Search completed in 0.91 seconds.
2694 results for "Select":
Your results are loading. Please wait...
<select>: The HTML Select element - HTML: Hypertext Markup Language
WebHTMLElementselect
the html <select> element represents a control that provides a menu of options: the source for this interactive example is stored in a github repository.
... the above example shows typical <select> usage.
...each menu option is defined by an <option> element nested inside the <select>.
...And 28 more matches
HTMLSelectElement.selectedOptions - Web APIs
the read-only htmlselectelement property selectedoptions contains a list of the <option> elements contained within the <select> element that are currently selected.
... the list of selected options is an htmlcollection object with one entry per currently selected option.
... an option is considered selected if it has an htmloptionelement.selected attribute.
...And 10 more matches
Selection.selectAllChildren() - Web APIs
the selection.selectallchildren() method adds all the children of the specified node to the selection.
... previous selection is lost.
... syntax sel.selectallchildren(parentnode) parameters parentnode all children of parentnode will be selected.
...And 2 more matches
HTMLSelectElement.selectedIndex - Web APIs
the htmlselectelement.selectedindex is a long that reflects the index of the first or last selected <option> element, depending on the value of multiple.
... the value -1 indicates that no element is selected.
... syntax var index = selectelem.selectedindex; selectelem.selectedindex = index; example html <p id="p">selectedindex: 0</p> <select id="select"> <option selected>option a</option> <option>option b</option> <option>option c</option> <option>option d</option> <option>option e</option> </select> javascript var selectelem = document.getelementbyid('select') var pelem = document.getelementbyid('p') // when a new <option> is selected selectelem.addeventlistener('change', function() { var index = selectelem.selectedindex; // add that data to the <p> pelem.innerhtml = 'selectedindex: ' + index; }) specifications specification status comment html living standardthe definition of 'htmlselectelement' in that specification.
... html5the definition of 'htmlselectelement' in that specification.
Selection.selectionLanguageChange() - Web APIs
selection.selectionlanguagechange() method is a gecko/firefox internal method that was exposed to web pages until firefox 29.
Selection - Web APIs
WebAPISelection
a selection object represents the range of text selected by the user or the current position of the caret.
... to obtain a selection object for examination or manipulation, call window.getselection().
... a user may make a selection from left to right (in document order) or right to left (reverse of document order).
...And 54 more matches
nsISelectionController
content/base/public/nsiselectioncontroller.idlscriptable please add a summary to this article.
... inherits from: nsiselectiondisplay last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void characterextendforbackspace(); native code only!
... void charactermove(in boolean forward, in boolean extend); boolean checkvisibility(in nsidomnode node, in short startoffset, in short endoffset); void completemove(in boolean forward, in boolean extend); void completescroll(in boolean forward); boolean getcaretenabled(); short getdisplayselection(); nsiselection getselection(in short type); void intralinemove(in boolean forward, in boolean extend); void linemove(in boolean forward, in boolean extend); void pagemove(in boolean forward, in boolean extend); void repaintselection(in short type); void scrollhorizontal(in boolean left); ...
...And 47 more matches
Tree Selection - Archive of obsolete content
« previousnext » the section will describe how to get and set the selected items in a tree.
... getting the selected tree items each item in a tree (that corresponds to treeitem element, if using content tree view) may be selected individually.
... if you add the seltype attribute to the tree, set to the value single, the user may only select one row at a time.
...And 41 more matches
nsITreeSelection
layout/xul/base/src/tree/public/nsitreeselection.idlscriptable this interface is used by the tree widget to get information about what is selected.
... inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview void adjustselection(in long index, in long count); void clearrange(in long startindex, in long endindex); void clearselection(); void getrangeat(in long i, out long min, out long max); long getrangecount(); void invalidateselection(); void invertselection(); boolean isselected(in long index); void rangedselect(in long startindex, in long endindex, in boolean augment); void select(in long index); void selectall(); void timedselect(in long index, in long delay); void toggleselect(in long index); attributes attribute type description count long the number of rows...
... currently selected in this tree.
...And 36 more matches
HTMLSelectElement - Web APIs
the htmlselectelement interface represents a <select> html element.
...aco,andale mono,monospace" fill="#4d4e53" text-anchor="middle" alignment-baseline="middle">htmlelement</text></a><polyline points="491,25 501,20 501,30 491,25" stroke="#d4dde4" fill="none"/><line x1="501" y1="25" x2="509" y2="25" stroke="#d4dde4"/><line x1="509" y1="25" x2="509" y2="90" stroke="#d4dde4"/><line x1="509" y1="90" x2="492" y2="90" stroke="#d4dde4"/><a xlink:href="/docs/web/api/htmlselectelement" target="_top"><rect x="321" y="65" width="170" height="50" fill="#f4f7f8" stroke="#d4dde4" stroke-width="2px" /><text x="406" y="94" font-size="12px" font-family="consolas,monaco,andale mono,monospace" fill="#4d4e53" text-anchor="middle" alignment-baseline="middle">htmlselectelement</text></a></svg></div> a:hover text { fill: #0095dd; pointer-events: all;} properties this inte...
... htmlselectelement.autofocus a boolean reflecting the autofocus html attribute, which indicates whether the control should have input focus when the page loads, unless the user overrides it, for example by typing in a different control.
...And 35 more matches
nsISelection
nsiselection content/base/public/nsiselection.idlscriptable ???
... inherits from: nsisupports last changed in gecko 13.0 (firefox 13.0 / thunderbird 13.0 / seamonkey 2.10) interface for manipulating and querying the current selected range of nodes within the document.
...as a service: var selection = components.classes["@mozilla.org/????????????????????????????"] .createinstance(components.interfaces.nsiselection); method overview void addrange(in nsidomrange range); void collapse(in nsidomnode parentnode, in long offset); [noscript,notxpcom,nostdcall] boolean collapsed(); void collapsenative(in nsidomnode parentnode, in long offset); native code only!
...And 32 more matches
CSS selectors - Learn web development
previous overview: building blocks next in css, selectors are used to target the html elements on our web pages that we want to style.
... there are a wide variety of css selectors available, allowing for fine-grained precision when selecting elements to style.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn how css selectors work in detail.
