runcommand("sort", {input: "c\na\nb"}) a b c 0 js> // demo of output and err options js> var opt={input: "c\na\nb", output: 'sort output:\n'} js> runcommand("sort", opt) 0 js> print(opt.output) sort output: a b c js> var opt={input: "c\na\nb", output: 'sort output:\n', err: ''} js> runcommand("sort", "--bad-arg", ...
... not found js> // passing explicit environment to the system shell js> runcommand("sh", "-c", "echo $env1 $env2", { env: {env1: 100, env2: 200}}) 100 200 0 js> // use args option to provide additional command arguments js> var arg_array = [1, 2, 3, 4]; js> runcommand("echo", { args: arg_array}) 1 2 3 4 0 examples for windows are similar: js> // invoke shell command js> runcommand("cmd", "/c", "
date /t") 27.08.2005 0 js> // run sort collectiong the output js> var opt={input: "c\na\nb", output: 'sort output:\n'} js> runcommand("sort", opt) 0 js> print(opt.output) sort output: a b c js> // invoke notepad and wait until it exits js> runcommand("notepad") 0 ...
JS::DeflateStringToUTF8Buffer
if dstlenp is provided, it will be up
dated to hold the number of bytes written to the buffer.
... if numcharsp is provided, it will be up
dated to hold the number of unicode characters written to the buffer.
JS_ExecuteRegExp
a pointer to the lastindex for the execution, and received the up
dated lastindex.
... js_executeregexp up
dates the built-in regexp object's properties.
JSAPI reference
er added in spidermonkey 1.8 obsolete since jsapi 23 js_call_object_tracer added in spidermonkey 1.8 obsolete since jsapi 23 js_call_string_tracer added in spidermonkey 1.8 obsolete since jsapi 23 js_call_double_tracer added in spidermonkey 1.8 obsolete since javascript 1.8.5 js_printtracethinginfo (debug-only) added in spidermonkey 1.8 obsolete since jsapi 16 miscellaneous gc apis: js_up
datemalloccounter added in spidermonkey 17 js::setlargeallocationfailurecallback added in spidermonkey 31 js::setoutofmemorycallback added in spidermonkey 31 js_enumeratediagnosticmemoryregions added in spidermonkey 17 jsval_lock obsolete since jsapi 18 jsval_unlock obsolete since jsapi 18 js_lockgcthing obsolete since jsapi 21 js_lockgcthingrt obsolete since jsapi 22 js_unlockgcthing obsol...
... jsprotokey added in spidermonkey 24 js_getclassobject js_getclassprototype js::protokeytoid added in spidermonkey 38 js_idtoprotokey added in spidermonkey 31 js::identifystandardinstance added in spidermonkey 31 js::identifystandardprototype added in spidermonkey 31 js::identifystandardinstanceorprototype added in spidermonkey 31 js::identifystandardconstructor added in spidermonkey 38
date js_new
dateobject added in spidermonkey 1.8.5 js_new
dateobjectmsec added in spidermonkey 1.8.5 js_objectis
date added in spidermonkey 1.8.5 js_clear
datecaches added in spidermonkey 17 js_now intl api js_setdefaultlocale added in spidermonkey 24 js_resetdefaultlocale added in spidermonkey 24 properties these functions correspond directly to the ways scripts access object properties: ...
SpiderMonkey 1.8.8
—insert-actual-release-
date-here platform support spidermonkey 1.8.8 is supported on all the platforms where firefox insert-actual-firefox-version-number-here runs.
...new javascript language features javascript 1.8.8 includes significant up
dates to language features, yo.
Gecko Roles
role_
date_editor represents control whose purpose is to allow a user to edit a
date.
... role_calendar a calendar that allows the user to select a
date.
Embedded Dialog API
stay tuned for up
dates.
... the dialog component's contract id should have the form "@mozilla.org/embedui/unique-component-name;1" original document information author: danm@netscape.com last up
dated
date: 15 dec 2001 ...
Manipulating bookmarks using Places
you can use the nsinavbookmarksservice.changebookmarkuri() method to up
date the uri for a given bookmark item: var uri = ios.newuri("http://mozilla.com/", null, null); bmsvc.changebookmarkuri(newbkmkid, uri); this example changes the bookmark to refer to the mozilla web site instead of google.
... // an nsinavbookmarkobserver var myext_bookmarklistener = { onbeginup
datebatch: function() {}, onendup
datebatch: function() {}, onitemadded: function(aitemid, afolder, aindex) {}, onitemremoved: function(aitemid, afolder, aindex) {}, onitemchanged: function(abookmarkid, aproperty, aisannotationproperty, avalue) { myextension.dosomething(); }, onitemvisited: function(abookmarkid, avisitid, time) {}, onitemmoved: function(aitemid, aoldparent, aoldindex,...
Using the Places keywords API
a keyword can only be associated to a given url, it's not possible to associate the same keyword with multiple urls (doing so will just up
date the url it's pointing to).
... placesutils.keywords.insert({ keyword: "my_keyword", url: "http://www.example.com/" postdata: "post+data=1&test=2" }).then(() => { /* success */ }, e => { /* failure */ }); note that setting an already existing keyword to a different url, will silently up
date the existing keyword to the new url.
Finishing the Component
when your component runs in a version of gecko in which this interface is up
dated, your method calls will be routed through a different v-table than the one the component expected, most likely resulting in a crash.
...the up
dated weblock class looks as follows: class weblock: public nsiobserver, public iweblock, public nsicontentpolicy { public: weblock(); virtual ~weblock(); ns_decl_isupports ns_decl_nsiobserver ns_decl_iweblock ns_decl_nsicontentpolicy private: urlnode* mrooturlnode; prbool mlocked; }; remember to change the nsisupports implementation macro to include nsiconte...
Using XPCOM Utilities to Make Things Easier
using these declaration macros not only saves a tremendous amount of time when you're writing the code, it can also save time if you make changes to your idl file, since the c++ header file will then automatically include the up
dated list of methods to be supported.
...this raw pointer can then be assigned to a variable and have its reference up
dated by ns_if_addref.
Mozilla internal string guide
calling restartbulkwrite() invali
dates previously-obtained span, raw pointer or length.
...it takes two arguments: the new logical length of the string (which must not exceed the capacity retuned by the length() method of the handle) and a boolean indicating whether it's ok to attempt to reallocate a smaller buffer in case a smaller mozjemalloc bucket could accommo
date the new logical length.
IAccessibleText
provided for use by the ::ia2_event_text_inserted and ::ia2_event_text_up
dated event handlers.
...provided for use by the ia2_event_text_removed/up
dated event handlers.
jsdIStackFrame
after you return from that handler the bottom frame, and any frame you found attached through it, are invali
dated via the jsdiephemeral interface.
... once a jsdistackframe has been invali
dated all method and property accesses will throw a ns_error_not_available exception.
nsIAbCard
following a huge refactoring of the address book code, most of the documentation below is out of
date.
...g used for the contact's work web page webpage2 astring used for the contact's home web page birthyear astring birthmonth astring birthday astring custom1 astring custom2 astring custom3 astring custom4 astring notes astring lastmodified
date unsigned long popularityindex unsigned long popularityindex is bumped every time e-mail is sent to this recipient .
nsIAccessibilityService
pports aframe); nsiaccessible createhtmlcaptionaccessible(in nsisupports aframe); nsiaccessible getaccessible(in nsidomnode anode, in nsipresshell apresshell, in nsiweakreference aweakshell, inout nsiframe framehint, out boolean aishidden); nsiaccessible addnativerootaccessible(in voidptr aatkaccessible); void removenativerootaccessible(in nsiaccessible arootaccessible); void invali
datesubtreefor(in nsipresshell apresshell, in nsicontent achangedcontent, in pruint32 aevent); methods removenativerootaccessible() void removenativerootaccessible( in nsiaccessible arootaccessible ); invali
datesubtreefor() invali
date the accessibility cache associated with apresshell, for accessibles that were generated for acontainercontent and it's subtree.
... void invali
datesubtreefor( in nsipresshell apresshell, in nsicontent achangedcontent, in pruint32 aevent ); parameters <tt>apresshell</tt> the presshell where changes occured.
nsIBrowserHistory
you should use moziasynchistory.up
dateplaces() instead.
... adobatchnotify obsolete since gecko 9.0 if set to true, the beginup
datebatch and endup
datebatch events are sent; otherwise, no notification of changes to the history is provided.
nsICacheSession
if false, expired entries will be returned (useful for offline mode and clients, such as http, that can up
date the valid lifetime of cached content).
...if blockingmode is set to false, it will return ns_error_cache_wait_for_validation rather than block when another descriptor has been given write access but hasn't vali
dated the entry yet.
nsICachingChannel
depending on the value of nsirequest.loadflags(), the cache entry may be vali
dated, overwritten, or simply read.
...the implementation of nsicachingchannel would be expected to only read from the cache entry identified by the cache token and not try to vali
date it.
nsICategoryManager
var content_type = 'application/pdf'; // up
date the category manager in case the plugins are already loaded.
... let categorymanager = cc['@mozilla.org/categorymanager;1']; categorymanager.getservice(ci.nsicategorymanager).deletecategoryentry('gecko-content-viewers', content_type, false); // up
date pref manager to prevent plugins from loading in future var stringtypes = ''; var types = []; var pref_disabled_plugin_types = 'plugin.disable_full_page_plugin_for_types'; if (services.prefs.prefhasuservalue(pref_disabled_plugin_types)) { stringtypes = services.prefs.getcharpref(pref_disabled_plugin_types); } if (stringtypes !== '') { types = stringtypes.split(','); } if (types.indexof(content_type) === -1) { types.push(content_type); } services.prefs.setcharpref(pref_disabled_plugin_types, types.join(',')); remarks categories have a variety of uses throughout the mozilla platform.
nsICookieService
setcookiestring() will query the documenturi property off of nsihttpchannelinternal if supported, and setcookiestring() could also query the
date header from the channel if achannel supports nsihttpchannel.
... aservertime the expiry information of the cookie (the
date header from the http response).
nsIDOMGeoPositionCallback
the nsidomgeopositioncallback interface is called when up
dated position information is available.
...void handleevent( in nsidomgeoposition position ); parameters position an nsidomgeoposition object indicating the up
dated location information.
nsIDOMMozNetworkStats
start
date start
date of the stats samples.
... end
date end
date of the stats samples.
nsIDOMWindowInternal
add-ons should be up
dated to use nsidomwindow instead.
...if the name doesn't exist, then a new window is opened and the specified resource is loaded into its browsing context.">open(in domstring url, in domstring name, in domstring options) nsidomwindow nsisupports aextraargument) void close() void up
datecommands(in domstring action) boolean find([optional] in domstring str,[optional] in boolean casesensitive, [optional] in boolean backwards, [optional] in boolean wraparound, [optional] in boolean wholeword, [optional] in boolean searchinframes, [optional] in boolean showdialog) domstring atob(in domstring aasciistring) domstring btoa(in domstring abase64data) ...
nsIDocShell
setting this attribute overrides the encoding; however, to up
date the dom or display of the content, you need have the data reparsed.
...an active docshell is one that is currently visible, which means it's not a good candi
date for optimizations such as image frame discarding.
nsIJumpListBuilder
applications that use recent or frequent lists should keep document use tracking up to
date by calling the shaddtorecentdocs shell api.
...applications that use recent or frequent lists should keep document use tracking up to
date by calling the shaddtorecentdocs shell api.
nsILocale
intl/locale/idl/nsilocale.idlscriptable represents one locale, which can be used for things like sorting text strings and formatting numbers,
dates and times.
...nsilocale_time -
date and time formats.
nsIMsgDBHdr
date prtime indicates the
date of this message; the equivalent header is the
date: header.
...
dateinseconds unsigned long readonly: indicates the
date of this message as a unix timestamp.
nsINavHistoryResult
while the result waits to be collected it will stay in memory, and continue to up
date itself, potentially causing unwanted additional work.
...changing this value up
dates the corresponding options for the result so that reusing the current options and queries will always return results based on the current view.
nsINavHistoryVisitResultNode
it describes a visit to an entry; you can use it to determine the
date and time of the last time the user visited a particular page, for example.
... 1.0 66 introduced gecko 1.9 inherits from: nsinavhistoryresultnode last changed in gecko 1.9 (firefox 3) attributes attribute type description sessionid long long the session id of the visit, used for session grouping when a tree view is sorted by
date.
nsITreeColumn
nsitreecolumn getnext(); nsitreecolumn getprevious(); void invali
date(); attributes attribute type description atom nsiatom the atom attribute of nsitreecolumn which returns an nsiatom for the column, making it fast to do comparisons.
...invali
date() void invali
date(); parameters none.
nsIURIFixup
nsiuri createfixupuri( in autf8string auritext, in unsigned long afixupflags ); parameters auritext candi
date uri.
... nsiuri createfixupuri( in autf8string auritext, in unsigned long afixupflags ); parameters auritext candi
date uri.
nsMsgViewSortType
for example to sort by
date you would pass a function the value: components.interfaces.nsmsgviewsorttype.by
date mailnews/base/public/nsimsgdbview.idlscriptable please add a summary to this article.
... last changed in gecko 1.9 (firefox 3) constants name value description bynone 0x11 not sorted by
date 0x12 bysubject 0x13 byauthor 0x14 byid 0x15 bythread 0x16 bypriority 0x17 bystatus 0x18 bysize 0x19 byflagged 0x1a byunread 0x1b byrecipient 0x1c bylocation 0x1d bytags 0x1e byjunkstatus 0x1f byattachments 0x20 byaccount 0x21 bycustom 0x22 byreceived 0x23 ...
XPCOM reference
for example to sort by
date you would pass a function the value:nsmsgviewsorttypethe nsmsgviewsorttype interface contains constants used for sorting the thunderbird threadpane.
...for example to sort by
date you would pass a function the value:nsmsgviewtypethe nsmsgviewtype interface contains constants used for views in thunderbird.
Working with Multiple Versions of Interfaces
the problem in this short note we illustrate how one can up
date an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.
...mine
date back to august of 2006, which is when i first built the lizard.
Buddy icons in mail
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2003.
Cached compose window FAQ
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2003.
Creating a gloda message query
gloda.
daterange([lower
date1, upper
date1], [lower
date2, upper
date2], ...): add the constraint that the message
date (per the message's
date header) must fall within one of the specified inclusive ranges.
... the
date instances are javascript
date instances.
Spam filtering
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2003.
The libmime module
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2002.
Thunderbird Binaries
trunk builds contain the very latest bleeding-edge changes and up
dates, as well as 64-bit builds for windows.
...trunk builds contain the very latest bleeding-edge changes and up
dates.
Activity Manager examples
tate = components.interfaces.nsiactivityprocess.state_completed; gactivitymanager.removeactivity(process.id); let event = components.classes["@mozilla.org/activity-event;1"].createinstance(nsiae); // localization is omitted, initiator is omitted event.init(folder.prettiestname + " is processed", null, "no junk found", process.starttime, // start time
date.now()); // completion time event.contexttype = process.contexttype; // optional event.contextobj = process.contextobj; // optional gactivitymanager.addactivity(event); showing a user-defined activity with cancel capability (javascript) this sample improves the previous one by providing an nsiactivitycancelhandler to allow the user to cancel the process.
...(this example seems to be out
dated and not working, see bug 557467 comment 1.) //optional: define some convenience constants const nsactprocess = components.constructor("@mozilla.org/activity-process;1", "nsiactivityprocess", "init"); const nsactevent = components.constructor("@mozilla.org/activity-event;1", "nsiactivityevent", "init"); // step...
Theme Packaging
the documentation here is out of
date.
...see the install.rdf reference for more information: em:id em:version em:type em:targetapplication em:name em:internalname optional install.rdf properties em:description em:creator em:contributor em:homepageurl em:up
dateurl note that if your theme will be made available on the https://addons.mozilla.org website, it may not include an up
dateurl.
Thunderbird extensions
learn more about gloda: an overview of gloda how to create your first message query and read the gloda examples gloda internals: gloda debugging, gloda indexing more thunderbird-specific links some links may be out of
date, but they still provide valuable information on the codebase.
...ibrary (obsolete as of thunderbird 52, use https://github.com/protz/thunderbird-stdlib) developing new account types useful newsgroup discussions (anything that's very old should be regarded suspiciously, because there has been significant api rewrite over the past years making most techniques considerably easier) thunderbird api docs (mostly a collection of out-of-
date pages, relevance is rather dubious) general links finding the code for a feature mozillazine articles on thunderbird community / communications thunderbird specific : add-ons section on developer.thunderbird.net thunderbird communication channels add-on developers forum/mailing list #maildev irc channel more gene...
libmime content type handlers
warning: the content of this article may be out of
date.
... it was imported from mozilla.org and last up
dated in 2001.
Toolkit version format
this format is used by the extension manager, software up
date, and other parts of the platform.
... versions in at least the following places must conform to this format: addon's and target application's version in install and up
date manifests.
Using tab-modal prompts
note: this part of the documentation is out
dated.
... the up
dated prompt documentation can be found in the firefox source docs.
Add to iPhoto
some of this may change as i refine the example in the future; i'll up
date the article if and when that happens.
...this is done using the js-ctypes library object's declare() method, just like importing a function: this.kcftypearraycallbacks = this.lib.declare("kcftypearraycallbacks", this.cfarraycallbacks); note: for the record, this is the part that requires a nightly build of firefox 3.7a5pre
dated april 16, 2010 or later; this capability was introduced in that build.
Blocking By Domain - Plugins
list contents and up
dates the plugin block lists are freely-licensed lists maintained by mozilla in github.
...subsequent up
dates to the list will be made using telemetry from firefox experiments.
Browser Side Plug-in API - Plugins
npn_invali
daterect invali
dates specified drawing area prior to repainting or refreshing a windowless plug-in.
... npn_invali
dateregion invali
dates specified drawing region prior to repainting or refreshing a windowless plug-in.
Plug-in Development Overview - Plugins
npn_invali
daterect: invali
date an area in a windowless plug-in before repainting or refreshing.
... npn_invali
dateregion: invali
date an area in a windowless plug-in before repainting or refreshing.
Version, UI, and Status Information - Plugins
displaying a status line message users are accustomed to checking the ui status line at the bottom of the browser window for up
dates on the progress of an operation or the url of a link on the page.
...consider using this function as part of the plug-in's smartup
date process.
Gecko Plugin API Reference - Plugins
npn_invali
daterect invali
dates specified drawing area prior to repainting or refreshing a windowless plug-in.
... npn_invali
dateregion invali
dates specified drawing region prior to repainting or refreshing a windowless plug-in.
Console messages - Firefox Developer Tools
synchronous and asynchronous reflows if a change is made that invali
dates the current layout — for example, the browser window is resized or some javascript modifies an element's css — the layout is not recalculated immediately.
...us, reflow, when it calls window.getcomputedstyle(thing).height: var thing = document.getelementbyid("the-thing"); thing.style.display = "inline-block"; var thingheight = window.getcomputedstyle(thing).height; because of this, it's a good idea to avoid interleaving write and read calls to an element's styles when manipulating the dom, because every time you read back a style that has been invali
dated by a previous write call, you force a synchronous reflow.