...And 27 more matches
nsIAccessibleSelectable
accessible/public/nsiaccessibleselectable.idlscriptable an interface for the accessibility module and in-process accessibility clients for dealing with getting and changing the selection of accessible nodes.
... inherits from: nsisupports last changed in gecko 1.7 method overview void addchildtoselection(in long index); void clearselection(); nsiarray getselectedchildren(); boolean ischildselected(in long index); nsiaccessible refselection(in long index); void removechildfromselection(in long index); boolean selectallselection(); attributes attribute type description selectioncount long the number of accessible children currently selected.
... constants constant value description eselection_add 0 eselection_remove 1 eselection_getstate 2 methods addchildtoselection() adds the specified accessible child of the object to the object's selection.
...And 20 more matches
Type, class, and ID selectors - Learn web development
previous overview: building blocks next in this lesson we will take a look at the simplest selectors that are available, which you will probably use the most in your work.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the different css selectors we can use to apply css to a document.
... type selectors a type selector is sometimes referred to as a tag name selector or element selector, because it selects an html tag/element in your document.
...And 19 more matches
nsISelectionPrivate
dom/base/nsiselectionprivate.idlscriptable internal support for content selection handling.
... method overview void addselectionlistener(in nsiselectionlistener newlistener); void endbatchchanges(); void getcachedframeoffset(in nsiframe aframe, in print32 inoffset, in nspointref apoint); native code only!
... nsienumerator getenumerator(); nsframeselection getframeselection(); native code only!
...And 18 more matches
Element.querySelectorAll() - Web APIs
the element method queryselectorall() returns a static (not live) nodelist representing a list of elements matching the specified group of selectors which are descendants of the element on which the method was called.
... note: this method is implemented based on the parentnode mixin's queryselectorall() method.
... syntax elementlist = parentnode.queryselectorall(selectors); parameters selectors a domstring containing one or more selectors to match against.
...And 18 more matches
selection - Archive of obsolete content
get and set text and html selections in the current web page.
... usage registering for selection notifications to be notified when the user makes a selection, register a listener for the "select" event.
... each listener will be called after a selection is made.
...And 16 more matches
Document.querySelectorAll() - Web APIs
the document method queryselectorall() returns a static (not live) nodelist representing a list of the document's elements that match the specified group of selectors.
... note: this method is implemented based on the parentnode mixin's queryselectorall() method.
... syntax elementlist = parentnode.queryselectorall(selectors); parameters selectors a domstring containing one or more selectors to match against.
...And 16 more matches
Selection API - Web APIs
the selection api provides functionality for reading and manipulating the range of text selected by the user.
... concepts and usage to retrieve the current text range the user has selected, you can use the window.getselection() or document.getselection() method, storing the return value — a selection object — in a variable for futher use.
... once your selection is in a variable, you perform a variety of operations on it, for example copying the selection to a text string using selection.tostring(), adding a range (as represented by a standard range object) to the selection (or removing one) with selection.addrange()/selection.removerange(), or changing the selection to be the entire contents of a dom node using selection.selectallchildren().
...And 16 more matches
Attribute selectors - Learn web development
in css you can use attribute selectors to target elements with certain attributes.
... this lesson will show you how to use these very useful selectors.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn what attribute selectors are and how to use them.
...And 15 more matches
ParentNode.querySelectorAll() - Web APIs
the parentnode mixin defines the queryselectorall() method as returning a nodelist representing a list of elements matching the specified group of selectors which are descendants of the object on which the method was called.
... if you need only a single result, consider the queryselector() method instead.
... note: this method is implemented as element.queryselectorall(), document.queryselectorall(), and documentfragment.queryselectorall() syntax elementlist = parentnode.queryselectorall(selectors); parameters selectors a domstring containing one or more selectors to match against.
...And 15 more matches
CSS selectors - CSS: Cascading Style Sheets
css selectors define the elements to which a set of css rules apply.
... note: there are no selectors or combinators to select parent items, siblings of parents, or children of parent siblings.
... basic selectors universal selector selects all elements.
...And 15 more matches
Focus and Selection - Archive of obsolete content
« previousnext » the section will describe how to handle the focus and selection of elements.
...typically, you will use focus and blur events to update parts of the interface as the user selects elements.
... text selection when working with a textbox, you may wish to retrieve not the entire contents of a field but only what the user has selected.
...And 13 more matches
HTMLInputElement.setSelectionRange() - Web APIs
the htmlinputelement.setselectionrange() method sets the start and end positions of the current text selection in an <input> or <textarea> element.
... optionally, in newer browser versions, you can specify the direction in which selection should be considered to have occurred.
... this lets you indicate, for example, that the selection was set by the user clicking and dragging from the end of the selected text toward the beginning.
...And 12 more matches
Document.querySelector() - Web APIs
the document method queryselector() returns the first element within the document that matches the specified selector, or group of selectors.
... syntax element = document.queryselector(selectors); parameters selectors a domstring containing one or more selectors to match.
... this string must be a valid css selector string; if it isn't, a syntax_err exception is thrown.
...And 11 more matches
ParentNode.querySelector() - Web APIs
the parentnode mixin defines the queryselector() method as returning an element representing the first element matching the specified group of selectors which are descendants of the object on which the method was called.
... if you need all the elements matching the selector list, use queryselectorall() instead.
... note: this method is implemented as document.queryselector(), documentfragment.queryselector() and element.queryselector().
...And 11 more matches
Element.querySelector() - Web APIs
the queryselector() method of the element interface returns the first element that is a descendant of the element on which it is invoked that matches the specified group of selectors.
... syntax element = baseelement.queryselector(selectors); parameters selectors a group of selectors to match the descendant elements of the element baseelement against; this must be valid css syntax, or a syntaxerror exception will occur.
... the first element found which matches this group of selectors is returned.
...And 10 more matches
Window.getSelection() - Web APIs
the window.getselection() method returns a selection object representing the range of text selected by the user or the current position of the caret.
... syntax selection = window.getselection(); return value a selection object.
... when cast to string, either by appending an empty string ("") or using selection.tostring(), this object returns the text selected.
...And 10 more matches
XForms Select1 Element - Archive of obsolete content
note, some representations of the select1 element do not support visual grouping.
... single-node binding special selection - this attribute, when set to 'open', allows the user to provide free entry to the list.
... incremental - supported, default value is true properties selection - see corresponding attribute incremental - see corresponding attribute type restrictions the select1 element can be bound to a node containing simple content.
...And 9 more matches
DocumentOrShadowRoot.getSelection() - Web APIs
the getselection() property of the documentorshadowroot interface returns a selection object representing the range of text selected by the user, or the current position of the caret.
... syntax var selection = documentorshadowrootinstance.getselection() parameters none.
... returns a selection object.
...And 9 more matches
Selection.setBaseAndExtent() - Web APIs
the setbaseandextent() method of the selection interface sets the selection to be a range including all or parts of two specified dom nodes, and any content located between them.
... syntax sel.setbaseandextent(anchornode,anchoroffset,focusnode,focusoffset) parameters anchornode the node at the start of the selection.
... anchoroffset the number of child nodes from the start of the anchor node that should be excluded from the selection.
...And 8 more matches
user-select - CSS: Cascading Style Sheets
the user-select css property controls whether the user can select text.
... /* keyword values */ user-select: none; user-select: auto; user-select: text; user-select: contain; user-select: all; /* global values */ user-select: inherit; user-select: initial; user-select: unset; /* mozilla-specific values */ -moz-user-select: none; -moz-user-select: text; -moz-user-select: all; /* webkit-specific values */ -webkit-user-select: none; -webkit-user-select: text; -webkit-user-select: all; /* doesn't work in safari; use only "none" or "text", or else it will allow typing in the <html> container */ /* microsoft-specific values */ -ms-user-select: none; -ms-user-select: text; -ms-user-select: element; note: user-select is not an inheri...
... syntax none the text of the element and its sub-elements is not selectable.
...And 8 more matches
Selection - Archive of obsolete content
jetpack's selection api provides a method for detecting the selections made by the user.
... features can get, set, and listen for selection events in html or plain text.
... the namespace for this api is jetpack.selection.
...And 7 more matches
Selection - Archive of obsolete content
jetpack's selection api provides a method for detecting the selections made by the user.
... features can get, set, and listen for selection events in html or plain text.
... the namespace for this api is jetpack.selection.
...And 7 more matches
Selection - Archive of obsolete content
ArchiveMozillaJetpackdocsUISelection
jetpack's selection api provides a method for detecting the selections made by the user.
... features can get, set, and listen for selection events in html or plain text.
... the namespace for this api is jetpack.selection.
...And 7 more matches
XForms Select Element - Archive of obsolete content
introduction allows the user to choose one or more selections from a list of pre-defined items (see the spec).
...note, some representations of the select element do not support visual grouping.
... single-node binding special selection - isn't currently supported.
...And 7 more matches
mozbrowserselectionstatechanged
the mozbrowserselectionstatechanged event is fired when the text selected inside the browser <iframe> content changes.
... details the details property returns an anonymous javascript object with the following properties: rect an object that represents the bounding rectangle of the selection.
... its properties are: width: the width of the selection, in css pixels.
...And 7 more matches
RTCIceTransport.getSelectedCandidatePair() - Web APIs
the rtcicetransport method getselectedcandidatepair() returns an rtcicecandidatepair object containing the current best-choice pair of ice candidates describing the configuration of the endpoints of the transport.
... syntax candidatepair = rtcicetransport.getselectedcandidatepair(); parameters none.
... return value a rtcicecandidatepair object describing the configurations of the currently-selected candidate pair's two endpoints.
...And 7 more matches
Selection.modify() - Web APIs
WebAPISelectionmodify
the selection.modify() method applies a change to the current selection or cursor position, using simple textual commands.
...specify "move" to move the current cursor position or "extend" to extend the current selection.
... direction the direction in which to adjust the current selection.
...And 7 more matches
Selection.rangeCount - Web APIs
the selection.rangecount read-only property returns the number of ranges in the selection.
...after the user clicks on the page, rangecount is 1, even if no selection is visible.
... a user can normally only select one range at a time, so the rangecount will usually be 1.
...And 7 more matches
nsISelection2
content/base/public/nsiselection2.idlscriptable please add a summary to this article.
... 1.0 66 introduced gecko 1.8 obsolete gecko 8.0 inherits from: nsiselection last changed in gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) in gecko 8.0 this interface was merged into the nsiselectionprivate interface.
... void scrollintoview(in short aregion, in boolean aissynchronous, in short avpercent, in short ahpercent); attributes attribute type description type short returns the type of the selection (see nsiselectioncontroller for available constants).
...And 6 more matches
Locating DOM elements using selectors - Web APIs
the selectors api provides methods that make it quick and easy to retrieve element nodes from the dom by matching against a set of selectors.
... the nodeselector interface this specification adds two new methods to any objects implementing the document, documentfragment, or element interfaces: queryselector() returns the first matching element node within the node's subtree.
... queryselectorall() returns a nodelist containing all matching element nodes within the node's subtree, or an empty nodelist if no matches are found.
...And 6 more matches
HTMLSelectElement.add() - Web APIs
the htmlselectelement.add() method adds an element to the collection of option elements for this select element.
... exceptions a domerror of the type hierarchyrequesterror if the item passed to the method is an ancestor of the htmlselectelement.
... examples creating elements from scratch var sel = document.createelement("select"); var opt1 = document.createelement("option"); var opt2 = document.createelement("option"); opt1.value = "1"; opt1.text = "option: value 1"; opt2.value = "2"; opt2.text = "option: value 2"; sel.add(opt1, null); sel.add(opt2, null); /* produces the following, conceptually: <select> <option value="1">option: value 1</option> <option value="2">option: value 2</option> </select> */ the before parameter is optional.
...And 6 more matches
Selection.type - Web APIs
WebAPISelectiontype
the type read-only property of the selection interface returns a domstring describing the type of the current selection.
... syntax value = sel.type value a domstring describing the type of the current selection.
... possible values are: none: no selection has currently been made.
...And 6 more matches
XRSession: selectend event - Web APIs
the webxr event selectend is sent to an xrsession when one of its input sources ends its primary action or when an input source that's in the process of handling an ongoing primary action is disconnected without successfully completing the action.
... bubbles yes cancelable no interface xrinputsourceevent event handler property onselectend for details on how the selectstart, select, and selectend events work, and how you should react to them, see primary actions in inputs and input sources.