Rich output - Firefox Developer Tools
in particular, it: provides extra information for certain types enables detailed examination of the object's properties provides richer information for dom elements, and enables you to select them in the inspector type-specific rich output the web console provides rich output for many object types, including the following: object array
date promise regexp window document element event examining object properties when an object is logged to the console it has a right-pointing triangle next to it, indicating that it can be expanded.
...for example, by expanding the array in the above list, i get the following: console.log(todolist) (4) […] ​ 0: object { status: "done", description: "morning pages",
datecreated: 1552404478137 } ​ 1: object { status: "in progress", description: "refactor styles",
datecreated: 1552404493169 } ​ 2: object { status: "to do", description: "create feedback form",
datecreated: 1552404512630 } ​ 3: object { status: "to do", description: "normalize table",
datecreated: 1552404533790 } ​ length: 4 ​ <prototype>: array [] debugger eval code:1:9 undefined highligh...
about:debugging (before Firefox 68) - Firefox Developer Tools
updating a temporary add-on if you install the add-on in this way, what happens when you up
date the add-on's files?
...as soon as a worker is registered, the listing is up
dated: before firefox 47, service workers were only shown when they were actually running.
about:debugging - Firefox Developer Tools
updating a temporary extension if you install an extension in this way, what happens when you up
date the extension?
...until such time as firefox for android is up
dated to a newer major release, in synch with desktop firefox, you should use one of the following firefox for android versions: firefox preview, if your desktop firefox is the main release or developer edition firefox for android nightly if you prefer to test with the main release of firefox for android (i.e., based on release 68), you can do so with the desktop firefox extended support release...
AbsoluteOrientationSensor - Web APIs
specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
AbsoluteOrientationSensor - Web APIs
} else { console.log("no permissions to use absoluteorientationsensor."); } }); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Accelerometer.x - Web APIs
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Accelerometer.y - Web APIs
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Accelerometer.z - Web APIs
ometer({frequency: 60}); accelerometer.addeventlistener('reading', e => { console.log("acceleration along the x-axis " + accelerometer.x); console.log("acceleration along the y-axis " + accelerometer.y); console.log("acceleration along the z-axis " + accelerometer.z); }); accelerometer.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Accelerometer - Web APIs
let acl = new accelerometer({frequency: 60}); acl.addeventlistener('reading', () => { console.log("acceleration along the x-axis " + acl.x); console.log("acceleration along the y-axis " + acl.y); console.log("acceleration along the z-axis " + acl.z); }); acl.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
AmbientLightSensor.illuminance - Web APIs
example if ( 'ambientlightsensor' in window ) { const sensor = new ambientlightsensor(); sensor.onreading = () => { console.log('current light level:', sensor.illuminance); }; sensor.onerror = (event) => { console.log(event.error.name, event.error.message); }; sensor.start(); } specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
AmbientLightSensor - Web APIs
example if ( 'ambientlightsensor' in window ) { const sensor = new ambientlightsensor(); sensor.onreading = () => { console.log('current light level:', sensor.illuminance); }; sensor.onerror = (event) => { console.log(event.error.name, event.error.message); }; sensor.start(); } specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
AudioContext.createMediaElementSource() - Web APIs
when the mouse pointer is moved, the up
datepage() function is invoked, which calculates the current gain as a ratio of mouse y position divided by overall window height.
...ourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and height of screen var cury; var height = window.innerheight; // get new mouse pointer coordinates when mouse is moved // then set new gain value document.onmousemove = up
datepage; function up
datepage(e) { cury = (window.event) ?
AudioTrackList.onchange - Web APIs
example this snippet establishes a handler for the change event that looks at each of the tracks in the list, calling a function to up
date the state of a user interface control that indicates the current state of the track.
... var tracklist = document.queryselector("video").audiotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { up
datetrackenabledbutton(track.id, track.enabled); }); }; the up
datetrackenabledbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's enabled flag to determine which state the control should be in now.
AudioTrackList - Web APIs
to keep it up to
date, handlers for the addtrack and removetrack events are set up.
... audiotracks.onaddtrack = up
datetrackcount; audiotracks.onremovetrack = up
datetrackcount; function up
datetrackcount(event) { trackcount = audiotracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'audiotracklist' in that specification.
BatteryManager.onchargingchange - Web APIs
these events occur when the battery charging state is up
dated.
...ontent navigator.getbattery().then(function(battery) { battery.onchargingchange = chargingchange(); function chargingchange() { document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candi
date recommendation initial definition ...
BatteryManager.onchargingtimechange - Web APIs
these events occur when the battery chargingtime is up
dated.
...etbattery().then(function(battery) { battery.onchargingtimechange = chargingtimechange(); function chargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candi
date recommendation initial definition ...
BatteryManager.ondischargingtimechange - Web APIs
these events occur when the battery dischargingtime is up
dated.
...ry().then(function(battery) { battery.ondischargingtimechange = dischargingtimechange; function dischargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candi
date recommendation initial definition ...
BatteryManager.onlevelchange - Web APIs
these events occur when the battery level is up
dated.
...battery.charging) { document.queryselector('#statebaterry').textcontent = "charging time: " + (battery.chargingtime / 60); } else { document.queryselector('#statebaterry').textcontent = "discharging time: " + (battery.dischargingtime / 60); } }; }); specifications specification status comment battery status api candi
date recommendation initial definition ...
CSSStyleSheet - Web APIs
cssrules read only returns a live cssrulelist which maintains an up-to-
date list of the cssrule objects that comprise the stylesheet.
... rules read only the rules property is functionally identical to the standard cssrules property; it returns a live cssrulelist which maintains an up-to-
date list of all of the rules in the style sheet.
CSS Object Model (CSSOM) - Web APIs
screen orientation api working draft css fonts module level 3 candi
date recommendation css animations working draft css transitions working draft css custom properties for cascading variables module level 1 candi
date recommendation css conditional rules module level 3 candi
date recommendation defined the css interface.
... css device adaptation working draft css counter styles level 3 candi
date recommendation document object model (dom) level 2 style specification obsolete initial definition.
Using the CSS Typed Object Model - Web APIs
up
date the javascript on line 2 to select the <p> rather than the <a>.
... .get() method / custom properties let's up
date our example to only retrieve a few properties and values.
DeprecationReportBody - Web APIs
anticipatedremoval a
date object (rendered as a string) representing the
date when the feature is expected to be removed from the current browser.
... if the
date is not known, this property will return null.
Document.evaluate() - Web APIs
modifying a node will invali
date the iterator.
...modifying the document doesn't invali
date the snapshot; however, if the document is changed, the snapshot may not correspond to the current state of the document, since nodes may have moved, been changed, added, or removed.
Introduction to the DOM - Web APIs
you can up
date the contents of the test() function as needed, create more buttons, or add elements as necessary.
... figure 0.1 sample dom test page in this example, the drop-down menus dynamically up
date such dom—accessible aspects of the web page as its background color (bgcolor), the color of the hyperlinks (alink), and color of the text (text).
Element - Web APIs
compositionup
date fired when a new character is received in the context of a text composition session controlled by a text composition system such as an input method editor.
... candi
date recommendation added the requestpointerlock() method.
EventSource - Web APIs
for example, eventsource is a useful approach for handling things like social media status up
dates, news feeds, or delivering data into a client-side storage mechanism like indexeddb or web storage.
... const sse = new eventsource('/api/v1/sse'); /* this will listen only for events * similar to the following: * * event: notice * data: useful data * id: someid * */ sse.addeventlistener("notice", function(e) { console.log(e.data) }) /* similarly, this will listen for events * with the field `event: up
date` */ sse.addeventlistener("up
date", function(e) { console.log(e.data) }) /* the event "message" is a special case, as it * will capture events without an event field * as well as events that have the specific type * `event: message` it will not trigger on any * other event type.
FetchEvent - Web APIs
if it finds a match in the cache, it asynchronously up
dates the cache for next time.
... const cache = await caches.open('dynamic-v1'); const cachedresponse = await cache.match(event.request); if (cachedresponse) { // if we found a match in the cache, return it, but also // up
date the entry in the cache in the background.
GeolocationCoordinates.longitude - Web APIs
from the geolocationposition object, we obtain the user's latitude and longitude using position.coords.latitude and position.coords.longitude so we can up
date the displayed coordinates.
... the two <span> elements are up
dated to display the corresponding values after being converted to a value with two decimal places.
GlobalEventHandlers - Web APIs
globaleventhandlers.ontimeup
date is an eventhandler representing the code to be called when the timeup
date event is raised.
... candi
date recommendation adds onpointerlockchange and onpointerlockerror on document.
Gyroscope.Gyroscope() - Web APIs
specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Gyroscope.x - Web APIs
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocity along the x-axis " + gyroscope.x); console.log("angular velocity along the y-axis " + gyroscope.y); console.log("angular velocity along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Gyroscope.y - Web APIs
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocety along the x-axis " + gyroscope.x); console.log("angular velocety along the y-axis " + gyroscope.y); console.log("angular velocety along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Gyroscope.z - Web APIs
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocety along the x-axis " + gyroscope.x); console.log("angular velocety along the y-axis " + gyroscope.y); console.log("angular velocety along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Gyroscope - Web APIs
new gyroscope({frequency: 60}); gyroscope.addeventlistener('reading', e => { console.log("angular velocity along the x-axis " + gyroscope.x); console.log("angular velocity along the y-axis " + gyroscope.y); console.log("angular velocity along the z-axis " + gyroscope.z); }); gyroscope.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation initial definition.
HTMLDialogElement.open - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // up
date button opens a modal dialog up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement.returnValue - Web APIs
<p><label>favorite animal: <select name="favanimal" required> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button>cancel</button> <button>confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if (dialog.open) { console.log('dialog open'); } else { console.log('dialog closed'); ...
... } } function handleuserinput(returnvalue) { if (returnvalue === 'cancel' || returnvalue == null) { // user canceled the dialog, do nothing } else if (returnvalue === 'confirm') { // user chose a favorite animal, do something with it } } // “up
date details” button opens the <dialog> modally up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); handleuserinput(dialog.returnvalue); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement.show() - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // up
date button opens a modal dialog up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> specifications specification status comment html living standardthe definition of 'show()' in that specification.
HTMLDialogElement.showModal() - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // up
date button opens a modal dialog up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLDialogElement - Web APIs
d="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="up
datedetails">up
date details</button> </menu> <script> (function() { var up
datebutton = document.getelementbyid('up
datedetails'); var cancelbutton = document.getelementbyid('cancel'); var dialog = document.getelementbyid('favdialog'); dialog.returnvalue = 'favanimal'; function opencheck(dialog) { if(dialog.open) { console.log('dialog open'); ...
... } else { console.log('dialog closed'); } } // up
date button opens a modal dialog up
datebutton.addeventlistener('click', function() { dialog.showmodal(); opencheck(dialog); }); // form cancel button closes the dialog box cancelbutton.addeventlistener('click', function() { dialog.close('animalnotchosen'); opencheck(dialog); }); })(); </script> note: you can find this example on github as htmldialogelement-basic (see it live also).
HTMLElement: beforeinput event - Web APIs
bubbles yes cancelable yes interface inputevent event handler property none sync / async sync composed yes default action up
date the dom element examples this example logs current value of the element immediately before replacing that value with the new one applied to the <input> element.
... html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('values'); input.addeventlistener('beforeinput', up
datevalue); function up
datevalue(e) { log.textcontent = e.target.value; } result specifications specification status ui eventsthe definition of 'beforeinput event' in that specification.
HTMLElement: change event - Web APIs
depending on the kind of element being changed and the way the user interacts with the element, the change event fires at a different moment: when the element is :checked (by clicking or using the keyboard) for <input type="radio"> and <input type="checkbox">; when the user commits the change explicitly (e.g., by selecting a value from a <select>'s dropdown with a mouse click, by selecting a
date from a
date picker for <input type="
date">, by selecting a file in the file picker for <input type="file">, etc.); when the element loses focus after its value was changed, but not commited (e.g., after editing the value of <textarea> or <input type="text">).
... html <input placeholder="enter some text" name="name"/> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.addeventlistener('change', up
datevalue); function up
datevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'change' in that specification.
HTMLFormElement.elements - Web APIs
this is a live collection; if form controls are added to or removed from the form, this collection will up
date to reflect the change.
... var inputs = document.getelementbyid("my-form").elements; // iterate over the form controls for (i = 0; i < inputs.length; i++) { if (inputs[i].nodename === "input" && inputs[i].type === "text") { // up
date text input inputs[i].value.tolocaleuppercase(); } } disabling form controls var inputs = document.getelementbyid("my-form").elements; // iterate over the form controls for (i = 0; i < inputs.length; i++) { // disable all form controls inputs[i].setattribute("disabled", ""); } specifications specification status comment html living standardthe definition of...
HTMLFormElement - Web APIs
htmlformelement.novali
date a boolean reflecting the value of the form's novali
date html attribute, indicating whether the form should not be vali
dated.
...the following properties have been added: autocomplete, novali
date, and encoding.
HTMLImageElement.height - Web APIs
<p>image height: <span class="size">?</span>px (resize to up
date)</p> <img src="/files/17373/clock-demo-200px.png" alt="clock" srcset="/files/17373/clock-demo-200px.png 200w, /files/17374/clock-demo-400px.png 400w" sizes="(max-width: 400px) 200px, 300px"> javascript the javascript code looks at the height to determine the height of the image given the width at which it's currently drawn.
... var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const up
dateheight = event => { output.innertext = clockimage.height; }; window.addeventlistener("load", up
dateheight); window.addeventlistener("resize", up
dateheight); result this example may be easier to try out in its own window.
HTMLImageElement.width - Web APIs
<p>image width: <span class="size">?</span>px (resize to up
date)</p> <img src="/files/16864/clock-demo-200px.png" alt="clock" srcset="/files/16864/clock-demo-200px.png 200w, /files/16797/clock-demo-400px.png 400w" sizes="(max-width: 400px) 200px, 400px"> javascript the javascript code looks at the width to determine the width of the image at the moment.
... var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const up
datewidth = event => { output.innertext = clockimage.width; }; window.addeventlistener("load", up
datewidth); window.addeventlistener("resize", up
datewidth); result this example may be easier to try out in its own window.
HTMLImageElement - Web APIs
this specifies a list of candi
date images, separated by commas (',', u+002c comma).
... each candi
date image is a url followed by a space, followed by a specially-formatted string indicating the size of the image.
HTMLMediaElement - Web APIs
durationchange fired when the duration attribute has been up
dated.
... timeup
date fired when the time indicated by the currenttime attribute has been up
dated volumechange fired when the volume has changed.
HTMLTableElement - Web APIs
the htmlcollection is live and is automatically up
dated when the htmltableelement changes.
...the htmlcollection is live and is automatically up
dated when the htmltableelement changes.
The HTML DOM API - Web APIs
among the things added to document by the html standard are: support for accessing various information provided by the http headers when loading the page, such as the location from which the document was loaded, cookies, modification
date, referring site, and so forth.
... eventsource examples in this example, an <input> element's input event is monitored in order to up
date the state of a form's "submit" button based on whether or not a given field currently has a value.
Drag Operations - Web APIs
the mouse pointer will up
date as necessary depending on the value of the dropeffect property.
... however, you can also up
date the user interface with an insertion point or highlight as needed.
Working with the History API - Web APIs
here too, going back doesn't change the document's contents from what they were in the previous step, although the document might up
date its contents manually upon receiving the popstate event.
... replacestate() is particularly useful when you want to up
date the state object or url of the current history entry in response to some user action.
IDBCursor - Web APIs
idbcursor.up
date() returns an idbrequest object, and, in a separate thread, up
dates the value at the current position of the cursor in the object store.
... this can be used to up
date specific records.
IDBIndex - Web APIs
the records in an index are automatically populated whenever records in the referenced object store are inserted, up
dated, or deleted.
...when the object store changes, all indexes that refers to the object store are automatically up
dated.
IDBRequest.error - Web APIs
example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store.
... var title = "walk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the do-do list with the specified title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var up
datetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; objectstoretitlerequest.one...
IDBRequest.onerror - Web APIs
}; example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var up
datetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; objectstoretitlerequest.one...
IDBRequest.onsuccess - Web APIs
}; example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item back // into the database var up
datetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; specifications sp...
IDBRequest.result - Web APIs
syntax var myresult = request.result; value any example the following example requests a given record title, onsuccess gets the associated record from the idbobjectstore (made available as objectstoretitlerequest.result), up
dates one property of the record, and then puts the up
dated record back into the object store.
...alk dog"; // open up a transaction as usual var objectstore = db.transaction(['todolist'], "readwrite").objectstore('todolist'); // get the to-do list object that has this title as it's title var objectstoretitlerequest = objectstore.get(title); objectstoretitlerequest.onsuccess = function() { // grab the data object returned as the result var data = objectstoretitlerequest.result; // up
date the notified value in the object to "yes" data.notified = "yes"; // create another request that inserts the item // back into the database var up
datetitlerequest = objectstore.put(data); // when this new request succeeds, run the displaydata() // function again to up
date the display up
datetitlerequest.onsuccess = function() { displaydata(); }; }; specifications sp...
IDBVersionChangeRequest.setVersion() - Web APIs
the idbversionchangerequest.setversion method up
dates the version of the database, returning immediately and running a versionchange transaction on the connected database in a separate thread.
...some not up-to-
date browsers still implement this method.
IndexedDB API - Web APIs
you need to specify the database schema, open a connection to your database, and then retrieve and up
date data within a series of transactions.
...they are still documented in case you need to up
date previously written code: idbversionchangerequest represents a request to change the version of a database.
install - Web APIs
as with the older startsoftwareup
date method, xpis installed with this method must have their own install.js files in which the full installation is defined.
... in contrast to startsoftwareup
date, install allows you to do multiple installs with the same trigger and provides a unified user experience for the multiple installs.
InstallTrigger - Web APIs
note: this article needs to be up
dated somewhat.
... startsoftwareup
date triggers the downloading and installation of the software at the specified url.
LinearAccelerationSensor.x - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
LinearAccelerationSensor.y - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
LinearAccelerationSensor.z - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
LinearAccelerationSensor - Web APIs
tionsensor({frequency: 60}); lasensor.addeventlistener('reading', e => { console.log("linear acceleration along the x-axis " + lasensor.x); console.log("linear acceleration along the y-axis " + lasensor.y); console.log("linear acceleration along the z-axis " + lasensor.z); }); lasensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
LockedFile.getMetadata() - Web APIs
the following metadata are supported: size : will provide the size of the file lastmodified : will provide the
date when the file was last modified return a filerequest object.
...they have the following format: size : a number lastmodified : a
date object specifications specification status comment filesystem api editor's draft draft proposal ...
Magnetometer.x - Web APIs
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Magnetometer.y - Web APIs
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Magnetometer.z - Web APIs
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
Magnetometer - Web APIs
r = new magnetometer({frequency: 60}); magsensor.addeventlistener('reading', e => { console.log("magnetic field along the x-axis " + magsensor.x); console.log("magnetic field along the y-axis " + magsensor.y); console.log("magnetic field along the z-axis " + magsensor.z); }); magsensor.start(); specifications specification status comment generic sensor api candi
date recommendation defines sensors in general.