... examples the following example uses addeventlistener() to establish handlers for the selection events: selectstart, selectend, and select.
...And 6 more matches
XRSession: selectstart event - Web APIs
the webxr event selectstart is sent to an xrsession when the user begins a primary action on one of its input sources.
... bubbles yes cancelable no interface xrinputsourceevent event handler property onselectstart for details on how the selectstart, select, and selectend events work, and how you should react to them, see primary actions in inputs and input sources.
... examples the following example uses addeventlistener() to establish handlers for the selection events: selectstart, selectend, and select.
...And 6 more matches
::selection - CSS: Cascading Style Sheets
the ::selection css pseudo-element applies styles to the part of a document that has been highlighted by the user (such as clicking and dragging the mouse across text).
... ::selection { background-color: cyan; } allowable properties only certain css properties can be used with ::selection: color background-color cursor caret-color outline and its longhands text-decoration and its associated properties text-emphasis-color text-shadow in particular, background-image is ignored.
... syntax /* legacy firefox syntax (version 61 and below) */ ::-moz-selection ::selection examples html this text has special styles when you highlight it.
...And 6 more matches
Test your skills: Selectors - Learn web development
the aim of this task is to help you check your understanding of selectors in css.
... selectors one without changing the html, use css to do the following things: make h1 headings blue.
... selectors two without changing the html, make the following changes to the look of the content in this example: give the element with an id of special a yellow background.
...And 5 more matches
DocumentFragment.querySelector() - Web APIs
the documentfragment.queryselector() method returns the first element, or null if no matches are found, within the documentfragment (using depth-first pre-order traversal of the document's nodes) that matches the specified group of selectors.
... if the selector matches an id and this id is erroneously used several times in the document, it returns the first matching element.
... if the selectors specified in parameter are invalid a domexception with a syntax_err value is raised.
...And 5 more matches
RTCIceCandidatePairStats.selected - Web APIs
the non-standard, firefox-specific rtcicecandidatepairstats property selected indicates whether or not the candidate pair described by the object is the one currently being used to communicate with the remote peer.
... syntax isselected = icpstats.selected; value a firefox-specific boolean value which is true if the candidate pair described by this object is the one currently in use.
... in any other browser, you can determine the selected candidate pair by looking for a stats object of type transport, which is an rtctransportstats object.
...And 5 more matches
Range.selectNodeContents() - Web APIs
the range.selectnodecontents() method sets the range to contain the contents of a node.
... syntax range.selectnodecontents(referencenode); parameters referencenode the node whose contents will be selected within a range.
... example range = document.createrange(); referencenode = document.getelementsbytagname("div")[0]; range.selectnodecontents(referencenode); live sample this example lets the user select and deselect a paragraph with buttons.
...And 5 more matches
Selection.containsNode() - Web APIs
the selection.containsnode() method indicates whether a specfied node is part of the selection.
... syntax sel.containsnode(node, partialcontainment) parameters node the node that is being looked for in the selection.
... partialcontainment optional when true, containsnode() returns true when a part of the node is part of the selection.
...And 5 more matches
Selector list - CSS: Cascading Style Sheets
the css selector list (,) selects all the matching nodes.
... /* selects all matching elements */ span, div { border: red 2px solid; } to reduce the size of style sheets, one can group selectors in comma-separated lists.
... syntax element, element, element { style properties } examples single line grouping grouping selectors in a single line using a comma-separated lists.
...And 5 more matches
-ms-touch-select - Archive of obsolete content
the -ms-touch-select css property is a microsoft extension that toggles the gripper visual elements that enable touch text selection.
...in addition, selection will start even if an onclick, onmsgesturetap, or onmouseup handler is present.
... none the grippers are always off and default touch selection functionality is not provided.
...And 4 more matches
Select an element - Firefox Developer Tools
the selected element is the element in the page that the inspector is currently focused on.
... the selected element is shown in the html pane and its css is displayed in the css pane.
... the highlighted element is the element that's overlaid in the page with a graphic showing the box model, and a tooltip showing its tag and size: with the context menu to open the inspector and select an element immediately, activate the context menu over the element in the page and select "inspect element": with the html pane when the inspector is open, as you move the mouse around the elements listed in the html pane, the corresponding elements are highlighted in the page.
...And 4 more matches
HTMLSelectElement.type - Web APIs
the htmlselectelement.type read-only property returns the form control's type.
... syntax var str = selectelt.type; the possible values are: "select-multiple" if multiple values can be selected.
... "select-one" if only one value can be selected.
...And 4 more matches
Selection.toString() - Web APIs
the selection.tostring() method returns a string currently being represented by the selection object, i.e.
... the currently selected text.
... syntax sel.tostring() return value a string representing the selection.
...And 4 more matches
QuerySelector - Archive of obsolete content
along the lines of other frameworks such as jquery or prototype, shortening the "queryselector" name can be convenient: function $ (selector, el) { if (!el) {el = document;} return el.queryselector(selector); } function $$ (selector, el) { if (!el) {el = document;} return el.queryselectorall(selector); // note: the returned object is a nodelist.
... // if you'd like to convert it to a array for convenience, use this instead: // return array.prototype.slice.call(el.queryselectorall(selector)); } alert($('#myid').id); (note that while using the firefox web console, the above functions are available automatically.) both xul and even xml can be easily made supportable (an alternative approach to the following would be to add chromewindow.prototype or window.prototype, accessing this.document.queryselector, or following the jquery style of chaining by returning 'this' within each prototype method of $()): htmldocument.prototype.$ = function (selector) { // only for html return this.queryselector(selector); }; example: <h1>test!</h1> <script> htmldocument.prototype.$ = function (selector) { return this.queryselector(selector...
...); }; alert(document.$('h1')); // [object htmlheadingelement] </script> xuldocument.prototype.$ = function (selector) { // only for xul return this.queryselector(selector); }; example: <label value="test!"/> <script type="text/javascript"><![cdata[ xuldocument.prototype.$ = function (selector) { // only for xul return this.queryselector(selector); }; alert(document.$('label')); // [object xulelement] ]]></script> document.prototype.$ = function (selector) { // only for plain xml return this.queryselector(selector); }; var foo = document.implementation.createdocument('somens', 'foo', null); // create an xml document <foo xmlns="somens"/> var bar = foo.createelementns('somens', 'bar'); // add <bar xmlns="somens"/> foo.documentelement.appendchild(bar); alert(foo.$('bar').nodename);...