... candi
date recommendation ...
MediaDevices: devicechange event - Web APIs
bubbles no cancelable no interface event event handler ondevicechange example you can use the devicechange event in an addeventlistener method: navigator.mediadevices.addeventlistener('devicechange', function(event) { up
datedevicelist(); }); or use the ondevicechange event handler property: navigator.mediadevices.ondevicechange = function(event) { up
datedevicelist(); } specifications specification status media capture and streamsthe definition of 'devicechange' in that specification.
... candi
date recommendation ...
MediaDevices.getUserMedia() - Web APIs
overconstrainederror the specified constraints resulted in no candi
date devices which met the criteria requested.
... candi
date recommendation initial definition ...
MediaElementAudioSourceNode - Web APIs
when the mouse pointer is moved, the up
datepage() function is invoked, which calculates the current gain as a ratio of mouse y position divided by overall window height.
...ourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and height of screen var cury; var height = window.innerheight; // get new mouse pointer coordinates when mouse is moved // then set new gain value document.onmousemove = up
datepage; function up
datepage(e) { cury = (window.event) ?
MediaSession.setPositionState() - Web APIs
the mediasession method setpositionstate() is used to up
date the current document's media playback position and speed for presentation by user's device in any kind of interface that provides details about ongoing media.
... syntax navigator.mediasession.setpositionstate(statedict); parameters statedict optional an object conforming to the mediapositionstate dictionary, providing up
dated information about the playback position and speed of the document's ongoing media.
MediaSource.duration - Web APIs
invalidstateerror mediasource.readystate is not equal to open, or one or more of the sourcebuffer objects in mediasource.sourcebuffers are being up
dated (i.e.
... example the following snippet is based on a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('up
dateend', function (_) { mediasource.endofstream(); mediasource.duration = 120; video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; ...
MediaSource.endOfStream() - Web APIs
return value undefined exceptions exception explanation invalidstateerror mediasource.readystate is not equal to open, or one or more of the sourcebuffer objects in mediasource.sourcebuffers are being up
dated (i.e.
... = url.createobjecturl(mediasource); mediasource.addeventlistener('sourceopen', sourceopen); } else { console.error('unsupported mime type or codec: ', mimecodec); } function sourceopen (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('up
dateend', function (_) { mediasource.endofstream(); video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; specifications specification status comment media source extensionsthe definition of 'endofstream()' in that specification.
active - Web APIs
when that stream becomes available (that is, when the returned promise is fulfilled, a button on the page is up
dated based on whether or not the stream is currently active.
... candi
date recommendation initial definition.
MediaStreamTrack.enabled - Web APIs
usage notes if the mediastreamtrack represents the video input from a camera, disabling the track by setting enabled to false also up
dates device activity indicators to show that the camera is not currently recording or streaming.
... candi
date recommendation initial specification.
MediaStreamTrack - Web APIs
candi
date recommendation additional properties for isolated track support media capture and streamsthe definition of 'mediastreamtrack' in that specification.
... candi
date recommendation initial definition ...
MediaTrackConstraints.deviceId - Web APIs
however, the value of the deviceid is determined by the source of the track's content, and there's no particular format man
dated by the specification (although some kind of guid is recommended).
... candi
date recommendation initial specification.
MediaTrackConstraints.groupId - Web APIs
however, the value of the groupid is determined by the source of the track's content, and there's no particular format man
dated by the specification (although some kind of guid is recommended).
... candi
date recommendation initial specification.
MerchantValidationEvent() - Web APIs
validationurl optional the url from which to retrieve payment handler specific verification information used to vali
date the merchant.
... candi
date recommendation initial definition.
MerchantValidationEvent.validationURL - Web APIs
the merchantvalidationevent property validationurl is a read-only string value providing the url from which to fetch the payment handler-specific data needed to vali
date the merchant.
... candi
date recommendation initial definition.
Metadata - Web APIs
this metadata includes the file's size and modification
date and time.
... properties modificationtime read only a
date object indicating the
date and time the entry was modified.
Using Navigation Timing - Web APIs
for example, to measure the perceived loading time for a page: window.addeventlistener("load", function() { let now = new
date().gettime(); let loadingtime = now - performance.timing.navigationstart; document.queryselector(".output").innertext = loadingtime + " ms"; }, false); this code, executed when the load event occurs, subtracts from the current time the time at which the navigation whose timing was recorded began (performance.timing.navigationstart), and outputs that information to the screen by inse...
...the new code looks like this: window.addeventlistener("load", function() { let now = new
date().gettime(); let loadingtime = now - performance.timing.navigationstart; output = "load time: " + loadingtime + " ms<br/>"; output += "navigation type: "; switch(performance.navigation.type) { case performancenavigation.type_navigate: output += "navigation"; break; case performancenavigation.type_reload: output += "reload"; break; case performan...
Navigator.registerProtocolHandler() - Web APIs
syntax navigator.registerprotocolhandler(scheme, url, title); note: recently up
dated to navigator.registerprotocolhandler(scheme, url), but no browsers currently support this version.
...it is recommended to always set the title, since browsers that support the up
dated spec most likely will be backwards-compatible and still accept the title (but not use it).
Navigator.onLine - Web APIs
the property sends up
dates whenever the browser's ability to connect to the network changes.
... the up
date occurs when the user follows links or when a script requests a remote page.
PayerErrors.email - Web APIs
example function vali
datepayment(response) { const correctionpromises let paymenterrors = {}; let payererrors = {}; // check payer details if (!validemail(response.payeremail)) { payererrors.email = "please make sure you enter a valid email address." } if (!validname(response.payername)) { payererrors.email = "please enter a valid name, using only <appropriate characters>." } if (!validphone(re...
... candi
date recommendation initial definition.
PaymentAddress.country - Web APIs
syntax var paymentcountry = paymentaddress.country; value a domstring which contains the iso3166-1 alpha-2 code identifying the country in which the address is located, or an empty string if no country is available, which frequently can be assumed to mean "same country as the site owner." usage notes if the payment handler vali
dates the address and determines that the value of country is invalid, a call to paymentrequestup
dateevent.up
datewith() will be made with a details object containing a shippingaddresserrors field.
... candi
date recommendation initial definition.
PaymentCurrencyAmount.value - Web APIs
see the example verifying a properly formatted price below for a simple regular expression that can be used to vali
date the value string prior to submission.
... candi
date recommendation ...
PaymentMethodChangeEvent.methodDetails - Web APIs
ev.up
datewith(newstuff); }; const response = await request.show(); note that the methoddetails property is being used by the calculatediscount() function to compute any payment discount, then up
datewith() is called to up
date the event with the computed up
date.
... candi
date recommendation initial definition.
PaymentMethodChangeEvent.methodName - Web APIs
ev.up
datewith(newstuff); }; const response = await request.show(); specifications specification status comment payment request apithe definition of 'paymentmethodchangeevent.methodname' in that specification.
... candi
date recommendation initial definition.
PaymentRequest.onpaymentmethodchange - Web APIs
ev.up
datewith(newstuff); }; const response = await request.show(); specifications specification status comment payment request apithe definition of 'onpaymentmethodchange' in that specification.
... candi
date recommendation initial definition.
PaymentRequest - Web APIs
events merchantvalidation secure context with some payment handlers (e.g., apple pay), this event handler is called to handle the merchantvalidation event, which is dispatched when the user agent requires that the merchant vali
date that the merchant or vendor requesting payment is legitimate.
... candi
date recommendation initial definition.
PaymentResponse - Web APIs
allows the developer to revali
date any requested user data (e.g., the phone number or the email address) if it changes.
... candi
date recommendation initial definition.
Performance - Web APIs
candi
date recommendation changes getentries() interface.
... candi
date recommendation defines clearresourcetimings() and setresourcetimingbuffersize() methods and the onresourcetimingbufferfull property.
PerformanceEntry - Web APIs
" + properties[i] + " is not supported"); } } } specifications specification status comment resource timing level 3 editor's draft resource timing level 2 working draft resource timing level 1 candi
date recommendation adds the performanceresourcetiming interface and the resource value for entrytype.
... candi
date recommendation added tojson() serializer method.
Performance API - Web APIs
as such, the performance api defines a domhighrestimestamp type rather than using the
date.now() interface.
... performance timeline level 2 candi
date recommendation adds serializer to the performanceentry interface as well as adding the performanceobserver interface and callback resource timing level 1 candi
date recommendation adds the performanceresourcetiming interface.
PointerEvent - Web APIs
pointerrawup
date this event is fired when any of a pointer's properties change.
... editor's draft added the getcoalescedevents() and getpredictedevents() methods and pointerrawup
date event.
Using Pointer Events - Web APIs
its responsibility in this example is to up
date the cached touch information and to draw a line from the previous position to the current position of each touch.
... // and a square at the end ongoingtouches.splice(idx, 1); // remove it; we're done } else { log("can't figure out which touch to end"); } } this is very similar to the previous function; the only real differences are that we draw a small square to mark the end and that when we call array.splice(), we simply remove the old entry from the ongoing touch list, without adding in the up
dated information.
Pointer events - Web APIs
the target element (node) should be large enough to accommo
date the largest contact surface area (typically a finger touch).
... specifications specification status comment pointer events – level 3 editor's draft added new apis for getcoalescedevent and getpredictedevents, new pointerrawup
date event, additional touch-action property values pan-left, pan-right, pan-up, pan-down.
Push API - Web APIs
this lets developers deliver asynchronous notifications and up
dates to users that opt in, resulting in better engagement with timely new content.
... serviceworkerglobalscope.onpushsubscriptionchange an event handler fired whenever a pushsubscriptionchange event occurs; for example, when a push subscription has been invali
dated, or is about to be invali
dated (e.g.
RTCCertificate - Web APIs
properties rtccertificate.expires read only returns the expiration
date of the certificate.
... specifications specification status comment webrtc 1.0: real-time communication between browsers candi
date recommendation initial definition.
RTCDTMFSender: tonechange event - Web APIs
examples this example establishes a handler for the tonechange event which up
dates an element to display the currently playing tone in its content, or, if all tones have played, the string "<none>".
... candi
date recommendation definition for the webrtc api ...
RTCDTMFToneChangeEvent.tone - Web APIs
syntax var tone = dtmftonechangeevent.tone; example this example establishes a handler for the tonechange event which up
dates an element to display the currently playing tone in its content, or, if all tones have played, the string "<none>".
... candi
date recommendation initial specification.
RTCDataChannel: close event - Web APIs
bubbles no cancelable no interface event event handler property rtcdatachannel.onclose examples this example sets up a handler for the close event for the rtcdatachannel named dc; its responsibility in this example is to up
date user interface elements to reflect that there is no longer an ongoing call, and to allow a new call to be started.
... candi
date recommendation initial specification.
RTCDataChannel.onopen - Web APIs
it then establishes an open event handler which up
dates some user interface elements to prepare them for being used to send messages over the data channel.
... candi
date recommendation initial specification.
RTCDataChannel.send() - Web APIs
var pc = new rtcpeerconnection(); var dc = pc.createdatachannel("backchannel"); function sendmessage(msg) { let obj = { "message": msg, "timestamp": new
date() } dc.send(json.stringify(obj)); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcdatachannel.send()' in that specification.
... candi
date recommendation initial specification.
RTCRtpStreamStats.ssrc - Web APIs
the manner in which these values are generated is not man
dated by the specification, although it does make recommendations.
... candi
date recommendation initial definition.
RTCSessionDescription - Web APIs
f (!pc) start(false); var message = json.parse(evt.data); if (message.sdp) pc.setremotedescription(new rtcsessiondescription(message), function () { // if we received an offer, we need to answer if (pc.remotedescription.type == "offer") pc.createanswer(localdesccreated, logerror); }, logerror); else pc.addicecandi
date(new rtcicecandi
date(message.candi
date), function () {}, logerror); }; specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcsessiondescription' in that specification.
... candi
date recommendation initial definition.
SVGGraphicsElement: cut event - Web APIs
note though that cancelling the default action will also prevent the document from being up
dated.
... specifications specification status comment scalable vector graphics (svg) 2 candi
date recommendation definition that the clipboard events apply to svg elements.
SourceBuffer.abort() - Web APIs
for example, consider this code: sourcebuffer.addeventlistener('up
dateend', function (_) { ...
... }); sourcebuffer.appendbuffer(buf); let's say that after the call to appendbuffer but before the up
dateend event fires (i.e.
Storage.setItem() - Web APIs
the setitem() method of the storage interface, when passed a key name and value, will add that key to the given storage object, or up
date that key's value if it already exists.
... syntax storage.setitem(keyname, keyvalue); parameters keyname a domstring containing the name of the key you want to create/up
date.
Storage - Web APIs
storage.setitem() when passed a key name and value, will add that key to the storage, or up
date that key's value if it already exists.
...if it does, we run a function called setstyles() that grabs the data items using storage.getitem() and uses those values to up
date page styles.
SubtleCrypto.exportKey() - Web APIs
/* convert an arraybuffer into a string from https://developers.google.com/web/up
dates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function ab2str(buf) { return string.fromcharcode.apply(null, new uint8array(buf)); } /* export the given key and write it into the "exported-key" space.
... /* convert an arraybuffer into a string from https://developers.google.com/web/up
dates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function ab2str(buf) { return string.fromcharcode.apply(null, new uint8array(buf)); } /* export the given key and write it into the "exported-key" space.
SubtleCrypto.importKey() - Web APIs
/* convert a string into an arraybuffer from https://developers.google.com/web/up
dates/2012/06/how-to-convert-arraybuffer-to-and-from-string */ function str2ab(str) { const buf = new arraybuffer(str.length); const bufview = new uint8array(buf); for (let i = 0, strlen = str.length; i < strlen; i++) { bufview[i] = str.charcodeat(i); } return buf; } const pemencodedkey = `-----begin private key----- miievqibadanbgkqhkig9w0baqefaascbkcwggsjageaaoibaqdd0tpv/du2vftjvxj1t/...
... // from https://developers.google.com/web/up
dates/2012/06/how-to-convert-arraybuffer-to-and-from-string function str2ab(str) { const buf = new arraybuffer(str.length); const bufview = new uint8array(buf); for (let i = 0, strlen = str.length; i < strlen; i++) { bufview[i] = str.charcodeat(i); } return buf; } const pemencodedkey = `-----begin public key----- miibijanbgkqhkig9w0baqefaaocaq8amiibcgkcaqeay3xo3u13dc+x...
TextTrackList - Web APIs
to keep it up to
date, handlers for the addtrack and removetrack events are set up.
... texttracks.onaddtrack = up
datetrackcount; texttracks.onremovetrack = up
datetrackcount; function up
datetrackcount(event) { trackcount = texttracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'textracklist' in that specification.
Touch events - Web APIs
its responsibility in this example is to up
date the cached touch information and to draw a line from the previous position to the current position of each touch.
... the end ongoingtouches.splice(idx, 1); // remove it; we're done } else { console.log("can't figure out which touch to end"); } } } this is very similar to the previous function; the only real differences are that we draw a small square to mark the end and that when we call array.splice(), we simply remove the old entry from the ongoing touch list, without adding in the up
dated information.
VideoTrackList.onchange - Web APIs
example this snippet establishes a handler for the change event that looks at each of the tracks in the list, calling a function to up
date the state of a user interface control that indicates the current state of the track.
... var tracklist = document.queryselector("video").videotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { up
datetrackselectedbutton(track.id, track.selected); }); }; the up
datetrackselectedbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's selected flag to determine which state the control should be in now.
VideoTrackList - Web APIs
to keep it up to
date, handlers for the addtrack and removetrack events are set up.
... videotracks.onaddtrack = up
datetrackcount; videotracks.onremovetrack = up
datetrackcount; function up
datetrackcount(event) { trackcount = videotracks.length; drawtrackcountindicator(trackcount); } specifications specification status comment html living standardthe definition of 'videotracklist' in that specification.
A basic 2D WebGL animation example - Web APIs
that's done here by calling requestanimationframe(), which asks that a callback function be executed the next time the browser is ready to up
date the screen.
...then the value of previoustime is up
dated and we call animatescene() to draw the next frame (and in turn schedule the next frame to be drawn, ad infinitum).
Matrix math for the web - Web APIs
the focus in the glmatrix library is to have target arrays that are allocated before the up
date loop.
... <div id='move-me' class='transformable'> <h2>move me with a matrix</h2> <p>lorem ipsum dolor sit amet, consectetur adipisicing elit...</p> </div> finally, for each of the examples we will generate a 4x4 matrix, then up
date the <div>'s style to have a transform applied to it, set to a matrix3d.
Writing WebSocket client applications - Web APIs
var msg = { type: "message", text: document.getelementbyid("text").value, id: clientid,
date:
date.now() }; // send the msg object as a json-formatted string.
...there are assorted types of data packets the client might receive, such as: login handshake message text user list up
dates the code that interprets these incoming messages might look like this: examplesocket.onmessage = function(event) { var f = document.getelementbyid("chatbox").contentdocument; var text = ""; var msg = json.parse(event.data); var time = new
date(msg.
date); var timestr = time.tolocaletimestring(); switch(msg.type) { case "id": clientid = msg.id; setusername(); ...
Using bounded reference spaces - Web APIs
; let spacetype = null; function onsessionstarted(session) { xrsession = session; spacetype = "bounded-floor"; xrsession.requestreferencespace(spacetype) .then(onrefspacecreated) .catch(() => { spacetype = "local-floor"; xrsession.requestreferencespace(spacetype) .then(onrefspacecreated) .catch(handleerror); }); } function onrefspacecreated(refspace) { xrsession.up
daterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); // now set up matrices, create a secondary reference space to // transform the viewer's pose, and so forth.
... this would change the onrefspacecreated() method from the above snippet to: function onrefspacecreated(refspace) { xrsession.up
daterenderstate({ baselayer: new xrwebgllayer(xrsession, gl) }); let startposition = vec3.fromvalues(0, 1.5, 0); const startorientation = vec3.fromvalues(0, 0, 1.0); xrreferencespace = xrreferencespace.getoffsetreferencespace( new xrrigidtransform(startposition, startorientation)); xrsession.requestanimationframe(ondrawframe); } in this code, executed after the reference sp...
Lighting a WebXR setting - Web APIs
once the api has stabilized, we'll up
date this documentation with the details.
... the lighting estimation api specification man
dates that all user agents perform temporal and spatial filtering to fuzz the data in a manner that reduces its usefulness for the purpose of locating the user or performing side-channel attacks.
Web Animations API Concepts - Web APIs
the internet explorer team requested an animations api to consoli
date and normalize animation functionality across all browsers, and thus efforts began in earnest among mozilla firefox and google chrome developers to create the one animation spec to rule them all: the web animations api.
...(read more about how to use element.animate() in using the web animations api.) uses the api allows for the creation of dynamic animations that can be up
dated on the fly as well as more straightforward, declarative animations like those css creates.