...And 3 more matches
nsISelection3
content/base/public/nsiselection3.idlscriptable please add a summary to this article.
... 1.0 66 introduced gecko 2.0 obsolete gecko 8.0 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) in gecko 8.0 this interface was merged into the nsiselection interface.
... method overview void modify(in domstring alter, in domstring direction, in domstring granularity); methods modify() modifies the selection.
...And 3 more matches
Select and highlight elements - Firefox Developer Tools
the selected element is the element in the page that the inspector is currently focused on.
... the selected element is shown in the html pane and its css is displayed in the css pane.
... the highlighted element is the element that's overlaid in the page with a graphic showing the box model, and a tooltip showing its tag and size: with the context menu to open the inspector and select an element immediately, activate the context menu over the element in the page and select "inspect element": with the html pane when the inspector is open, as you move the mouse around the elements listed in the html pane, the corresponding elements are highlighted in the page.
...And 3 more matches
HTMLSelectElement.remove() - Web APIs
the htmlselectelement.remove() method removes the element at the specified index from the options collection for this select element.
... example var sel = document.getelementbyid("existinglist"); sel.remove(1); /* takes the existing following select object: <select id="existinglist" name="existinglist"> <option value="1">option: value 1</option> <option value="2">option: value 2</option> <option value="3">option: value 3</option> </select> and changes it to: <select id="existinglist" name="existinglist"> <option value="1">option: value 1</option> <option value="3">option: value 3</option> </select> */ specifications specification status comment html living standardthe definit...
...ion of 'htmlselectelement.remove()' in that specification.
...And 3 more matches
Selection.focusNode - Web APIs
the selection.focusnode read-only property returns the node in which the selection ends.
... a user may make a selection from left to right (in document order) or right to left (reverse of document order).
... the focus is where the user ended the selection.
...And 3 more matches
XRSession: select event - Web APIs
the webxr event select is sent to an xrsession when one of the session's input sources has completed a primary action.
... bubbles yes cancelable no interface xrinputsourceevent event handler property onselect for details on how the selectstart, select, and selectend events work, and how you should react to them, see primary actions in inputs and input sources.
... examples the following example uses addeventlistener() to set up a handler for the select event.
...And 3 more matches
Attribute selectors - CSS: Cascading Style Sheets
the css attribute selector matches elements based on the presence or value of a given attribute.
...g="en-us en-gb en-au en-nz">hello world!</div> <div lang="pt">olá mundo!</div> <div lang="zh-cn">世界您好!</div> <div lang="zh-tw">世界您好!</div> <div data-lang="zh-tw">世界您好!</div> result html ordered lists the html specification requires the type attribute to be matched case-insensitively due to it primarily being used in the <input> element, trying to use attribute selectors to with the type attribute of an ordered list doesn't work without the case-sensitive modifier.
...*/ ol[type="a"] { list-style-type: lower-alpha; background: red; } ol[type="a" s] { list-style-type: lower-alpha; background: lime; } ol[type="a" s] { list-style-type: upper-alpha; background: lime; } html <ol type="a"> <li>example list</li> </ol> result specifications specification status comment selectors level 4the definition of 'attribute selectors' in that specification.
...And 3 more matches
Class selectors - CSS: Cascading Style Sheets
the css class selector matches elements based on the contents of their class attribute.
...ss="spacious" */ .spacious { margin: 2em; } /* all <li> elements with class="spacious" */ li.spacious { margin: 2em; } /* all <li> elements with a class list that includes both "spacious" and "elegant" */ /* for example, class="elegant retro spacious" */ li.spacious.elegant { margin: 2em; } syntax .class_name { style properties } note that this is equivalent to the following attribute selector: [class~=class_name] { style properties } examples css .red { color: #f33; } .yellow-bg { background: #ffa; } .fancy { font-weight: bold; text-shadow: 4px 4px 3px #77f; } html <p class="red">this paragraph has red text.</p> <p class="red yellow-bg">this paragraph has red text and a yellow background.</p> <p class="red fancy">this paragraph has red text and "fancy" styling.</p> ...
...<p>this is just a regular paragraph.</p> result specifications specification status comment selectors level 4the definition of 'class selectors' in that specification.
...And 3 more matches
ID selectors - CSS: Cascading Style Sheets
the css id selector matches an element based on the value of the element’s id attribute.
... in order for the element to be selected, its id attribute must match exactly the value given in the selector.
... /* the element with id="demo" */ #demo { border: red 2px solid; } syntax #id_value { style properties } note that syntactically (but not specificity-wise), this is equivalent to the following attribute selector: [id=id_value] { style properties } examples css #identified { background-color: skyblue; } html <div id="identified">this div has a special id on it!</div> <div>this is just a regular div.</div> result specifications specification status comment selectors level 4the definition of 'id selectors' in that specification.
...And 3 more matches
Type selectors - CSS: Cascading Style Sheets
the css type selector matches elements by node name.
... in other words, it selects all elements of the given type within a document.
...*/ a { color: red; } syntax element { style properties } examples css span { background-color: skyblue; } html <span>here's a span with some text.</span> <p>here's a p with some text.</p> <span>here's a span with more text.</span> result specifications specification status comment selectors level 4the definition of 'type (tag name) selector' in that specification.
...And 3 more matches
visuallyselected - Archive of obsolete content
« xul reference home visuallyselected type: boolean new in firefox 40.
... indicates that a tab is selected.
... the visuallyselected attribute is set asynchronously, once the browser has switched to the selected tab.
...And 2 more matches
selectedItem - Archive of obsolete content
« xul reference selecteditem type: element holds the currently selected item.
... if no item is currently selected, this value will be null.
... you can select an item by setting this value.
...And 2 more matches
CSSStyleRule.selectorText - Web APIs
the cssrule.selectortext property gets the textual representation of the selector for the rule set.
... syntax string = cssrule.selectortext example // for cssrule: body { background-color: darkblue; } var stylesheet = document.stylesheets[0]; alert(stylesheet.cssrules[0].selectortext); // body notes the implementation may have stripped out insignificant whitespace while parsing the selector.