Migrating from webkitAudioContext - Web APIs
in this article, we cover the differences in web audio api since it was first implemented in webkit and how to up
date your code to use the modern web audio api.
... (audiobuffersourcenode has yet another way of starting output: the notegrainon() method.) the noteon()/notegrainon()/noteoff() methods were the original way to start/stop output in these nodes, and in the newer versions of the specification, the noteon() and notegrainon() methods were consoli
dated into a single start() method, and the noteoff() method was renamed to the stop() method.
Using the Web Speech API - Web APIs
e demo, so we are just specifying one (which is actually the default anyway.) recognition.grammars = speechrecognitionlist; recognition.continuous = false; recognition.lang = 'en-us'; recognition.interimresults = false; recognition.maxalternatives = 1; starting the speech recognition after grabbing references to the output <div> and the html element (so we can output diagnostic messages and up
date the app background color later on), we implement an onclick handler so that when the screen is tapped/clicked, the speech recognition service will start.
... inputtxt.blur(); } updating the displayed pitch and rate values the last part of the code simply up
dates the pitch/rate values displayed in the ui, each time the slider positions are moved.
Using Web Workers - Web APIs
they are intended to (amongst other things) enable the creation of effective offline experiences, intercepting network requests and taking appropriate action based on whether the network is available and up
dated assets reside on the server.
... functions and interfaces available in workers you can use most standard javascript features inside a web worker, including: navigator xmlhttprequest array,
date, math, and string windowtimers.settimeout and windowtimers.setinterval the main thing you can't do in a worker is directly affect the parent page.
window.cancelAnimationFrame() - Web APIs
other browsers can use something like
date.now().
... var myreq; function step(timestamp) { var progress = timestamp - start; d.style.left = math.min(progress / 10, 200) + 'px'; if (progress < 2000) { // it's important to up
date the requestid each time you're calling requestanimationframe myreq = requestanimationframe(step); } } myreq = requestanimationframe(step); // the cancelation uses the last requestid cancelanimationframe(myreq); specifications specification status comment html living standardthe definition of 'cancelanimationframe()' in that specification.
XRReferenceSpace.getOffsetReferenceSpace() - Web APIs
canvas.oncontextmenu = (event) => { event.preventdefault(); }; canvas.addeventlistener("mousemove", (event) => { if (event.buttons & 2) { rotateviewby(event.movementx, event.movementy); } }); next, the rotateviewby() function, which up
dates the mouse look direction's yaw and pitch based on the mouse delta values from the mousemove event.
...each time this is called, the new offsets are used to up
date the current values of mousepitch and mouseyaw.
XRReferenceSpace: reset event - Web APIs
the event is sent before any animation frame callbacks are executed to render the pending frame, to ensure that those callbacks have the up
dated coordinate system available.
...instead of allowing this to happen, you can integrate the emulatedposition into the teleportation offset calculated prior to calling getoffsetreferencespace() to create a new reference space whose up
dated effective origin is adjusted by the distance the viewer's position jumped since the previous frame.
XRRenderStateInit - Web APIs
the xrrenderstateinit dictionary is a writeable version of the xrrenderstate interface, and is used when calling an xrsession's up
daterenderstate() method to apply changes to the render state prior to rendering the next frame.
... usage notes any properties not specified in the xrrenderstateinit compliant object passed into up
daterenderstate() are left at their current values.
XRSessionInit - Web APIs
at this time, all features are identified using strings from the xrreferencespacetype enumeration, but future up
dates to the webxr standard may add more features.
...more features may be added in future up
dates to the webxr standard.
XRWebGLLayer.getNativeFramebufferScaleFactor() static method - Web APIs
frame buffer at the device's native resolution, regardless of any performance concerns: function requestnativescalewebgllayer(gl, xrsession) { return gl.makexrcompatible().then(() => { let scalefactor = xrwebgllayer.getnativeframebufferscalefactor(xrsession); let gllayer = new xrwebgllayer(xrsession, gl, { framebufferscalefactor: scalefactor }); xrsession.up
daterenderstate({ baselayer: gllayer }); }); }; this starts by calling the webgl rendering context function makexrcompatible().
... that gets us a new xrwebgllayer object representing a rendering surface we can use for the xrsession; we set it as the rendering surface for xrsession by calling its up
daterenderstate() method, passing the new gllayer in using the xrrenderstate dictionary's xrrenderstate.baselayer property.
XSL Transformations in Mozilla FAQ - Web APIs
ie up to version 6 required a deprecated namespace of a xslt working draft, please up
date to mozilla ;-), ie6+ or msxml3+, as it is fixed there.
... original document information author(s): axel hecht last up
dated
date: february 2, 2005 copyright information: portions of this content are © 1998–2006 by individual mozilla.org contributors; content available under a creative commons license ...
Using the aria-invalid attribute - Accessibility
<input name="name" id="name" aria-required="true" aria-invalid="false" onblur="checkvalidity('name', ' ', 'invalid name entered (requires both first and last name)');"/> <br /> <input name="email" id="email" aria-required="true" aria-invalid="false" onblur="checkvalidity('email', '@', 'invalid e-mail address');"/> note that it is not necessary to vali
date the fields immediately on blur; the application could wait until the form is submitted (though this is not necessarily recommended).
...shows a very simple validation function, which only checks for the presence of a particular character (in the real world, validation will likely be more sophisticated): function checkvalidity(aid, asearchterm, amsg){ var elem = document.getelementbyid(aid); var invalid = (elem.value.indexof(asearchterm) < 0); if (invalid) { elem.setattribute("aria-invalid", "true"); up
datealert(amsg); } else { elem.setattribute("aria-invalid", "false"); up
datealert(); } } the snippet below shows the alert functions, which add (or remove) the error message: function up
datealert(msg) { var oldalert = document.getelementbyid("alert"); if (oldalert) { document.body.removechild(oldalert); } if (msg) { var newalert = document.cre...
Using the progressbar role - Accessibility
as the task progresses, the aria-valuenow value has to be up
dated dynamically to indicate this progress to assistive technology products.
... possible effects on user agents and assistive technology screen readers should announce the progress up
dates as they occur.
ARIA: dialog role - Accessibility
<div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully up
dated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> description marking up a dialog element with the dialog role helps assistive technology identify the dialog's content as being grouped and separated from the rest of the page content.
...this approach is shown in the code snippet below: <div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully up
dated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> keep in mind that a dialog's title and description text do not have to be focusable in order to be perceived by screen readers operating in a non-virtual mode.
ARIA: listbox role - Accessibility
up
date the aria-activedescendant value on the listbox to the id of the newly selected option visually handle the blur, focus, and selected states of the option toggling the state of an option in a multi select listbox when the user clicks on an option, hits space when focused on an option, or otherwise toggles the state of an option, the following must occur: toggle the aria-selected state of the...
... change the appearance of the option to reflect it's selected state up
date the aria-activedescendant value on the listbox to the id of the option the user just interacted with, even if they toggled the option to be unselected.
WAI-ARIA Roles - Accessibility
for a full list of roles, see using aria: roles, states, and properties aria: alert rolethe alert role can be used to tell the user an element has been dynamically up
dated.
... screen readers will instantly start reading out the up
dated content when the role is added.
Basic form hints - Accessibility
the second part of the example, a snippet of javascript vali
dates the email format, and sets the aria-invalid attribute of the email field (line 12 of the html) according to the result (in addition to changing the presentation of the element).
... <label for="name">* name:</label> <input type="text" value="name" id="name" aria-required="true"/> </div> <div> <label for="phone">phone:</label> <input type="text" value="phone" id="phone" aria-required="false"/> </div> <div> <label for="email">* e-mail:</label> <input type="text" value="email" id="email" aria-required="true"/> </div> </form> the script that vali
dates the form entry would look something like this: var vali
date = function () { var emailelement = document.getelementbyid(emailfieldid); var valid = emailvalid(formdata.email); // returns true if valid, false otherwise emailelement.setattribute("aria-invalid", !valid); setelementbordercolour(emailelement, valid); // sets the border to red if second arg is false }; providing helpful erro...
Accessibility: What users can do to browse more safely - Accessibility
those in the public sector who must accomo
date those with special sensitivities, should consider setting aside at least one work station and becoming familiar with its personalization and accessibility settings.
...one work station can be set up to acommo
date both a low-vision individual (needs high-contrast) and to accomo
date an individual with photosensitive susceptibilities, by simply, adjusting personalization and accessiblity settings.
Keyboard-navigable JavaScript widgets - Accessibility
to do this: bind a key down handler to each element in the group, and when an arrow key is used to move to another element: programmatically apply focus to the new element, up
date the tabindex of the focused element to "0", and up
date the tabindex of the previously focused element to "-1".
...for example, the code that up
dates the tabindex or the styling when users navigate using the arrow keys should also be used by mouse click handlers to produce the same changes.
Web Accessibility: Understanding Colors and Luminance - Accessibility
luckily, css media queries level 5 will be a game-changer in accessibility initiatives, because it will allow users to select settings that accomo
date their needs best.
...macknik on november 1, 2014 scientific papers photic- and pattern-induced seizures: expert consensus of the epilepsy foundation of america working group w3c issues and discussions contrast ratio math and related visual issues #695 luminance / luma confusion #236 out
dated threshold for srgb companding in the "relative luminance" definition #308 non-srgb color spaces, out
dated srgb threshold, and other issues in the "relative luminance" definition #360 w3c resources css color module level 3 css color module level 4 ensuring that a contrast ratio of 3:1 is provided for icons understanding success criterion 1.4.3: contrast (minimum) wcag working group's wi...
Operable - Accessibility
live multiplayer games), and any other activity that requires a time limit and would be invali
dated if it were turned off.
... for auto-updating information that starts automatically and is shown alongside other content, controls should be provided to pause, stop, or hide it, or to control the frequency of up
dates.
Text labels and names - Accessibility
<div role="dialog" aria-labelledby="dialog1title" aria-describedby="dialog1desc"> <h2 id="dialog1title">your personal details were successfully up
dated</h2> <p id="dialog1desc">you can change your details at any time in the user account section.</p> <button>close</button> </div> if the dialog box doesn't have a heading, you can instead use aria-label to contain the label text: <div role="dialog" aria-label="personal details up
dated confirmation"> <p>your personal details were successfully up
dated.
... examples the title for the reference article about the <title> element is as follows: <title><title>: the document title element - html: hypertext markup language</title> another example might look like so: <title>fill in your details to register — mygov services</title> to help the user, you can up
date the page title value to reflect significant page state changes (such as form validation problems): <title>2 errors — fill in your details to register — mygov services</title> see also <title> embedded content must be labeled make sure that elements that embed content have a title attribute that describes the embedded content.
Understandable - Accessibility
see form data validation for comprehensive validation information, and wai-aria: dynamic content up
dates for information on live regions.
...when a simple instruction or prompt is required, you can use <label> elements for single inputs like name or age, a combination or <label>s and <fieldset>s/<legend>s for multiple inputs that go together (like the elements of a
date of birth or postal address).
Accessibility
when the web meets this goal, it is accessible to people with a diverse range of hearing, movement, sight, and cognitive ability." (w3c - accessibility) key tutorials the mdn accessibility learning area contains modern, up-to-
date tutorials covering accessibility essentials: what is accessibility?
... wai-aria basics following on from the previous article, sometimes making complex ui controls that involve unsemantic html and dynamic javascript-up
dated content can be difficult.
:-moz-ui-invalid - CSS: Cascading Style Sheets
the :-moz-ui-invalid css pseudo-class represents any vali
dated form element whose value isn't valid based on their validation constraints, in certain circumstances.
... if the control has focus, and the value was invalid when it gained focus, re-vali
date on every keystroke.
:-moz-ui-valid - CSS: Cascading Style Sheets
the :-moz-ui-valid css pseudo-class represents any vali
dated form element whose value vali
dates correctly based on its validation constraints.
... if the control has focus, and the value was invalid when it gained focus, re-vali
date on every keystroke.
:invalid - CSS: Cascading Style Sheets
the :invalid css pseudo-class represents any <input> or other <form> element whose contents fail to vali
date.
... syntax :invalid examples this example presents a simple form that colors elements green when they vali
date and red when they don't.
:is() (:matches(), :any()) - CSS: Cascading Style Sheets
hat is being hovered */ :is(header, main, footer) p:hover { color: red; cursor: pointer; } /* the above is equivalent to the following */ header p:hover, main p:hover, footer p:hover { color: red; cursor: pointer; } /* backwards-compatible version with :-*-any() and :matches() (it is not possible to group selectors into single rule, because presence of invalid selector would invali
date whole rule.) */ :-webkit-any(header, main, footer) p:hover { color: red; cursor: pointer; } :-moz-any(header, main, footer) p:hover { color: red; cursor: pointer; } :matches(header, main, footer) p:hover { color: red; cursor: pointer; } syntax :is( <complex-selector-list> )where <complex-selector-list> = <complex-selector>#where <complex-selector> = <compound-selector> [ <combinato...
... article, aside, nav) h1 { font-size: 25px; } /* level 2 */ :is(section, article, aside, nav) :is(section, article, aside, nav) h1 { font-size: 20px; } /* level 3 */ :is(section, article, aside, nav) :is(section, article, aside, nav) :is(section, article, aside, nav) h1 { font-size: 15px; } avoiding selector list invalidation unlike selector lists, the :is() pseudo-class doesn't get invali
dated when one of the selectors passed to it isn't supported by the browser.
@import - CSS: Cascading Style Sheets
candi
date recommendation extended the syntax to support the @supports syntax.
... candi
date recommendation media queriesthe definition of '@import' in that specification.
Coordinate systems - CSS: Cascading Style Sheets
handling the mouse events setcoords() is called by the event handler for the various mouse events, named up
date(); this is shown below.
... function up
date(e) { setcoords(e, "offset"); setcoords(e, "client"); setcoords(e, "page"); setcoords(e, "screen"); } inner.addeventlistener("mouseenter", up
date, false); inner.addeventlistener("mousemove", up
date, false); inner.addeventlistener("mouseleave", up
date, false); the event handler is in the up
date() method.
CSS Flexible Box Layout - CSS: Cascading Style Sheets
the flexbox spec now refers to the box alignment specification for up to
date definitions.
... backwards compatibility of flexbox browser status of flexbox, interoperability issues and supporting older browsers and versions of the spec specifications specification status comment css flexible box layout module candi
date recommendation initial definition.
CSS Images - CSS: Cascading Style Sheets
specifications specification status comment css images module level 4 working draft added image-resolution, conic-gradient(), and image() css images module level 3 candi
date recommendation added image-orientation, image-rendering, object-fit and object-position compatibility standardthe definition of 'css gradients' in that specification.
... candi
date recommendation css level 2 (revision 1)the definition of '<uri>' in that specification.
CSS values and units - CSS: Cascading Style Sheets
adds the min(), max() and clamp() functional notation adds toggle() css values and units module level 3 candi
date recommendation adds calc(), ch, rem, vw, vw, vmin, vmax, q css color module level 4 working draft adds commaless syntaxes for the rgb(), rgba(), hsl(), and hsla() functions.
... css images module level 4 working draft adds element(), image(), image-set(), conic-gradient() css images module level 3 candi
date recommendation initial definition of image.
Introducing the CSS Cascade - CSS: Cascading Style Sheets
specifications specification status comment css cascading and inheritance level 4 candi
date recommendation added the revert keyword, which allows rolling a property back a cascade level.
... css cascading and inheritance level 3 candi
date recommendation removed the override cascade origin, as it was never used in a w3c standard.
Cubic Bezier Generator - CSS: Cascading Style Sheets
<html> <canvas id="bezier" width="336" height="336"> </canvas> <form> <label for="x1">x1 = </label><input onchange="up
datecanvas();" type="text" maxlength=6 id="x1" value="0.79" class='field'> <label for="y1">y1 = </label><input onchange="up
datecanvas();return true;" type="text" maxlength=6 id="y1" value="0.33" class='field'> <label for="x2">x2 = </label><input onchange="up
datecanvas();return true;" type="text" maxlength=6 id="x2" value="0.14" class='field'> <label for="y2">y2 = </label><input onchange="up
datecanvas();return true;" type="text" maxlength=6 id="y2" value="0.53" class='field'> <br> <output id="output">log</output> </form> </html> .field { width: 40px; } function up
datecanvas() { var x1 =...
...r x2 = document.getelementbyid('x2'); var y2 = document.getelementbyid('y2'); x2.value = reversex(x); x2.value = math.round(x2.value * 10000) / 10000; y2.value = reversey(y); y2.value = math.round(y2.value * 10000) / 10000; if (x2.value < 0) { x2.value = 0; } if (x2.value > 1) { x2.value = 1; } } up
datecanvas(); } } initcanvas(); up
datecanvas(); this is a sample tool; it lets you edit bezier curves.
<filter-function> - CSS: Cascading Style Sheets
updating the controls up
dates the filter effect in real time, allowing you to investigate the effects of different filters.
...ilter === 'drop-shadow') { divelem.style.filter = `${selectelem.value}(${math.round(slider.value)}${slider.getattribute('data-unit')} ${math.round(slider.value)}${slider.getattribute('data-unit')} ${math.round(math.abs(slider.value/2))}${slider.getattribute('data-unit')})`; } else { divelem.style.filter = `${selectelem.value}(${slider.value}${slider.getattribute('data-unit')}`; } up
dateoutput(); up
datecurvalue(); } function up
dateoutput() { output.textcontent = slider.value; } function up
datecurvalue() { curvalue.textcontent = `filter: ${divelem.style.filter}`; } setslider(selectelem.value); setdiv(selectelem.value); result specifications specification status filter effects module level 1the definition of 'filter-function' in that specifica...
font-kerning - CSS: Cascading Style Sheets
ij</textarea> css div { font-size: 2rem; font-family: serif; } #nokern { font-kerning: none; } #kern { font-kerning: normal; } javascript let input = document.getelementbyid('input'); let kern = document.getelementbyid('kern'); let nokern = document.getelementbyid('nokern'); input.addeventlistener('keyup', function() { kern.textcontent = input.value; /* up
date content */ nokern.textcontent = input.value; }); kern.textcontent = input.value; /* initialize content */ nokern.textcontent = input.value; specifications specification status comment css fonts module level 3the definition of 'font-kerning' in that specification.
... candi
date recommendation initial definition.
font-size - CSS: Cascading Style Sheets
changing the font size also up
dates the sizes of the font size-relative <length> units, such as em, ex, and so forth.
... candi
date recommendation no change.
font-style - CSS: Cascading Style Sheets
00vw; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let slantlabel = document.queryselector('label[for="slant"]'); let slantinput = document.queryselector('#slant'); let sampletext = document.queryselector('.sample'); function up
date() { let slant = `oblique ${slantinput.value}deg`; slantlabel.textcontent = `font-style: ${slant};`; sampletext.style.fontstyle = slant; } slantinput.addeventlistener('input', up
date); up
date(); accessibility concerns large sections of text set with a font-style value of italic may be difficult for people with cognitive concerns such as dyslexia to read.
... candi
date recommendation no change css level 2 (revision 1)the definition of 'font-style' in that specification.
font-variation-settings - CSS: Cascading Style Sheets
in order to use variable fonts on your operating system, you need to make sure that it is up to
date.
...if your operating system is not up to
date, you will not be able to use variable fonts in web pages or the firefox developer tools.
font-weight - CSS: Cascading Style Sheets
; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let weightlabel = document.queryselector('label[for="weight"]'); let weightinput = document.queryselector('#weight'); let sampletext = document.queryselector('.sample'); function up
date() { weightlabel.textcontent = `font-weight: ${weightinput.value};`; sampletext.style.fontweight = weightinput.value; } weightinput.addeventlistener('input', up
date); up
date(); accessibility concerns people experiencing low vision conditions may have difficulty reading text set with a font-weight value of 100 (thin/hairline) or 200 (extra light), especially if the font has a low contrast...
... candi
date recommendation no change.
mask-border-outset - CSS: Cascading Style Sheets
mask-border-outset: 1rem; chromium-based browsers support an out
dated version of this property — mask-box-image-outset — with a prefix: -webkit-mask-box-image-outset: 1rem; note: the mask-border page features a working example (using the out-of-
date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candi
date recommendation initial definition ...
mask-border-repeat - CSS: Cascading Style Sheets
mask-border-repeat: round; chromium-based browsers support an out
dated version of this property — mask-box-image-repeat — with a prefix: -webkit-mask-box-image-repeat: round; note: the mask-border page features a working example (using the out-of-
date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candi
date recommendation initial definition ...
mask-border-slice - CSS: Cascading Style Sheets
mask-border-slice: 30 fill; chromium-based browsers support an out
dated version of this property — mask-box-image-slice — with a prefix: -webkit-mask-box-image-slice: 30 fill; note: the mask-border page features a working example (using the out-of-
date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candi
date recommendation initial defintion ...
mask-border-source - CSS: Cascading Style Sheets
mask-border-source: url(image.jpg); chromium-based browsers support an out
dated version of this property — mask-box-image-source — with a prefix: -webkit-mask-box-image-source: url(image.jpg); note: the mask-border page features a working example (using the out-of-
date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candi
date recommendation initial definition ...
mask-border-width - CSS: Cascading Style Sheets
mask-border-width: 30 fill; chromium-based browsers support an out
dated version of this property — mask-box-image-width — with a prefix: -webkit-mask-box-image-width: 20px; note: the mask-border page features a working example (using the out-of-
date prefixed border mask properties supported in chromium), so you can get an idea of the effect.
... candi
date recommendation initial definition ...
mask-border - CSS: Cascading Style Sheets
-webkit-mask-box-image-repeat: round; -webkit-mask-box-image-outset: 1px; */ /* prefixed shorthand property currently supported in chromium */ -webkit-mask-box-image: url("https://udn.realityripple.com/samples/2d/fd08a3134c.png") /* source */ 30 fill / /* slice */ 20px / /* width */ 1px /* outset */ round; /* repeat */ /* up
dated standard shorthand property, not supported anywhere yet */ mask-border: url("https://udn.realityripple.com/samples/2d/fd08a3134c.png") /* source */ 30 fill / /* slice */ 20px / /* width */ 1px /* outset */ round; /* repeat */ } result specifications specification status comment css masking module lev...
... candi
date recommendation initial definition ...
place-content - CSS: Cascading Style Sheets
ption value="center" selected>center</option> <option value="start">start</option> <option value="end">end</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="left">left</option> <option value="right">right</option> <option value="safe">safe</option> <option value="unsafe">unsafe</option> </select><code>;</code> var up
date = function () { document.getelementbyid("container").style.placecontent = document.getelementbyid("aligncontentalignment").value + " " + document.getelementbyid("justifycontentalignment").value; } var aligncontentalignment = document.getelementbyid("aligncontentalignment"); aligncontentalignment.addeventlistener("change", up
date); var justifycontentalignment = document.getelementbyid("justi...
...fycontentalignment"); justifycontentalignment.addeventlistener("change", up
date); var writingm = document.getelementbyid("writingmode"); writingm.addeventlistener("change", function (evt) { document.getelementbyid("container").style.writingmode = evt.target.value; }); var direction = document.getelementbyid("direction"); direction.addeventlistener("change", function (evt) { document.getelementbyid("container").style.direction = evt.target.value; }); css #container { display: flex; height:240px; width: 240px; flex-wrap: wrap; background-color: #8c8c8c; writing-mode: horizontal-tb; /* can be changed in the live sample */ direction: ltr; /* can be changed in the live sample */ place-content: flex-end center; /* can be changed in the live sample */ } div > div { borde...
<position> - CSS: Cascading Style Sheets
candi
date recommendation relists links to both definitions: if css backgrounds and borders module level 3 is supported, its definition of <position> must also be used.
... candi
date recommendation defines <position> explicitly and extends it to support offsets from any edge.
<ratio> - CSS: Cascading Style Sheets
in media queries level 4, the <ratio>
date type is up
dated to consist of a strictly positive <number> followed by a forward slash ('/', unicode u+002f solidus) and a second strictly positive <number>.
... candi
date recommendation media queriesthe definition of '<ratio>' in that specification.
transition-timing-function - CSS: Cascading Style Sheets
: 12em; min-width: 12em; margin-bottom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration: 7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration: 2s; } function up
datetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(up
datetransition, 10000); .ease { transition-timing-function: ease; } .easein { transition-timing-function: ease-in; } .easeout { transition-timing-function: ease-out; } .easeinout {...
...th: 12em; min-width: 12em; margin-bottom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration:7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration:2s; } function up
datetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(up
datetransition, 10000); .jump-start { transition-timing-function: steps(5, jump-start); } .jump-end { transition-timing-function: steps(5, jump-end); } .jump-none { transition-timi...
Used value - CSS: Cascading Style Sheets
example this example computes and displays the used width value of three elements (up
dates on resize): html <div id="no-width"> <p>no explicit width.</p> <p class="show-used-width">..</p> <div id="width-50"> <p>explicit width: 50%.</p> <p class="show-used-width">..</p> <div id="width-inherit"> <p>explicit width: inherit.</p> <p class="show-used-width">..</p> </div> </div> </div> css #no-width { width: auto; } #width-50 { width: 50%; } #...
...width-inherit { width: inherit; } /* make results easier to see */ div { border: 1px solid red; padding: 8px; } javascript function up
dateusedwidth(id) { var div = document.queryselector(`#${id}`); var par = div.queryselector('.show-used-width'); var wid = window.getcomputedstyle(div)["width"]; par.textcontent = `used width: ${wid}.`; } function up
dateallusedwidths() { up
dateusedwidth("no-width"); up
dateusedwidth("width-50"); up
dateusedwidth("width-inherit"); } up
dateallusedwidths(); window.addeventlistener('resize', up
dateallusedwidths); result difference from computed value css 2.0 defined only computed value as the last step in a property's calculation.
Media buffering, seeking, and time ranges - Developer guides
for (var i = 0; i < myaudio.buffered.length; i++) { if (myaudio.buffered.start(myaudio.buffered.length - 1 - i) < myaudio.currenttime) { document.getelementbyid("buffered-amount").style.width = (myaudio.buffered.end(myaudio.buffered.length - 1 - i) / duration) * 100 + "%"; break; } } } }); myaudio.addeventlistener('timeup
date', function() { var duration = myaudio.duration; if (duration > 0) { document.getelementbyid('progress-amount').style.width = ((myaudio.currenttime / duration)*100) + "%"; } }); } the progress event is fired as data is downloaded, this is a good event to react to if we want to display download or buffering progress.
... the timeup
date event is fired 4 times a second as the media plays and that's where we increment our playing progress bar.
A hybrid approach - Developer guides
similarly, because it uses user-agent detection, you will have to up
date your detection rules as time goes on.
...subscribe to the mozilla webdev blog for up
dates about our progress.
Writing forward-compatible websites - Developer guides
if you choose to use them, be prepared to need to frequently up
date your site to keep up with changes.
... code hygiene avoid missing > passing a validator is one way to ensure this, but even if your website doesn't vali
date entirely you should make sure all your > characters are present.
HTML attribute: accept - HTML: Hypertext Markup Language
pt=".doc,.docx,application/msword,application/vnd.openxmlformats-officedocument.wordprocessingml.document"> whereas if you're accepting a media file, you may want to be include any format of that media type: <input type="file" id="soundfile" accept="audio/*"> <input type="file" id="videofile" accept="video/*"> <input type="file" id="imagefile" accept="image/*"> the accept attribute doesn't vali
date the types of the selected files; it simply provides hints for browsers to guide users towards selecting the correct file types.
... because of this, you should make sure that expected requirement is vali
dated server-side.
HTML attribute: max - HTML: Hypertext Markup Language
valid for the numeric input types, including the
date, month, week, time,
datetime-local, number and range types, and both the <progress> and <meter> elements, the max attribute is a number that specifies the most positive value a form control to be considered valid.
... syntax syntax for max values by input type input type syntax example
date yyyy-mm-dd <input type="
date" max="2019-12-25" step="1"> month yyyy-mm <input type="month" max="2019-12" step="12"> week yyyy-w## <input type="week" max="2019-w23" step=""> time hh:mm <input type="time" max="17:00" step="900">
datetime-local yyyy-mm-ddthh:mm <input type="
datetime-local" min="2019-12-25t23:59"> number <number> <input type="number" min="0" step="5" max="100"> range <number> <input type="range" min="60" step...
<button>: The Button element - HTML: Hypertext Markup Language
formnovali
date html5 if the button is a submit button, this boolean attribute specifies that the form is not to be vali
dated when it is submitted.
... if this attribute is specified, it overrides the novali
date attribute of the button's form owner.
<form> - HTML: Hypertext Markup Language
novali
date this boolean attribute indicates that the form shouldn't be vali
dated when submitted.
... if this attribute is not set (and therefore the form is vali
dated), it can be overridden by a formnovali
date attribute on a <button>, <input type="submit">, or <input type="image"> element belonging to the form.
<input type="checkbox"> - HTML: Hypertext Markup Language
(only the htmlinputelement’s checked idl attribute is up
dated.) note: unlike other input controls, a checkboxes value is only included in the submitted data if the checkbox is currently checked.
... var overall = document.queryselector('input[id="enchtbl"]'); var ingredients = document.queryselectorall('ul input'); overall.addeventlistener('click', function(e) { e.preventdefault(); }); for(var i = 0; i < ingredients.length; i++) { ingredients[i].addeventlistener('click', up
datedisplay); } function up
datedisplay() { var checkedcount = 0; for(var i = 0; i < ingredients.length; i++) { if(ingredients[i].checked) { checkedcount++; } } if(checkedcount === 0) { overall.checked = false; overall.indeterminate = false; } else if(checkedcount === ingredients.length) { overall.checked = true; overall.indeterminat...
<input type="search"> - HTML: Hypertext Markup Language
this allows your code to up
date the search results in real time as the user edits the search.
...if your server-side code fails to vali
date the data it receives, disaster could strike when improperly-formatted data (or data which is too large, is of the wrong type, and so forth) is entered into your database.
<kbd>: The Keyboard Input element - HTML: Hypertext Markup Language
by convention, the user agent defaults to rendering the contents of a <kbd> element using its default monospace font, although this is not man
dated by the html standard.
... result the output looks like this without a style sheet applied: with custom styles we can make more sense of this by adding some css: css we add a new style for <kbd> elements, key, which we can apply when rendering keyboard keys: kbd.key { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } html then we up
date the html to use this class on the keys in the output to be presented: <p>you can also create a new document by pressing <kbd><kbd class="key">ctrl</kbd>+<kbd class="key">n</kbd></kbd>.</p> result the result is just what we want!
<summary>: The Disclosure Summary element - HTML: Hypertext Markup Language
basic example a simple example showing the use of <summary> in a <details> element: <details open> <summary>overview</summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due
date: 5/6/19</li> </ol> </details> summaries as headings you can use heading elements in <summary>, like this: <details open> <summary><h4>overview</h4></summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due
date: 5/6/19</li> </ol> </details> this currently has some spacing issues that could be addressed using css.
... html in summaries this example adds some semantics to the <summary> element to indicate the label as important: <details open> <summary><strong>overview</strong></summary> <ol> <li>cash on hand: $500.00</li> <li>current invoice: $75.30</li> <li>due
date: 5/6/19</li> </ol> </details> specifications specification status comment html living standardthe definition of '<summary>' in that specification.
itemid - HTML: Hypertext Markup Language
hamilton <dt>publication
date <dd><time itemprop="pub
date"
datetime="1996-01-26">26 january 1996</time> </dl> structured data itemscope itemtype: itemid http://vocab.example.net/book: urn:isbn:0-330-34032-8 itemprop title the reality dysfunction itemprop author peter f.
... hamilton itemprop pub
date 1996-01-26 result specifications specification status comment html living standardthe definition of 'itemid' in that specification.
Microdata - HTML: Hypertext Markup Language
this vocabulary defines a standard set of type names and property names, for example, schema.org music event indicates a concert performance, with start
date and location properties to specify the concert's key details.
... in this case, schema.org music event would be the url used by itemtype and start
date and location would be itemprop's that schema.org music event defines.
HTML reference - HTML: Hypertext Markup Language
date and time formats used in html certain html elements allow you to specify
dates and/or times as the value or as the value of an attribute.
... these include the
date and time variations of the <input> element as well as the <ins> and <del> elements.
MIME types (IANA media types) - HTTP
the internet assigned numbers authority (iana) is responsible for all official mime types, and you can find the most up-to-
date and complete list at their media types page.
... audio and video types as is the case for images, html doesn't man
date that web browsers support any specific file and codec types for the <audio> and <video> elements, so it's important to consider your target audience and the range of browsers (and versions of those browsers) they may be using when choosing the file type and codecs to use for media.
Feature Policy - HTTP
the feature-policy header has now been renamed to permissions-policy in the spec, and this article will eventually be up
dated to reflect that change.
... block the use of out
dated apis like synchronous xhr and document.write().
Content-Security-Policy - HTTP
mixed content candi
date recommendation adds block-all-mixed-content.
... upgrade insecure requests candi
date recommendation adds upgrade-insecure-requests.
Last-Modified - HTTP
the last-modified response http header contains the
date and time at which the origin server believes the resource was last modified.
...http
dates are always expressed in gmt, never in local time.
Retry-After - HTTP
header type response header forbidden header name no syntax retry-after: <http-
date> retry-after: <delay-seconds> directives <http-
date> a
date after which to retry.
... see the
date header for more details on the http
date format.
Tk - HTTP
(dynamic) tk: g (gateway or multiple parties) tk: n (not tracking) tk: t (tracking) tk: c (tracking with consent) tk: p (potential consent) tk: d (disregarding dnt) tk: u (up
dated) directives !
... u up
dated.
Link prefetching FAQ - HTTP
however, it is possible to instruct mozilla to vali
date a prefetched document when the user follows a href to the prefetched document by specifying the cache-control: must-revali
date http response header.
... prefetching hints original document information author(s): darin fisher (darin at meer dot net) last up
dated
date: up
dated: march 3, 2003 ...
OPTIONS - HTTP
/1.1 options * http/1.1 examples identifying allowed request methods to find out which request methods a server supports, one can use the curl command-line program to issue an options request: curl -x options https://example.org -i the response then contains an allow header that holds the allowed methods: http/1.1 204 no content allow: options, get, head, post cache-control: max-age=604800
date: thu, 13 oct 2016 11:45:00 gmt server: eos (lax004/2813) preflighted requests in cors in cors, a preflight request is sent with the options method so that the server can respond if it is acceptable to send the request.
... http/1.1 204 no content
date: mon, 01 dec 2008 01:15:39 gmt server: apache/2.0.61 (unix) access-control-allow-origin: https://foo.example access-control-allow-methods: post, get, options access-control-allow-headers: x-pingother, content-type access-control-max-age: 86400 vary: accept-encoding, origin keep-alive: timeout=2, max=100 connection: keep-alive specifications specification title rfc 7231,...
HTTP resources and specifications - HTTP
cross-origin resource sharing living standard rfc 7034 http header field x-frame-options informational rfc 6797 http strict transport security (hsts) proposed standard upgrade insecure requests upgrade insecure requests candi
date recommendation content security policy 1.0 content security policy 1.0 csp 1.1 and csp 3.0 doesn't extend the http standard obsolete microsoft document specifying legacy document modes* defines x-ua-compatible note rfc 5689 http extensions for web distributed authoring and versioning (webdav) these extensions of the web, as well as carddav and...
... 2324 hyper text coffee pot control protocol (htcpcp/1.0) april 1st joke spec rfc 7168 the hyper text coffee pot control protocol for tea efflux appliances (htcpcp-tea) april 1st joke spec html living standard html defines extensions of http for server-sent events living standard tracking preference expression dnt header editor's draft / candi
date recommendation reporting api report-to header draft draft spec expect-ct extension for http ietf draft ...
206 Partial Content - HTTP
status 206 partial content examples a response containing one single range: http/1.1 206 partial content
date: wed, 15 nov 2015 06:25:24 gmt last-modified: wed, 15 nov 2015 04:58:08 gmt content-range: bytes 21010-47021/47022 content-length: 26012 content-type: image/gif ...
... a response containing several ranges: http/1.1 206 partial content
date: wed, 15 nov 2015 06:25:24 gmt last-modified: wed, 15 nov 2015 04:58:08 gmt content-length: 1741 content-type: multipart/byteranges; boundary=string_separator --string_separator content-type: application/pdf content-range: bytes 234-639/8000 ...the first range...
HTTP
rudp — the reliable up
date of udp — is a suitable alternative.
...the cookie can also be set to expire on a certain
date, or restricted to a specific domain and path.
CSS Houdini
browsers parse the cssom — including layout, paint, and composite processes — before applying any style up
dates found in scripts.
... in addition, layout, paint, and composite processes are repeated for javascript style up
dates.
Concurrency model and the event loop - JavaScript
here is an example that demonstrates this concept (settimeout does not run immediately after its timer expires): const s = new
date().getseconds(); settimeout(function() { // prints out "2", meaning that the callback is not called immediately after 500 milliseconds.
... console.log("ran after " + (new
date().getseconds() - s) + " seconds"); }, 500) while (true) { if (new
date().getseconds() - s >= 2) { console.log("good, looped for 2 seconds") break; } } zero delays zero delay doesn't actually mean the call back will fire-off after zero milliseconds.
extends - JavaScript
this.name = 'square'; } get area() { return this.height * this.width; } } using extends with built-in objects this example extends the built-in
date object.
... class my
date extends
date { getformatted
date() { var months = ['jan', 'feb', 'mar', 'apr', 'may', 'jun', 'jul', 'aug', 'sep', 'oct', 'nov', 'dec']; return this.get
date() + '-' + months[this.getmonth()] + '-' + this.getfullyear(); } } specifications specification ecmascript (ecma-262)the definition of 'extends' in that specification.
JavaScript error reference - JavaScript
error: permission denied to access property "x"internalerror: too much recursionrangeerror: argument is not a valid code pointrangeerror: invalid array lengthrangeerror: invalid
daterangeerror: precision is out of rangerangeerror: radix must be an integerrangeerror: repeat count must be less than infinityrangeerror: repeat count must be non-negativereferenceerror: "x" is not definedreferenceerror: assignment to undeclared variable "x"referenceerror: can't access lexical declaration "x" before initializationreferenceerror: deprecated caller or arguments usagereferenceerror: in...