... if set to a selector string which cannot be parsed, a syntaxerror is thrown.
...And 2 more matches
GlobalEventHandlers.onselect - Web APIs
the onselect property of the globaleventhandlers mixin is an eventhandler that processes select events.
... the select event only fires after text inside an <input type="text"> or <textarea> is selected.
... syntax target.onselect = functionref; value functionref is a function name or a function expression.
...And 2 more matches
GlobalEventHandlers.onselectionchange - Web APIs
the onselectionchange property of the globaleventhandlers mixin is an eventhandler that processes selectionchange events.
... the selectionchange event fires when the text selected on a webpage changes.
... syntax object.onselectionchange = functionref; value functionref is a function name or a function expression.
...And 2 more matches
GlobalEventHandlers.onselectstart - Web APIs
the onselectstart property of the globaleventhandlers mixin is an eventhandler that processes selectstart events.
... the selectstart event fires when the user starts to make a new text selection on a webpage.
... syntax object.onselectstart = functionref; value functionref is a function name or a function expression.
...And 2 more matches
HTMLSelectElement.form - Web APIs
the htmlselectelement.form read-only property returns a htmlformelement representing the form that this element is associated with.
... syntax edit aform = aselectelement.form.selectname; example html <form action="http://www.google.com/search" method="get"> <label>google: <input type="search" name="q"></label> <input type="submit" value="search..."> </form> javascript a property available on all form elements, "type" returns the type of the calling form element.
... for select, the two possible values are "select-one" or "select-multiple", depending on the type of selection list.
...And 2 more matches
RTCIceTransport.onselectedcandidatepairchange - Web APIs
the rtcicetransport interface's onselectedcandidatepairchange event handler specifies a function to be called to handle the selectedcandidatepairchange event, which is fired when the ice agent selects a new candidate pair to be used for the connection.
... syntax rtcicetransport.onselectedcandidatepairchange = candidatepairhandler; value this propoerty should be set to reference an event handler function to be called by the ice agent when it discovers a new candidate pair that the rtcicetransport will be using for communication with the remote peer.
... the event handler can determine the current state by calling the transport's getselectedcandidatepair() method, which returns a rtcicecandidatepair whose rtcicecandidatepair.local and rtcicecandidatepair.global properties specify rtcicecandidate objects describing the local and remote candidates that are currently being used.
...And 2 more matches
Selection.anchorNode - Web APIs
the selection.anchornode read-only property returns the node in which the selection begins.
... a user may make a selection from left to right (in document order) or right to left (reverse of document order).
... the anchor is where the user began the selection.
...And 2 more matches
Selection.collapse() - Web APIs
the selection.collapse() method collapses the current selection to a single point.
...this value can also be set to null — if null is specified, the method will behave like selection.removeallranges(), i.e.
... all ranges will be removed from the selection.
...And 2 more matches
Selection.extend() - Web APIs
WebAPISelectionextend
the selection.extend() method moves the focus of the selection to a specified point.
... the anchor of the selection does not move.
... the selection will be from the anchor to the new focus, regardless of direction.
...And 2 more matches
Selection.isCollapsed - Web APIs
the selection.iscollapsed read-only property returns a boolean which indicates whether or not there is currently any text selected.
... no text is selected when the selection's start and end points are at the same position in the content.
... keep in mind that a collapsed selection may still have one (or more, in gecko) ranges, so selection.rangecount may not be zero.
...And 2 more matches
Selection.removeRange() - Web APIs
the selection.removerange() method removes a range from a selection.
... syntax sel.removerange(range) parameters range a range object that will be removed to the selection.
... return value undefined examples /* programmaticaly, more than one range can be selected.
...And 2 more matches
XRSession.onselect - Web APIs
the onselect property of the xrsession object is the event handler for the select event, which is dispatched when a primary action is completed successfully by the user.
... the select event is sent after tracking of the primary action begins, as announced by the selectstart event, and immediately before the tracking of the primary action ends, which is announced by the selectend event.
... syntax xrsession.onselect = selecthandlerfunction; value an event handler function to be invoked when the xrsession receives a select event.
...And 2 more matches
Universal selectors - CSS: Cascading Style Sheets
the css universal selector (*) matches elements of any type.
... /* selects all elements */ * { color: green; } beginning with css3, the asterisk may be used in combination with namespaces: ns|* - matches all elements in namespace ns *|* - matches all elements |* - matches all elements without any declared namespace syntax * { style properties } the asterisk is optional with simple selectors.
...</p> result specifications specification status comment selectors level 4the definition of 'universal selector' in that specification.
...And 2 more matches
tree.onselect - Archive of obsolete content
« xul reference home onselect type: script code this event is sent to a tree when a row is selected, or whenever the selection changes.
... the user can select multiple rows by holding down shift or control and clicking on a row.
... the onselect event will be sent for each item added to or removed from the selection.
... see the tree selection page on the tutorial for more information.
selectItemRange - Archive of obsolete content
« xul reference home selectitemrange( startitem, enditem ) return type: no return value selects the items between the two items given as arguments, including the start and end items.
... all other items are deselected.
... this method does nothing for single-selection list boxes.
... a select event is sent after the selection is made.
selectedIndex - Archive of obsolete content
« xul reference selectedindex type: integer returns the index of the currently selected item.
... you may select an item by assigning its index to this property.
... by assigning -1 to this property, all items will be deselected.
... returns -1 if no items are selected ...
selectionEnd - Archive of obsolete content
« xul reference selectionend type: integer get or set the end of the selected portion of the field's text.
... use in conjuction with the selectionstart property.
... the value specifies the index of the character after the selection.
... if this value is equal to the value of the selectionstart property, no text is selected, but the value indicates the position of the caret (cursor) within the textbox.
DocumentFragment.querySelectorAll() - Web APIs
the documentfragment.queryselectorall() method returns a nodelist of elements within the documentfragment (using depth-first pre-order traversal of the document's nodes) that matches the specified group of selectors.
... if the selectors specified in parameter are invalid a domexception with a syntax_err value is raised.
... syntax elementlist = documentfragment.queryselectorall(selectors); parameters selectors is a domstring containing one or more css selectors separated by commas.