... argumenttypeerror: invalid argumentstypeerror: invalid assignment to const "x"typeerror: property "x" is non-configurable and can't be deletedtypeerror: setting getter-only property "x"typeerror: variable "x" redeclares argumenturierror: malformed uri sequencewarning: 08/09 is not a legal ecma-262 octal constantwarning: -file- is being assigned a //# sourcemappingurl, but already has onewarning:
date.prototype.tolocaleformat is deprecatedwarning: javascript 1.6's for-each-in loops are deprecatedwarning: string.x is deprecated; use string.prototype.x insteadwarning: expression closures are deprecatedwarning: unreachable code after return statement ...
The arguments object - JavaScript
non-strict functions that are passed only simple parameters (that is, not rest, default, or restructured parameters) will sync the value of variables new values in the body of the function with the arguments object, and vice versa: function func(a) { arguments[0] = 99; // updating arguments[0] also up
dates a console.log(a); } func(10); // 99 and also: function func(a) { a = 99; // updating a also up
dates arguments[0] console.log(arguments[0]); } func(10); // 99 conversely, non-strict functions that are passed rest, default, or destructured parameters will not sync new values assigned to argument variables in the function body with the arguments object.
... instead, the arguments object in non-strict functions with complex parameters will always reflect the values passed to the function when the function was called (this is the same behavior as exhibited by all strict-mode functions, regardless of the type of variables they are passed): function func(a = 55) { arguments[0] = 99; // updating arguments[0] does not also up
date a console.log(a); } func(10); // 10 and also: function func(a = 55) { a = 99; // updating a does not also up
date arguments[0] console.log(arguments[0]); } func(10); // 10 and also: // an untracked default parameter function func(a = 55) { console.log(arguments[0]); } func(); // undefined specifications specification ecmascript (ecma-262)the definition of 'arguments exotic objects' in th...
Array.prototype.indexOf() - JavaScript
; // -1 array.indexof(2, -3); // 0 finding all the occurrences of an element var indices = []; var array = ['a', 'b', 'a', 'c', 'a', 'd']; var element = 'a'; var idx = array.indexof(element); while (idx != -1) { indices.push(idx); idx = array.indexof(element, idx + 1); } console.log(indices); // [0, 2, 4] finding if an element exists in the array or not and updating the array function up
datevegetablescollection (veggies, veggie) { if (veggies.indexof(veggie) === -1) { veggies.push(veggie); console.log('new veggies collection is : ' + veggies); } else if (veggies.indexof(veggie) > -1) { console.log(veggie + ' already exists in the veggies collection.'); } } var veggies = ['potato', 'tomato', 'chillies', 'green-pepper']; up
datevegetablescollection(...
...veggies, 'spinach'); // new veggies collection is : potato,tomato,chillies,green-pepper,spinach up
datevegetablescollection(veggies, 'spinach'); // spinach already exists in the veggies collection.
Array.prototype.toLocaleString() - JavaScript
options optional an object with configuration properties, for numbers see number.prototype.tolocalestring(), and for
dates see
date.prototype.tolocalestring().
... object: object.prototype.tolocalestring() number: number.prototype.tolocalestring()
date:
date.prototype.tolocalestring() always display the currency for the strings and numbers in the prices array: var prices = ['ï¿¥7', 500, 8123, 12]; prices.tolocalestring('ja-jp', { style: 'currency', currency: 'jpy' }); // "ï¿¥7,ï¿¥500,ï¿¥8,123,ï¿¥12" for more examples, see also the intl, numberformat, and
datetimeformat pages.
Array - JavaScript
other methods (e.g., push(), splice(), etc.) also result in up
dates to an array's length property.
... const fruits = [] fruits.push('banana', 'apple', 'peach') console.log(fruits.length) // 3 when setting a property on a javascript array when the property is a valid array index and that index is outside the current bounds of the array, the engine will up
date the array's length property accordingly: fruits[5] = 'mango' console.log(fruits[5]) // 'mango' console.log(object.keys(fruits)) // ['0', '1', '2', '5'] console.log(fruits.length) // 6 increasing the length.
Function.prototype.apply() - JavaScript
rray = [4, 'hello world!', false]; let myinstance = myconstructor.construct(myarray); console.log(myinstance.property1); // logs 'hello world!' console.log(myinstance instanceof myconstructor); // logs 'true' console.log(myinstance.constructor); // logs 'myconstructor' note: this non-native function.construct method will not work with some native constructors; like
date, for example.
... for example, imagine having an array like the following, to be used with
date constructor: [2012, 11, 4]; in this case you have to write something like: new (function.prototype.bind.apply(
date, [null].concat([2012, 11, 4])))().
Function.prototype.bind() - JavaScript
polyfill because older browsers are generally also slower browsers, it is far more critical than most people recognize to create performance polyfills to make the browsing experience in out
dated browsers slightly less horrible.
...(proper bound functions have none.) the partial implementation creates bound functions whose length property does not agree with that man
dated by ecma-262: it creates functions with length of 0.
JSON.stringify() - JavaScript
the instances of
date implement the tojson() function by returning a string (the same as
date.toisostring()).
... examples using json.stringify json.stringify({}); // '{}' json.stringify(true); // 'true' json.stringify('foo'); // '"foo"' json.stringify([1, 'false', false]); // '[1,"false",false]' json.stringify([nan, null, infinity]); // '[null,null,null]' json.stringify({ x: 5 }); // '{"x":5}' json.stringify(new
date(2006, 0, 2, 15, 4, 5)) // '"2006-01-02t15:04:05.000z"' json.stringify({ x: 5, y: 6 }); // '{"x":5,"y":6}' json.stringify([new number(3), new string('false'), new boolean(false)]); // '[3,"false",false]' // string-keyed array elements are not enumerable and make no sense in json let a = ['foo', 'bar']; a['baz'] = 'quux'; // a: [ 0: 'foo', 1: 'bar', baz: 'quux' ] json.stringify(a); // '["foo...
Map.prototype.set() - JavaScript
the set() method adds or up
dates an element with a specified key and a value to a map object.
... examples using set() let mymap = new map() // add new elements to the map mymap.set('bar', 'foo') mymap.set(1, 'foobar') // up
date an element in the map mymap.set('bar', 'baz') using the set() with chaining since the set() method returns back the same map object, you can chain the method call like below: // add new elements to the map with chaining.
Object.prototype.constructor - JavaScript
function type () {} let types = [ new array(), [], new boolean(), true, // remains unchanged new
date(), new error(), new function(), function () {}, math, new number(), 1, // remains unchanged new object(), {}, new regexp(), /(?:)/, new string(), 'test' // remains unchanged ] for (let i = 0; i < types.length; i++) { types[i].constructor = type types[i] = [types[i].constructor, types[i] instanceof type, types[i].tostring()] } console.log(typ...
...nction type() {},false, // new array() function type() {},false, // [] function type() {},false,false // new boolean() function boolean() { [native code] },false,true // true function type() {},false,mon sep 01 2014 16:03:49 gmt+0600 // new
date() function type() {},false,error // new error() function type() {},false,function anonymous() { } // new function() function type() {},false,function () {} // function () {} function type() {},false,[object math] // math function type() {},false,0 ...
Object.prototype.toLocaleString() - JavaScript
objects overriding tolocalestring array: array.prototype.tolocalestring() number: number.prototype.tolocalestring()
date:
date.prototype.tolocalestring() typedarray: typedarray.prototype.tolocalestring() bigint: bigint.prototype.tolocalestring() examples array tolocalestring() override on array objects, tolocalestring() can be used to print array values as a string, optionally with locale-specific identifiers (such as currency symbols) appended to them: for example: const testarray = [4, 7, 10]; let europr...
...ices = testarray.tolocalestring('fr', { style: 'currency', currency: 'eur'}); // "4,00 €,7,00 €,10,00 €"
date tolocalestring() override on
date objects, tolocalestring() is used to print out
date displays more suitable for specific locales: for example: const test
date = new
date(
date.now()); // "
date fri may 29 2020 18:04:24 gmt+0100 (british summer time)" let de
date = test
date.tolocalestring('de'); // "29.5.2020, 18:04:24" var fr
date = test
date.tolocalestring('fr'); //"29/05/2020 à 18:04:24" number tolocalestring() override on number objects, tolocalestring() is used to print out number displays more suitable for specific locales, e.g.
Object.prototype.toString() - JavaScript
const tostring = object.prototype.tostring; tostring.call(new
date); // [object
date] tostring.call(new string); // [object string] tostring.call(math); // [object math] // since javascript 1.8.5 tostring.call(undefined); // [object undefined] tostring.call(null); // [object null] using tostring() in this way is unreliable; objects can change the behavior of object.prototype.tostring() by defining a symbol.tostringtag property, leading to ...
...for example: const my
date = new
date(); object.prototype.tostring.call(my
date); // [object
date] my
date[symbol.tostringtag] = 'my
date'; object.prototype.tostring.call(my
date); // [object my
date]
date.prototype[symbol.tostringtag] = 'prototype polluted'; object.prototype.tostring.call(new
date()); // [object prototype polluted] specifications specification ecmascript (ecma-262)the definition of 'object.prototype.tostring' in that specification.
WebAssembly - JavaScript
webassembly.vali
date() vali
dates a given typed array of webassembly binary code, returning whether the bytes are valid webassembly code (true) or not (false).
... 61firefox android full support 58opera android full support 45safari ios no support nosamsung internet android full support 8.0nodejs no support novali
datechrome full support 57edge full support 16firefox full support 52notes full support 52notes notes disabled in the firefox 52 extended support release (esr).ie no support noop...
JavaScript reference - JavaScript
obalthis function properties eval() isfinite() isnan() parsefloat() parseint() decodeuri() decodeuricomponent() encodeuri() encodeuricomponent() fundamental objects object function boolean symbol error objects error aggregateerror evalerror internalerror rangeerror referenceerror syntaxerror typeerror urierror numbers &
dates number bigint math
date text processing string regexp indexed collections array int8array uint8array uint8clampedarray int16array uint16array int32array uint32array float32array float64array bigint64array biguint64array keyed collections map set weakmap weakset structured data arraybuffer sharedarraybuffer atomics datavie...
...w json control abstraction promise generator generatorfunction asyncfunction reflection reflect proxy internationalization intl intl.collator intl.
datetimeformat intl.displaynames intl.listformat intl.locale intl.numberformat intl.pluralrules intl.relativetimeformat webassembly webassembly webassembly.module webassembly.instance webassembly.memory webassembly.table webassembly.compileerror webassembly.linkerror webassembly.runtimeerror statements javascript statements and declarations control flowblock break continue empty if...else switch throw try...catch declarations var let const functions and classes function function* async function return class iteration...
serviceworker - Web app manifests
examples "serviceworker": { "src": "./serviceworker.js", "scope": "/app", "type": "", "up
date_via_cache": "none" } values service worker contain the following values (only src is required): member description src the url to download the service worker script from.
... up
date_via_cache whether the user agent cache should be bypassed when fetching the service worker.
OpenSearch description format
supporting automatic up
dates for opensearch plugins opensearch plugins can automatically up
date.
...the template attribute should be the url of the opensearch document to automatically up
date to.
Optimizing startup performance - Web Performance
the source application might have a main loop that can easily be made to operate asynchronously (by running each main loop iteration separately); startup is often just a continuous, monolithic procedure that might periodically up
date a progress meter.
...in between calculations, up
date your progress indicator, make changes to the display, or anything else you might be able to do to help the user feel like your app is doing something instead of sitting there quietly.
Progressive web app structure - Progressive web apps (PWAs)
client-side rendering (csr) allows the website to be up
dated in the browser almost instantly when navigating to different pages, but requires more of an initial download hit and extra rendering on the client at the beginning.
... mixing ssr with csr can lead to the best results — you can render a website on the server, cache its contents, and then up
date the rendering on the client-side as and when needed.
Making PWAs work offline with Service workers - Progressive web apps (PWAs)
up
dates there is still one point to cover: how do you upgrade a service worker when a new version of the app containing new assets is available?
... the version number in the cache name is key to this: var cachename = 'js13kpwa-v1'; when this up
dates to v2, we can then add all of our files (including our new files) to a new cache: contenttocache.push('/pwa-examples/js13kpwa/icons/icon-32.png'); // ...
Structural overview of progressive web apps - Progressive web apps (PWAs)
client-side rendering (csr) allows the website to be up
dated in the browser almost instantly when navigating to different pages, but requires more of an initial download hit and extra rendering on the client at the beginning.
... the best results tend to come when you use both client-side and server-side rendering; you can render a web site on the server, cache its contents, and then up
date the rendering on the client side as needed.
cx - SVG: Scalable Vector Graphics
candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'cx' in that specification.
... candi
date recommendation definition for svg2 paint servers.
cy - SVG: Scalable Vector Graphics
candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'cy' in that specification.
... candi
date recommendation definition for svg2 paint servers.
gradientTransform - SVG: Scalable Vector Graphics
candi
date recommendation no change scalable vector graphics (svg) 2the definition of 'gradienttransformation for <radialgradient>' in that specification.
... candi
date recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'gradienttransformation for <lineargradient>' in that specification.
gradientUnits - SVG: Scalable Vector Graphics
candi
date recommendation no change scalable vector graphics (svg) 2the definition of 'gradientunits for <lineargradient>' in that specification.
... candi
date recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'gradientunits for <radialgradient>' in that specification.
image-rendering - SVG: Scalable Vector Graphics
candi
date recommendation definition in css scalable vector graphics (svg) 2the definition of 'image-rendering' in that specification.
... candi
date recommendation no significant change, only added a reference to css images 3 scalable vector graphics (svg) 1.1 (second edition)the definition of 'image-rendering' in that specification.
points - SVG: Scalable Vector Graphics
candi
date recommendation definition for <polygon> scalable vector graphics (svg) 2the definition of 'points' in that specification.
... candi
date recommendation definition for <polyline> scalable vector graphics (svg) 1.1 (second edition)the definition of 'points' in that specification.
r - SVG: Scalable Vector Graphics
candi
date recommendation definition as a geometry property scalable vector graphics (svg) 2the definition of 'r' in that specification.
... candi
date recommendation definition for svg2 paint servers <radialgradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'r' in that specification.
refX - SVG: Scalable Vector Graphics
candi
date recommendation added keywords left, center, and right.
... candi
date recommendation initial definition for <symbol> scalable vector graphics (svg) 1.1 (second edition)the definition of 'refx' in that specification.
refY - SVG: Scalable Vector Graphics
candi
date recommendation added keywords left, center, and right.
... candi
date recommendation initial definition for <symbol> scalable vector graphics (svg) 1.1 (second edition)the definition of 'refy' in that specification.
spreadMethod - SVG: Scalable Vector Graphics
candi
date recommendation no change scalable vector graphics (svg) 2the definition of 'spreadmethod for <lineargradient>' in that specification.
... candi
date recommendation no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'spreadmethod for <radialgradient>' in that specification.
text-decoration - SVG: Scalable Vector Graphics
candi
date recommendation defines the property as a shorthand for text-decoration-line, text-decoration-style, and text-decoration-color.
... candi
date recommendation mainly refers to the definition in css text decoration 3 turning the property into a shorthand for text-decoration-line and text-decoration-style.
textLength - SVG: Scalable Vector Graphics
after updating the text width, the contents of the widthdisplay box are up
dated with the new value as well, and we're finished.
... candi
date recommendation allowed percentages and numbers as values.
x1 - SVG: Scalable Vector Graphics
candi
date recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'x1' in that specification.
... candi
date recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x1' in that specification.
x2 - SVG: Scalable Vector Graphics
candi
date recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'x2' in that specification.
... candi
date recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'x2' in that specification.
y1 - SVG: Scalable Vector Graphics
candi
date recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'y1' in that specification.
... candi
date recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y1' in that specification.
y2 - SVG: Scalable Vector Graphics
candi
date recommendation definition for <line> scalable vector graphics (svg) 2the definition of 'y2' in that specification.
... candi
date recommendation definition for <lineargradient> scalable vector graphics (svg) 1.1 (second edition)the definition of 'y2' in that specification.
Introduction to using XPath in JavaScript - XPath
note however, that if the document is mutated (the document tree is modified) between iterations that will invali
date the iteration and the invaliditeratorstate property of xpathresult is set to true, and a ns_error_dom_invalid_state_err exception is thrown.
... last up
dated
date: 2006-3-25.
Using the WebAssembly JavaScript API - WebAssembly
tables can be mutated via table.prototype.set(), which up
dates one of the values in a table, and table.prototype.grow(), which increases the number of values that can be stored in a table.
...: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-up
dated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-up
dated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
2015 MDN Fellowship Program - Archive of obsolete content
github: chrisdavidmills twitter: @chrisdavidmills why increase the reach and impact of your expertise grow your skills beyond coding and managing to educating and communicating build something used by hundreds of thousands (or more) developers worldwide directly impact and grow the value of the open web when application deadline: april 1, 2015 orientation: early june (
dates tbd) graduation: august 11-12, 2015 where orientation: a mozilla location (tbd).
Game over - Game development
up
date the last bit of code you modified again, to the following: if(y + dy < ballradius) { dy = -dy; } else if(y + dy > canvas.height-ballradius) { if(x > paddlex && x < paddlex + paddlewidth) { dy = -dy; } else { alert("game over"); document.location.reload(); clearinterval(interval); } } if the ball hits the bottom edge of the canvas we need to ch...
Mouse controls - Game development
add the following line in the same place as the other event listeners, just below the keyup event: document.addeventlistener("mousemove", mousemovehandler, false); anchoring the paddle movement to the mouse movement we can up
date the paddle position based on the pointer coordinates — the following handler function will do exactly that.
Build the brick field - Game development
up
date the brickx and bricky lines as follows: var brickx = (c*(brickinfo.width+brickinfo.padding))+brickinfo.offset.left; var bricky = (r*(brickinfo.height+brickinfo.padding))+brickinfo.offset.top; each brickx position is worked out as brickinfo.width plus brickinfo.padding, multiplied by the column number, c, plus the brickinfo.offset.left; the logic for the bricky is identical except that it uses ...
Buttons - Game development
to do that, adjust the up
date() function like so: function up
date() { game.physics.arcade.collide(ball, paddle, ballhitpaddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); if(playing) { paddle.x = game.input.x || game.world.width*0.5; } } that way the paddle is immovable after everything is loaded and prepared, but before the start of the actual game.
Collision detection - Game development
first, add a new line inside your up
date() function that checks for collision detection between ball and bricks, as shown below: function up
date() { game.physics.arcade.collide(ball, paddle); game.physics.arcade.collide(ball, bricks, ballhitbrick); paddle.x = game.input.x || game.world.width*0.5; } the ball's position is calculated against the positions of all the bricks in the group.
Extra lives - Game development
to make it easier for us to maintain in the future we can create a separate variable that will hold our styling, let's call it textstyle and place it before the text definitions: textstyle = { font: '18px arial', fill: '#0095dd' }; we can now use this variable when stlying our text labels — up
date your code so that the multiple instances of the text styling are replaced with the variable: scoretext = game.add.text(5, 5, 'points: 0', textstyle); livestext = game.add.text(game.world.width-5, 5, 'lives: '+lives, textstyle); livestext.anchor.set(1,0); lifelosttext = game.add.text(game.world.width*0.5, game.world.height*0.5, 'life lost, click to continue', textstyle); lifelosttext.anchor.set(0...
Scaling - Game development
up
date your existing preload() function as follows: function preload() { game.scale.scalemode = phaser.scalemanager.show_all; game.scale.pagealignhorizontally = true; game.scale.pagealignvertically = true; } scalemode has a few different options available for how the canvas can be scaled: no_scale — nothing is scaled.
Delta - MDN Web Docs Glossary: Definitions of Web-related terms
likewise, given the new value of x and its old value, you might compute the delta like this: let deltax = newx - oldx; more commonly, you receive the delta and use it to up
date a saved previous condition: let newx = oldx + deltax; learn more technical reference mouse wheel events (wheelevent offer the amount the wheel moved since the last event in its deltax, deltay, and deltaz properties, for example.
Forbidden header name - MDN Web Docs Glossary: Definitions of Web-related terms
forbidden header names start with proxy- or sec-, or are one of the following names: accept-charset accept-encoding access-control-request-headers access-control-request-method connection content-length cookie cookie2
date dnt expect feature-policy host keep-alive origin proxy- sec- referer te trailer transfer-encoding upgrade via note: the user-agent header is no longer forbidden, as per spec — see forbidden header name list (this was implemented in firefox 43) — it can now be set in a fetch headers object, or via xhr setrequestheader().
HTTP header - MDN Web Docs Glossary: Definitions of Web-related terms
a basic request with one header: get /example.http http/1.1 host: example.com redirects have mandatory headers (location): 302 found location: /newpage.html a typical set of headers: 304 not modified access-control-allow-origin: * age: 2318192 cache-control: public, max-age=315360000 connection: keep-alive
date: mon, 18 jul 2016 16:06:00 gmt server: apache vary: accept-encoding via: 1.1 3dc30c7222755f86e824b93feb8b5b8c.cloudfront.net (cloudfront) x-amz-cf-id: tol0fem6ui4fgldrkjx0vao5hpkkgzulyn2twd2gawltr7vlnjtvzw== x-backend-server: developer6.webapp.scl3.mozilla.com x-cache: hit from cloudfront x-cache-info: cached ...
reader.parse-on-load.force-enabled
type:boolean default value: false exists by default: yes application support:firefox mobile 23.0 status: active; last up
dated 2013-05-11 introduction: pushed to nightly on 2013-05-06 bugs: bug 867875 values true reader mode is enabled independent of memory available.
ui.SpellCheckerUnderline
type:string default value:#ff0000 exists by default: no application support: gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) status: active; last up
dated 2012-02-21 introduction: pushed to nightly on 2009-04-03 bugs: bug 338209 values a color code like #ff0000 for red.
ui.SpellCheckerUnderlineStyle
type:integer default value:5 exists by default: no application support: gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) status: active; last up
dated 2012-02-22 introduction: pushed to nightly on 2009-04-03 bugs: bug 338209 values the values are defined in nsstyleconsts.h.
ui.alertNotificationOrigin
type:integer default value:dependent on position of taskbar or equivalent exists by default: no application support: gecko 1.8.1.2 (firefox 2.0.0.2 / thunderbird 2.0.0.4 / seamonkey 1.1) status: active; last up
dated 2012-02-22 introduction: pushed to nightly on 2007-01-04 bugs: bug 133527 values 0 bottom right corner, vertical slide-in from the bottom 1 bottom right corner, horizontal slide-in from the right 2 bottom left corner, vertical slide-in from the bottom 3 bottom left corner, horizontal slide-in from the left 4 top right corner, vertical slide-in from the top 5 top right corner, horizontal slide-in from the right 6...
ui.textSelectBackground
type:string with rgb hex value as color code default value:#ef0fff (blue) [1] exists by default: no application support: before gecko 1.7 status: active; last up
dated 2015-09-21 introduction: pushed to trunk on 2000-04-13 bugs: bug 34704 [1]: nsxplookandfeel.cpp, line 628, retrieved 2015-09-21 ...
ui.textSelectForeground
type:string with rgb hex value as color code default value:#ffffff (white) [1] exists by default: no application support: before gecko 1.7 status: active; last up
dated 2015-09-21 introduction: pushed to trunk on 2000-04-13 bugs: bug 34704 [1]: nsxplookandfeel.cpp, line 635, retrieved 2015-09-21 ...
ui.tooltipDelay
type:integer default value:500 exists by default: no application support: gecko 11.0 (firefox 11.0 / thunderbird 11.0 / seamonkey 2.8) status: active; last up
dated 2012-02-21 introduction: pushed to nightly on 2011-12-15 bugs: bug 204786 values integer (milliseconds, default: 500) the time for delay between the mouse stopping over the element and the tooltip appearing is stored in milliseconds and the default value is 500ms.
Research and prep
here's the basic process: file a bug under mozilla localizations>[your_locale] to request up
dates to your locale's productization preferences.
L20n HTML Bindings
<link rel="localization" href="../locales/manifest.json"> an example of the manifest file (all keys are required): { "locales": [ "en-us", "pl"], "default_locale": "en-us", "resources": [ "../locales/{{locale}}/strings.l20n", "/shared/{{locale}}/
date.l20n"¨ ] } make html elements localizable use the data-l10n-id attribute on an html element to mark it as localizable.
Localization Use Cases
0 : 1; var sizeinfo = filesizeformatter.getreadablefilesize(size, fixeddigits); var _ = navigator.mozl10n.get; element.textcontent = _(l10nid, { size: sizeinfo.size, unit: _('byteunit-' + sizeinfo.unit) }); } the function is used like so: // application storage up
dateappfreespace: function storage_up
dateappfreespace() { var self = this; this.getfreespace(this.appstorage, function(freespace) { devicestoragehelper.showformatedsize(self.appstoragedesc, 'availablesize', freespace); }); }, problem definition for all values of freespace, the following string is enough to construct a grammatically-correct sentence in english: availablesize = {{$si...
L20n
note: this document is in draft form/out-of-
date — for current documentation please see our documentation on github.
Leak And Bloat Tests
1txfw.minimum/mail/local folders"); user_pref("mail.server.server2.directory", "/home/moztest/.thunderbird/t7i1txfw.minimum/mail/tinderbox"); user_pref("mail.attachment.store.version", 1); user_pref("mail.folder.views.version", 1); user_pref("mail.spam.version", 1); user_pref("mailnews.quotingprefs.version", 1); user_pref("mailnews.ui.threadpane.version", 6); changes to leak and bloat tests
date and time (pst) description approx effect on numbers pre dec 2008 initial version - 2008/12/07 11:20 bug 463594 disabled os x and outlook address books via the preference settings mac lk -56.2kb.
About NSPR
original document information author: larryh@netscape.com last up
dated
date: 2000 (portions of the introduction moved to the history section in 2012) ...
Creating a Cookie Log
original document information author(s): mike connor last up
dated
date: december 4, 2004 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
NSPR Poll Method
original document information author: wan teh chang last up
dated
date: june 27, 2006 ...
OLD SSL Reference
n ssl_authcertificatehook ssl_authcertificate ssl_badcerthook ssl_getclientauthdatahook nss_getclientauthdata ssl_handshakecallback ssl communication functions ssl_invali
datesession ssl_datapending ssl_securitystatus ssl_getsessionid ssl_setsockpeerid ssl functions used by callbacks ssl_peercertificate ssl_revealurl ssl_revealpinarg ssl handshake functions ...
sslcrt.html
validating certificates manipulating certificates getting certificate information comparing secitem objects validating certificates cert_verifycertnow cert_verifycertname cert_checkcertvalidtimes nss_cmpcertchainwcanames cert_verifycertnow checks that the current
date is within the certificate's validity period and that the ca signature on the certificate is valid.
sslerr.html
rforming this operation." sec_error_ocsp_malformed_response -8063 "the response from the ocsp server was corrupted or improperly formed." sec_error_ocsp_unauthorized_response -8062 "the signer of the ocsp response is not authorized to give status for this certificate." sec_error_ocsp_future_response -8061 "the ocsp response is not yet valid (contains a
date in the future)." sec_error_ocsp_old_response -8060 "the ocsp response contains out-of-
date information." sec_error_digest_not_found -8059 "the cms or pkcs #7 digest was not found in signed message." sec_error_unsupported_message_type -8058 "the cms or pkcs #7 message type is unsupported." sec_error_module_stuck -8057 "pkcs #11 module cou...
sslintro.html
functions that can be used by both clients and servers during communication include the following: pr_send or pr_write pr_read or pr_recv pr_geterror pr_getpeername pr_sleep pr_malloc pr_free pr_poll pr_now pr_intervaltomilliseconds pr_millisecondstointerval pr_shutdown pr_close ssl_invali
datesession after establishing a connection, an application first calls pr_send, pr_recv, pr_read, pr_write, or ssl_forcehandshake to initiate the handshake.
SSL functions
ssl_getclientauthdatahook mxr 3.2 and later ssl_getmaxservercachelocks mxr 3.4 and later ssl_getsessionid mxr 3.2 and later ssl_getstatistics mxr 3.2 and later ssl_handshakecallback mxr 3.2 and later ssl_importfd mxr 3.2 and later ssl_inheritmpserversidcache mxr 3.2 and later ssl_invali
datesession mxr 3.2 and later ssl_localcertificate mxr 3.4 and later ssl_optionget mxr 3.2 and later ssl_optiongetdefault mxr 3.2 and later ssl_optionset mxr 3.2 and later ssl_optionsetdefault mxr 3.2 and later ssl_peercertificate mxr 3.2 and later ssl_preencryptedfiletostream mxr 3.2 and lat...
NSS Tools pk12util-tasks
nss security tools: pk12util tasks newsgroup: mozilla.dev.tech.crypto task list need to migrate code to use an up-to-
date version of nss.
NSS Tools pk12util
ng values: 0 - no error 1 - user cancelled 2 - usage error 6 - nls init error 8 - certificate db open error 9 - key db open error 10 - file initialization error 11 - unicode conversion error 12 - temporary file creation error 13 - pkcs11 get slot error 14 - pkcs12 decoder start error 15 - error read from import file 16 - pkcs12 decode error 17 - pkcs12 decoder verify error 18 - pkcs12 decoder vali
date bags error 19 - pkcs12 decoder import bags error 20 - key db conversion version 3 to version 2 error 21 - cert db conversion version 7 to version 5 error 22 - cert and key dbs patch error 23 - get default cert db error 24 - find cert by nickname error 25 - create export context error 26 - pkcs12 add password itegrity error 27 - cert and key safes creation error 28 - pkcs12 add cert and key error ...
NSS tools : pk12util
- certificate db open error o 9 - key db open error o 10 - file initialization error o 11 - unicode conversion error o 12 - temporary file creation error o 13 - pkcs11 get slot error o 14 - pkcs12 decoder start error o 15 - error read from import file o 16 - pkcs12 decode error o 17 - pkcs12 decoder verify error o 18 - pkcs12 decoder vali
date bags error o 19 - pkcs12 decoder import bags error o 20 - key db conversion version 3 to version 2 error o 21 - cert db conversion version 7 to version 5 error o 22 - cert and key dbs patch error o 23 - get default cert db error o 24 - find cert by nickname error o 25 - create export context error o 26 - pkcs12 add password itegrity error o 27...
NSS tools : vfychain
options -a the following certfile is base64 encoded -b yymmddhhmmz vali
date date (default: now) -d directory database directory -f enable cert fetching from aia url -o oid set policy oid for cert validation(format oid.1.2.3) -p use pkix library to vali
date certificate by calling: * cert_verifycertificate if specified once, * cert_pkixverifycert if specified twice and more.
Necko FAQ
todo original document information author(s): gagan saksena last up
dated
date: december 21, 2001 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
The Necko HTTP module
original document information last up
dated
date: may 12, 2003 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details ...
Proxies in Necko
original document information author(s): christian biesinger last up
dated
date: april 8, 2005 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Pork
please refer to the oink link below for a more up-to-
date toolchain.
Download Rhino
binaries release release
date change log download link rhino 1.7r4 2012-06-18 new in rhino 1.7r4 rhino1_7r4.zip rhino 1.7r5 2015-01-29 release notes rhino1_7r5.zip rhino 1.7.6 2015-04-15 release notes rhino1.7.6.zip rhino 1.7.7 2015-06-17 release notes rhino1.7.7.zip rhino 1.7.7.1 2016-02-01 release notes rhino1.7.7.1.zip rhino 1.7.7.2 2017-08-24 release notes rhino1.7.7.2.zip rhino 1.7.8 2018-01-22 release notes rhino1.7.8.zip rhino 1.7.9 2018-03-15 release notes rhino1.7.9.zip rhino 1.7.10 2018-04-09 release notes rhino1.7.10.zip ...
nsMsgSearchOpValue
49 interface nsmsgsearchop { 150 const nsmsgsearchopvalue contains = 0; /* for text attributes */ 151 const nsmsgsearchopvalue doesntcontain = 1; 152 const nsmsgsearchopvalue is = 2; /* is and isn't also apply to some non-text attrs */ 153 const nsmsgsearchopvalue isnt = 3; 154 const nsmsgsearchopvalue isempty = 4; 155 156 const nsmsgsearchopvalue isbefore = 5; /* for
date attributes */ 157 const nsmsgsearchopvalue isafter = 6; 158 159 const nsmsgsearchopvalue ishigherthan = 7; /* for priority.
nsMsgViewSortOrder
for example to sort by
date you would pass a function the value: components.interfaces.nsmsgviewsortorder.ascending mailnews/base/public/nsimsgdbview.idlscriptable please add a summary to this article.
Performance
for example sqlite> explain query plan select * from moz_historyvisit v join moz_history h on v.page_id = h.id where v.visit_
date > 1000000000; 0|0|table moz_historyvisit as v with index moz_historyvisit_
dateindex 1|1|table moz_history as h using primary key this tells us that it will first look up in moz_historyvisit using an index, and will then look up in moz_history using the primary key.
Status, Recent Changes, and Plans
added an entire section to the getting started guide on nscomptrs in function signatures added references to recent bugs influencing the use of nscomptr machinery: bug 59212, and bug 59414 fixed comparisons 1 and 3, as per comments by morten welinder up
dated examples to prefer direct initialization over copy initialization.
Using nsCOMPtr
general bibliography original document information author(s): scott collins last up
dated
date: december 11, 2001 copyright information: copyright © 1999, 2000 by the mozilla organization; use is subject to the mpl.
Using nsIClassInfo
original document information authors: mike shaver, justin lebar last up
dated
date: july 25, 2011 copyright information: portions of this content are © 1998–2011 by individual mozilla.org contributors; content available under a creative commons license | details.
Using nsIDirectoryService
related pages code_snippets:file_i/o original document information authors: conrad carlen, doug turner last up
dated
date: september 26, 2000 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
Weak reference
see also the source xpcom/base/nsiweakreference.idl xpcom/glue/nsweakreference.h xpcom/glue/nsweakreference.cpp xpcom ownership guidelines using nscomptr original document information author: scott collins last up
dated
date: september 23, 2000 copyright information: portions of this content are © 1998–2007 by individual mozilla.org contributors; content available under a creative commons license | details.
XPCOM ownership guidelines
original document information author: scott collins last up
dated
date: may 8, 2003 copyright information: copyright© 1999 by netscape; use is subject to the npl.
XPCOM
if the referent object is destroyed before the weak reference, the pointer inside the weak reference is set to nsnull.working with multiple versions of interfacesin this short note we illustrate how one can up
date an xpcom module in order for it to work in both firefox 2 and firefox 3, even if the interfaces have changed in the interim.working with out parameterswrappedjsobjectwrappedjsobject is a property sometimes available on xpconnect wrappers.
XTF
xtf home the xtf home (out
dated).
XUL Overlays
though overlays often define ui elements that have been added as a result of an up
date or enhancement of some kind, they can be used in many different ways.
Address Book examples
list object that implements nsiabdirectory: let abmanager = components.classes["@mozilla.org/abmanager;1"] .getservice(components.interfaces.nsiabmanager); let maillistdirectory = abmanager.getdirectory(maillistcard.maillisturi); you can then adjust the items in the actual mailing list: maillistdirectory.addresslists.appendelement(newcard, false); then save the up
dated list to the database: maillistdirectory.editmaillisttodatabase(maillistcard); deleting a mailing list there are two ways to delete a mailing list.
Gloda examples
ation); query.subjectmatches("gloda makes searching easy"); query.getcollection(alistener) search messages by tags searches for all messages having any (or several) of all tags defined in tb let query = gloda.newquery(gloda.noun_message); let tagarray = mailservices.tags.getalltags({}); query.tags(...tagarray); let collection = query.getcollection(mylistener); search messages by
daterange searches for all messages within a
date range id_q=gloda.newquery(gloda.noun_message); // define a
date range form yesterday to now id_q.
daterange([new
date() - 86400000, new
date()]); var mylistener = { /* called when new items are returned by the database query or freshly indexed */ onitemsadded: function _onitemsadded(aitems, acollection) { }, /* called when items that a...
CanvasCaptureMediaStreamTrack.requestFrame() - Web APIs
this may change in the future, so it would be wise to plan ahead and watch for exceptions such as securityerror (although the specific error that might be thrown is not mentioned in the spec, this is a likely candi
date).
CanvasPattern.setTransform() - Web APIs
); pattern.settransform(matrix.rotate(-45).scale(1.5)); ctx.fillstyle = pattern; ctx.fillrect(0, 0, 400, 400); }; note that newer browser versions started to support dommatrix as an input to settransform(), so for example you could replace the svgmatrix in the above example with the following: const matrix = new dommatrix([1, .2, .8, 1, 0, 0]); edit the code below and see your changes up
date live in the canvas: playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"></canvas> <svg id="svg1" style="display:none"></svg> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code" style="height:120px"> var img = new image(); img.src = 'http...
CanvasRenderingContext2D.addHitRegion() - Web APIs
ion) { alert('ouch, my eye :('); } }); ctx.beginpath(); ctx.arc(100, 100, 75, 0, 2 * math.pi); ctx.linewidth = 5; ctx.stroke(); // eyes ctx.beginpath(); ctx.arc(70, 80, 10, 0, 2 * math.pi); ctx.arc(130, 80, 10, 0, 2 * math.pi); ctx.fill(); ctx.addhitregion({id: "eyes"}); // mouth ctx.beginpath(); ctx.arc(100, 110, 50, 0, math.pi); ctx.stroke(); edit the code below to see your changes up
date live in the canvas.