... examples this example returns a list of all div elements within the documentfragment with a class of either "note" or "alert": var matches = documentfrag.queryselectorall("div.note, div.alert"); specifications specification status comment selectors api level 1the definition of 'documentfragment.queryselectorall' in that specification.
Element: select event - Web APIs
the select event fires when some text has been selected.
... bubbles yes cancelable no interface uievent if generated from a user interface, event otherwise event handler property onselect the event is not available for all elements in all languages.
... for example, in html, select events can be dispatched only on form <input type="text"> and <textarea> elements.
... examples selection logger <input value="try selecting some text in this element."> <p id="log"></p> function logselection(event) { const log = document.getelementbyid('log'); const selection = event.target.value.substring(event.target.selectionstart, event.target.selectionend); log.textcontent = `you selected: ${selection}`; } const input = document.queryselector('input'); input.addeventlistener('select', logselection); onselect equivalent you can also set up the event handler using the onselect property: input.onselect = logselection; specifications specification status ui eventsthe definition of 'select' in that specification.
HTMLInputElement.select() - Web APIs
the htmlinputelement.select() method selects all the text in a <textarea> element or in an <input> element that includes a text field.
... syntax element.select(); example click the button in this example to select all the text in the <input> element.
... html <input type="text" id="text-box" size="20" value="hello world!"> <button onclick="selecttext()">select text</button> javascript function selecttext() { const input = document.getelementbyid('text-box'); input.focus(); input.select(); } result notes calling element.select() will not necessarily focus the input, so it is often used with htmlelement.focus().
... in browsers where it is not supported, it is possible to replace it with a call to htmlinputelement.setselectionrange() with parameters 0 and the input's value length: <input onclick="this.select();" value="sample text" /> <!-- equivalent to --> <input onclick="this.setselectionrange(0, this.value.length);" value="sample text" /> specifications specification status comment html living standardthe definition of 'select' in that specification.
HTMLSelectElement.disabled - Web APIs
the htmlselectelement.disabled is a boolean that reflects the disabled html attribute, which indicates whether the control is disabled.
... syntax edit aselectelement.disabled = abool; example html <label> allow drinks?
... <input id="allow-drinks" type="checkbox"/> </label> <label for="drink-select">drink selection:</label> <select id="drink-select" disabled> <option value="1">water</option> <option value="2">beer</option> <option value="3">pepsi</option> <option value="4">whisky</option> </select> javascript var allowdrinkscheckbox = document.getelementbyid("allow-drinks"); var drinkselect = document.getelementbyid("drink-select"); allowdrinkscheckbox.addeventlistener("change", function(event) { if (event.target.checked) { drinkselect.disabled = false; } else { drinkselect.disabled = true; } }, false); result specifications specification status comment html living standardthe definition of 'disabled' in that specification.
... living standard html5the definition of 'htmlselectelement' in that specification.
HTMLSelectElement.item() - Web APIs
the htmlselectelement.item() method returns the element corresponding to the htmloptionelement whose position in the options list corresponds to the index given in the parameter, or null if there are none.
... in javascript, using the array bracket syntax with an unsigned long, like selectelt[index] is equivalent to selectelt.nameditem(index).
... examples html <form> <select id="myformcontrol" type="textarea"> <option id="o1">opt 1</option> <option id="o2">opt 2</option> </select> </form> javascript // returns the htmloptionelement representing #o2 elem1 = document.forms[0]['myformcontrol'][1]; specifications specification status comment html living standardthe definition of 'htmlselectelement.item()' in that specification.
... html5the definition of 'htmlselectelement.item()' in that specification.
HTMLSelectElement.namedItem() - Web APIs
the htmlselectelement.nameditem() method returns the htmloptionelement corresponding to the htmloptionelement whose name or id match the specified name, or null if no option matches.
... in javascript, using the array bracket syntax with a string, like selectelt["value"] is equivalent to selectelt.nameditem("value").
... example html <form> <select id="myformcontrol"> <option id="o1">opt 1</option> <option id="o2">opt 2</option> </select> </form> javascript elem1 = document.forms[0]['myformcontrol']['o1']; // returns the htmloptionelement representing #o1 specifications specification status comment html living standardthe definition of 'htmlselectelement.nameditem()' in that specification.
... html5the definition of 'htmlselectelement.nameditem()' in that specification.
HTMLSelectElement.setCustomValidity() - Web APIs
the htmlselectelement.setcustomvalidity() method sets the custom validity message for the selection element to the specified message.
... syntax selectelt.setcustomvalidity(string); parameters string is the domstring containing the error message.
... specifications specification status comment html living standardthe definition of 'htmlselectelement.setcustomvalidity()' in that specification.
... html5the definition of 'htmlselectelement.setcustomvalidity()' in that specification.
PublicKeyCredentialCreationOptions.authenticatorSelection - Web APIs
authenticatorselection, an optional property of the publickeycredentialcreationoptions dictionary, is an object giving criteria to filter out the authenticators to be used for the creation operation.
... syntax authenticatorselection = publickeycredentialcreationoptions.authenticatorselection value an object with the following properties: authenticatorattachmentoptional a string which is either "platform" or "cross-platform".
... examples var publickey = { authenticatorselection:{ authenticatorattachment: "cross-platform", requireresidentkey: true, userverification: "required" }, challenge: new uint8array(26) /* this actually is given from the server */, rp: { name: "example corp", id : "login.example.com" }, user: { id: new uint8array(26), /* to be changed for each user */ name: "jdoe@example.com", displayname: "john doe", ...
...unction (newcredentialinfo) { // send attestation response and client extensions // to the server to proceed with the registration // of the credential }).catch(function (err) { console.error(err); }); specifications specification status comment web authentication: an api for accessing public key credentials level 1the definition of 'authenticatorselection' in that specification.
RTCIceTransport: selectedcandidatepairchange event - Web APIs
a selectedcandidatepairchange event is sent to an rtcicetransport when the ice agent selects a new pair of candidates that describe the endpoints of a viable connection.
... bubbles no cancelable no interface event event handler property onselectedcandidatepairchange examples this example creates an event handler for selectedcandidatepairchange that updates a display providing the user information about the progress of the ice negotiation for an rtcpeerconnection called pc.