CanvasRenderingContext2D.scrollPathIntoView() - Web APIs
html <canvas id="canvas"></canvas> javascript const canvas = document.getelementbyid('canvas'); const ctx = canvas.getcontext('2d'); ctx.beginpath(); ctx.fillrect(10, 10, 30, 30); ctx.scrollpathintoview(); edit the code below to see your changes up
date live in the canvas: playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"> <input id="button" type="range" min="1" max="12"> </canvas> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code"> ctx.beginpath(); ctx.rect(10, 10, 30, 30); ctx.scro...
Drawing text - Web APIs
a textbaseline example edit the code below and see your changes up
date live in the canvas: ctx.font = '48px serif'; ctx.textbaseline = 'hanging'; ctx.stroketext('hello world', 0, 100); playable code <canvas id="canvas" width="400" height="200" class="playable-canvas"></canvas> <div class="playable-buttons"> <input id="edit" type="button" value="edit" /> <input id="reset" type="button" value="reset" /> </div> <textarea id="code" class="playable-code"> ctx.fo...
CompositionEvent.initCompositionEvent() - Web APIs
syntax compositioneventinstance.initcompositionevent(typearg, canbubblearg, cancelablearg, viewarg, dataarg, localearg) parameters typearg a domstring representing the type of composition event; this will be one of compositionstart, compositionup
date, or compositionend.
ConstrainBoolean - Web APIs
candi
date recommendation initial definition technically, constrainboolean is actually based on an intermediary dictionary named constrainbooleanparameters, which adds exact and ideal to the simple boolean type.
ConstrainDOMString - Web APIs
candi
date recommendation initial definition technically, constraindomstring is actually based on an intermediary dictionary named constraindomstringparameters, which adds exact and ideal to domstring.
ConstrainDouble - Web APIs
candi
date recommendation initial definition technically, constraindouble is actually based on an intermediary dictionary named constraindoublerange, which adds exact and ideal to doublerange, with constraindouble being a type that can be either a long integer or a doublerange.
ConstrainULong - Web APIs
candi
date recommendation initial definition technically, constrainulong is actually based on an intermediary dictionary named constrainulongrange, which adds exact and ideal to ulongrange, with constrainulong being a type that can be either a long integer or a ulongrange.
Page Visibility API - Web APIs
a site has an image carousel that shouldn't advance to the next slide unless the user is viewing the page an application showing a dashboard of information doesn't want to poll the server for up
dates when the page isn't visible a page wants to detect when it is being prerendered so it can keep accurate count of page views a site wants to switch off sounds when a device is in standby mode (user pushes power button to turn screen off) developers have historically used imperfect proxies to detect this.
PannerNode.coneInnerAngle - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.coneOuterAngle - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.coneOuterGain - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.distanceModel - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode.maxDistance - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode.orientationX - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.orientationY - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.orientationZ - Web APIs
outer cone // setting it to 0 means there is no sound, so we can clearly hear when we leave the cone // 0 is also the default panner.coneoutergain = 0; // increase the z position to ensure the cone has an effect // (otherwise the sound is located at the same position as the listener) panner.positionz.setvalueattime(1, context.currenttime); having set up the pannernode, we can now schedule some up
dates to its y-axis rotation: // calculate the vector for no rotation // this means the sound will play at full volume const [x1, y1, z1] = yrotationtovector(0); // schedule the no-rotation vector immediately panner.orientationx.setvalueattime(x1, context.currenttime); panner.orientationy.setvalueattime(y1, context.currenttime); panner.orientationz.setvalueattime(z1, context.currenttime); // calcula...
PannerNode.panningModel - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode.setOrientation() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode.setPosition() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode.setVelocity() - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
PannerNode - Web APIs
generally you will define the position in 3d space that your audio listener and panner (source) occupy initially, and then up
date the position of one or both of these as the application is used.
Window.mozAnimationStartTime - Web APIs
this value should be used instead of, for example,
date.now(), because this value will be the same for all animations started in this window during this refresh interval, allowing them to remain in sync with one another.
Window: popstate event - Web APIs
if new-entry has a different document object than current-entry, the browsing context is up
dated so that its document property refers to the document referred to by new-entry, and the context's name is up
dated to match the context name of the now-current document.
Window.screenLeft - Web APIs
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftup
date = initialleft - newleft; let topup
date = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftup
date + (width/2), topup
date + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenTop - Web APIs
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftup
date = initialleft - newleft; let topup
date = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftup
date + (width/2), topup
date + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenX - Web APIs
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftup
date = initialleft - newleft; let topup
date = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftup
date + (width/2), topup
date + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.screenY - Web APIs
initialleft = window.screenleft + canvaselem.offsetleft; initialtop = window.screentop + canvaselem.offsettop; function positionelem() { let newleft = window.screenleft + canvaselem.offsetleft; let newtop = window.screentop + canvaselem.offsettop; let leftup
date = initialleft - newleft; let topup
date = initialtop - newtop; ctx.fillstyle = 'rgb(0, 0, 0)'; ctx.fillrect(0, 0, width, height); ctx.fillstyle = 'rgb(0, 0, 255)'; ctx.beginpath(); ctx.arc(leftup
date + (width/2), topup
date + (height/2) + 35, 50, degtorad(0), degtorad(360), false); ctx.fill(); pelem.textcontent = 'window.screenleft: ' + window.screenleft + ', window.screentop: ' +...
Window.setImmediate() - Web APIs
this method is used to break up long running operations and run a callback function immediately after the browser has completed other operations such as events and display up
dates.
Window - Web APIs
window.up
datecommands() up
dates the state of commands of the current chrome window (ui).
WorkerGlobalScope.self - Web APIs
observe: function observe() { [native code] } prototype: array[0] unobserve: function unobserve() { [native code] } __proto__: function empty() {} <function scope> arraybuffer: function arraybuffer() { [native code] } blob: function blob() { [native code] } boolean: function boolean() { [native code] } dataview: function dataview() { [native code] }
date: function
date() { [native code] } dedicatedworkerglobalscope: function dedicatedworkerglobalscope() { [native code] } error: function error() { [native code] } // etc.
WorkerNavigator.permissions - Web APIs
the workernavigator.permissions read-only property returns a permissions object that can be used to query and up
date permission status of apis covered by the permissions api.
Working with objects - JavaScript
examples are as follows: // four variables are created and assigned in a single go, // separated by commas var myobj = new object(), str = 'mystring', rand = math.random(), obj = new object(); myobj.type = 'dot syntax'; myobj['
date created'] = 'string with space'; myobj[str] = 'string value'; myobj[rand] = 'random number'; myobj[obj] = 'object'; myobj[''] = 'even an empty string'; console.log(myobj); please note that all keys in the square bracket notation are converted to string unless they're symbols, since javascript object property names (keys) can only be strings...
JavaScript Guide - JavaScript
error objects loops and iteration for while do...while break/continue for..in for..of functions defining functions calling functions function scope closures arguments & parameters arrow functions expressions and operators assignment & comparisons arithmetic operators bitwise & logical operators conditional (ternary) operator numbers and
dates number literals number object math object
date object text formatting string literals string object template literals internationalization regular expressions indexed collections arrays typed arrays keyed collections map weakmap set weakset working with objects objects and properties creating objects defining methods getter and set...
JavaScript technologies overview - JavaScript
the internationalization api provides collation (string comparison), number formatting, and
date-and-time formatting for javascript applications, letting the applications choose the language and tailor the functionality to their needs.
JavaScript language resources - JavaScript
the following ecmascript standards have been approved or are being worked on: name links release
date description current editions ecma-262 10th edition pdf, html, working draft, repository 2019 ecmascript 2019 language specification ecma-262 9th edition pdf, html, working draft, repository 2018 ecmascript 2018 language specification ecma-402 5th edition working draft, repository 2018 ecmascript 2018 internationalization api specification obsolete/historical editions ecma-262 pdf ...
Memory Management - JavaScript
var d = new
date(); // allocates a
date object var e = document.createelement('div'); // allocates a dom element some methods allocate new values or objects: var s = 'azerty'; var s2 = s.substr(0, 3); // s2 is a new string // since strings are immutable values, // javascript may decide to not allocate memory, // but just store the [0, 3] range.
SyntaxError: "x" is a reserved identifier - JavaScript
var colorenum = { red: 0, green: 1, blue: 2 }; var list = ["potatoes", "rice", "fries"]; up
date older browsers if you are using an older browser that does not yet implement let or class, for example, you should up
date to a more recent browser version that does support these new language features.
setter - JavaScript
when current is assigned a value, it up
dates log with that value: const language = { set current(name) { this.log.push(name); }, log: [] } language.current = 'en'; console.log(language.log); // ['en'] language.current = 'fa'; console.log(language.log); // ['en', 'fa'] note that current is not defined, and any attempts to access it will result in undefined.
Array.prototype.forEach() - JavaScript
[2, 5, , 9].foreach(logarrayelements) // logs: // a[0] = 2 // a[1] = 5 // a[3] = 9 using thisarg the following (contrived) example up
dates an object's properties from each entry in the array: function counter() { this.sum = 0 this.count = 0 } counter.prototype.add = function(array) { array.foreach((entry) => { this.sum += entry ++this.count }, this) // ^---- note } const obj = new counter() obj.add([2, 5, 9]) obj.count // 3 obj.sum // 16 since the thisarg parameter (this) is provided to foreach(), it is passed...
Error - JavaScript
', ...params) { // pass remaining arguments (including vendor specific ones) to parent constructor super(...params) // maintains proper stack trace for where our error was thrown (only available on v8) if (error.capturestacktrace) { error.capturestacktrace(this, customerror) } this.name = 'customerror' // custom debugging information this.foo = foo this.
date = new
date() } } try { throw new customerror('baz', 'bazmessage') } catch(e) { console.error(e.name) //customerror console.error(e.foo) //baz console.error(e.message) //bazmessage console.error(e.stack) //stacktrace } es5 custom error object all browsers include the customerror constructor in the stack trace when using a prototypal declaration.
JSON - JavaScript
examples example json { "browsers": { "firefox": { "name": "firefox", "pref_url": "about:config", "releases": { "1": { "release_
date": "2004-11-09", "status": "retired", "engine": "gecko", "engine_version": "1.7" } } } } } specifications specification ecmascript (ecma-262)the definition of 'json' in that specification.
Number - JavaScript
using number to convert a
date object the following example converts the
date object to a numerical value using number as a function: let d = new
date('december 17, 1995 03:24:00') console.log(number(d)) this logs 819199440000.
Object.prototype.__proto__ - JavaScript
for objects created using new fun, where fun is one of the built-in constructor functions provided by javascript (array, boolean,
date, number, object, string, and so on — including new constructors added as javascript evolves), this value is always fun.prototype.
Object.prototype.valueOf() - JavaScript
examples using valueof on custom types function mynumbertype(n) { this.number = n; } mynumbertype.prototype.valueof = function() { return this.number; }; var myobj = new mynumbertype(4); myobj + 3; // 7 using unary plus +"5" // 5 (string to number) +"" // 0 (string to number) +"1 + 2" // nan (doesn't evaluate) +new
date() // same as (new
date()).gettime() +"foo" // nan (string to number) +{} // nan +[] // 0 (tostring() returns an empty string list) +[1] // 1 +[1,2] // nan +new set([1]) // nan +bigint(1) // uncaught typeerror: cannot convert a bigint value to a number +undefined // nan +null // 0 +true // 1 +false // 0 specifications specification ecmascript (ecma-262)the definition of 'o...
Promise - JavaScript
"use strict"; // to experiment with error handling, "threshold" values cause errors randomly const threshold_a = 8; // can use zero 0 to guarantee error function tetheredgetnumber(resolve, reject) { try { settimeout( function() { const randomint =
date.now(); const value = randomint % 10; try { if(value >= threshold_a) { throw new error(`too large: ${value}`); } } catch(msg) { reject(`error in callback ${msg}`); } resolve(value); return; }, 500); // to experiment with error at set-up, uncomment the following 'throw'.
Proxy - JavaScript
validation with a proxy, you can easily vali
date the passed value for an object.
Reflect.construct() - JavaScript
} let obj3 = object.create(otherclass.prototype); oneclass.apply(obj3, args) // output: // oneclass // undefined examples using reflect.construct() let d = reflect.construct(
date, [1776, 6, 4]) d instanceof
date // true d.getfullyear() // 1776 specifications specification ecmascript (ecma-262)the definition of 'reflect.construct' in that specification.
RegExp.prototype.exec() - JavaScript
return value if the match succeeds, the exec() method returns an array (with extra properties index and input; see below) and up
dates the lastindex property of the regular expression object.
SharedArrayBuffer - JavaScript
var sab = new sharedarraybuffer(1024); worker.postmessage(sab); updating and synchronizing shared memory with atomic operations shared memory can be created and up
dated simultaneously in workers or the main thread.
WeakMap.prototype.set() - JavaScript
examples using the set method var wm = new weakmap(); var obj = {}; // add new elements to the weakmap wm.set(obj, 'foo').set(window, 'bar'); // chainable // up
date an element in the weakmap wm.set(obj, 'baz'); specifications specification ecmascript (ecma-262)the definition of 'weakmap.prototype.set' in that specification.
WebAssembly.Global() constructor - JavaScript
: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-up
dated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-up
dated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
WebAssembly.Global - JavaScript
: ${got}<br>`; } asserteq("webassembly.global exists", typeof webassembly.global, "function"); const global = new webassembly.global({value:'i32', mutable:true}, 0); webassembly.instantiatestreaming(fetch('global.wasm'), { js: { global } }) .then(({instance}) => { asserteq("getting initial value from wasm", instance.exports.getglobal(), 0); global.value = 42; asserteq("getting js-up
dated value from wasm", instance.exports.getglobal(), 42); instance.exports.incglobal(); asserteq("getting wasm-up
dated value from js", global.value, 43); }); note: you can see the example running live on github; see also the source code.
isNaN() - JavaScript
ted to the number 37 which is not nan isnan('37.37'); // false: "37.37" is converted to the number 37.37 which is not nan isnan("37,5"); // true isnan('123abc'); // true: parseint("123abc") is 123 but number("123abc") is nan isnan(''); // false: the empty string is converted to 0 which is not nan isnan(' '); // false: a string with spaces is converted to 0 which is not nan //
dates isnan(new
date()); // false isnan(new
date().tostring()); // true // this is a false positive and the reason why isnan is not entirely reliable isnan('blabla'); // true: "blabla" is converted to a number.
Equality (==) - JavaScript
rence the same object for comparison to succeed: const string1 = "hello"; const string2 = string("hello"); const string3 = new string("hello"); const string4 = new string("hello"); console.log(string1 == string2); // true console.log(string1 == string3); // true console.log(string2 == string3); // true console.log(string3 == string4); // false console.log(string4 == string4); // true comparing
dates and strings const d = new
date('december 17, 1995 03:24:00'); const s = d.tostring(); // for example: "sun dec 17 1995 03:24:00 gmt-0800 (pacific standard time)" console.log(d == s); //true specifications specification ecmascript (ecma-262)the definition of 'equality operators' in that specification.
Logical OR assignment (||=) - JavaScript
examples setting default content if the "lyrics" element is empty, set the innerhtml to a default value: document.getelementbyid('lyrics').innerhtml ||= '<i>no lyrics.</i>' here the short-circuit is especially beneficial, since the element will not be up
dated unnecessarily and won't cause unwanted side-effects such as additional parsing or rendering work, or loss of focus, etc.
Optional chaining (?.) - JavaScript
the optional chaining operator (?.) permits reading the value of a property located deep within a chain of connected objects without having to expressly vali
date that each reference in the chain is valid.
Spread syntax (...) - JavaScript
however, an array can be easily used with new thanks to spread syntax: const
datefields = [1970, 0, 1]; // 1 jan 1970 const d = new
date(...
datefields); to use new with an array of parameters without spread syntax, you would have to do it indirectly through partial application: function applyandnew(constructor, args) { function partial () { return constructor.apply(this, args); }; if (typeof constructor.prototype === "object") { partial.prototype = obj...
typeof - JavaScript
eof symbol('foo') === 'symbol' typeof symbol.iterator === 'symbol' // undefined typeof undefined === 'undefined'; typeof declaredbutundefinedvariable === 'undefined'; typeof undeclaredvariable === 'undefined'; // objects typeof {a: 1} === 'object'; // use array.isarray or object.prototype.tostring.call // to differentiate regular objects from arrays typeof [1, 2, 4] === 'object'; typeof new
date() === 'object'; typeof /regex/ === 'object'; // see regular expressions section for historical results // the following are confusing, dangerous, and wasteful.
export - JavaScript
bindings that are exported can still be modified locally; when imported, although they can only be read by the importing module the value up
dates whenever it is up
dated by the exporting module.
import - JavaScript
bindings imported are called live bindings because they are up
dated by the module that exported the binding.
throw - JavaScript
this.tostring = function() { return string(this.value) }; } else { throw new zipcodeformatexception(zip); } } function zipcodeformatexception(value) { this.value = value; this.message = 'does not conform to the expected format for a zip code'; this.tostring = function() { return this.value + this.message; }; } /* * this could be in a script that vali
dates address data * for us addresses.
JavaScript
standard objects get to know standard built-in objects array, boolean,
date, error, function, json, math, number, object, regexp, string, map, set, weakmap, weakset, and others.
<mtable> - MathML
in gecko 17.0 (firefox 17.0 / thunderbird 17.0 / seamonkey 2.14) the parsing has been up
dated to treat whitespace correctly.
Handling media support issues in web content - Web media technologies
<img src="/images/stafff-photo-huge-progressive.jpg" alt="staff photo, taken in january of 1972"> when using a progressive image, the data is stored in such a way that the browser is able to render a low-quality representation of the image as soon as possible, then up
date the image as it loads—or after it's finished loading—to present it in full quality.
Web Performance
beginner's tutorials the mdn web performance learning area contains modern, up-to-
date tutorials covering performance essentials.
Add to Home screen - Progressive web apps (PWAs)
deferredprompt = e; // up
date ui to notify the user they can add to home screen addbtn.style.display = 'block'; addbtn.addeventlistener('click', (e) => { // hide our user interface that shows our a2hs button addbtn.style.display = 'none'; // show the prompt deferredprompt.prompt(); // wait for the user to respond to the prompt deferredprompt.userchoice.then((choiceresult) => { if (choicere...
SVG Event Attributes - SVG: Scalable Vector Graphics
, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onstalled, onsubmit, onsuspend, ontimeup
date, ontoggle, onvolumechange, onwaiting graphical event attributes onactivate, onfocusin, onfocusout ...
alignment-baseline - SVG: Scalable Vector Graphics
candi
date recommendation refers to the definition in css inline layout and notes the changes to auto, before-edge, after-edge, text-before-edge, and text-after-edge scalable vector graphics (svg) 1.1 (second edition)the definition of 'alignment-baseline' in that specification.
begin - SVG: Scalable Vector Graphics
those are: focus, blur, focusin, focusout, activate, auxclick, click, dblclick, mousedown, mouseenter, mouseleave, mousemove, mouseout, mouseover, mouseup, wheel, beforeinput, input, keydown, keyup, compositionstart, compositionup
date, compositionend, load, unload, abort, error, select, resize, scroll, beginevent, endevent, and repeatevent.