... let icetransport = pc.getsenders[0].transport.icetransport; let localprotoelem = document.getelementbyid("local-protocol"); let remoteprotoelem = document.getelementbyid("remote-protocol"); icetransport.addeventlistener("selectedcandidatepairchange", ev => { let pair = icetransport.getselectedcandidatepair(); localprotoelem.innertext = pair.local.protocol.touppercase(); remoteprotoelem.innertext = pair.remote.protocol.touppercase(); }, false) this can also be done by setting the onselectedcandidatepairchange event handler property directly.
... let icetransport = pc.getsenders[0].transport.icetransport; let localprotoelem = document.getelementbyid("local-protocol"); let remoteprotoelem = document.getelementbyid("remote-protocol"); icetransport.onselectedcandidatepairchange = ev => { let pair = icetransport.getselectedcandidatepair(); localprotoelem.innertext = pair.local.protocol.touppercase(); remoteprotoelem.innertext = pair.remote.protocol.touppercase(); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'selectedcandidatepairchange' in that specification.
Range.selectNode() - Web APIs
WebAPIRangeselectNode
the range.selectnode() method sets the range to contain the node and its contents.
... syntax range.selectnode(referencenode); parameters referencenode the node to select within a range.
... example let range = document.createrange(); let referencenode = document.getelementsbytagname('div').item(0); range.selectnode(referencenode); specifications specification status comment domthe definition of 'range.selectnode()' in that specification.
... document object model (dom) level 2 traversal and range specificationthe definition of 'range.selectnode()' in that specification.
Selection.addRange() - Web APIs
the selection.addrange() method adds a range to a selection.
... syntax selection.addrange(range); parameters range a range object that will be added to the selection.
... example currently only firefox supports multiple selection ranges, other browsers will not add new ranges to the selection if it already contains one.
... html <p>i <strong>insist</strong> that you <strong>try</strong> selecting the <strong>strong words</strong>.</p> <button>select strong words</button> javascript let button = document.queryselector('button'); button.addeventlistener('click', function () { let selection = window.getselection(); let strongs = document.getelementsbytagname('strong'); if (selection.rangecount > 0) { selection.removeallranges(); } for (let i = 0; i < strongs.length; i++) { let range = document.createrange(); range.selectnode(strongs[i]); selection.addrange(range); } }); result specifications specification status comment selection apithe definition of 'selection.addrange()' in that specification.
Selection.deleteFromDocument() - Web APIs
the deletefromdocument() method of the selection interface deletes the selected text from the document's dom.
... example this example lets you delete selected text by clicking a button.
... upon clicking the button, the window.getselection() method gets the selected text, and the deletefromdocument() method removes it.
...once you do, you can remove the selected content by clicking the button below.</p> <button>delete selected text</button> javascript let button = document.queryselector('button'); button.addeventlistener('click', deleteselection); function deleteselection() { let selection = window.getselection(); selection.deletefromdocument(); } result specifications specification status comment selection apithe definition of 'selection.deletefromdocument()' in that specification.
USBDevice.selectAlternateInterface() - Web APIs
the selectalternateinterface() method of the usbdevice interface returns a promise that resolves when the specified alternative endpoint is selected.
... syntax var promise = usbdevice.selectalternateinterface(interfacenumber, alternatesetting) parameters interfacenumber the index of one of the interfaces supported by the device.
... alternatesetting the configuration of the selected interface.
... specifications specification status comment webusbthe definition of 'selectalternateinterface()' in that specification.
XRSession.onselectend - Web APIs
the onselectend attribute of the xrsession object is the event handler for the selectend event, which is dispatched when user finishes making some sort of selection by releasing a trigger, touchpad, or button, finishes speaking a command, or makes a hand gesture.
... note: not to be confused with xrsession.onselectstart and xrsession.onselect.
... syntax xrsession.onselectend = function(event) { ...
... } example xrsession.onselectend = function(event) { console.log("the user has completed a primary action.") } specifications specification status comment webxr device apithe definition of 'xrsession.onselectend' in that specification.
XRSession.onselectstart - Web APIs
the onselectstart attribute of the xrsession object is the event handler for the selectstart event, which is dispatched when user starts making some sort of selection by pressing a trigger, touchpad, or button, speaking a command, or making a hand gesture.
... note: not to be confused with xrsession.onselect and xrsession.onselectend.
... syntax xrsession.onselectstart = function(event) { ...
... } example xrsession.onselectstart = function(event) { console.log("the user has started a primary action, but might not have completed it.") } specifications specification status comment webxr device apithe definition of 'xrsession.onselectstart' in that specification.
Privacy and the :visited selector - CSS: Cascading Style Sheets
before about 2010, the css :visited selector allowed websites to uncover a user's browsing history and figure out what sites the user had visited.
... little white lies to preserve users' privacy, firefox and other browsers will lie to web applications under certain circumstances: the window.getcomputedstyle method, and similar functions such as element.queryselector, will always return values indicating that a user has never visited any of the links on a page.
... if you use a sibling selector such as :visited + span, the adjacent element (span in this example) will be styled as if the link were unvisited.
... colors that are otherwise transparent will fail to appear if styled in a :visited selector.
Intl.PluralRules.select() - JavaScript
the intl.pluralrules.prototype.select method returns a string indicating which plural rule to use for locale-aware formatting.
... syntax pluralcategory = pluralrule.select(number) parameters number the number to get a plural rule for.
... description this function selects a pluralization category according to the locale and formatting options of a pluralrules object.
... examples using select() new intl.pluralrules('ar-eg').select(0); // → 'zero' new intl.pluralrules('ar-eg').select(1); // → 'one' new intl.pluralrules('ar-eg').select(2); // → 'two' new intl.pluralrules('ar-eg').select(6); // → 'few' new intl.pluralrules('ar-eg').select(18); // → 'many' specifications specification ecmascript internationalization api (ecma-402)the definition of 'intl.pluralrules.select()' in that specification.
xChannelSelector - SVG: Scalable Vector Graphics
the xchannelselector attribute indicates which color channel from in2 to use to displace the pixels in in along the x-axis.
...is using this attribute: <fedisplacementmap> html, body, svg { height: 100%; } <svg viewbox="0 0 440 160" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" xchannelselector="r"/> </filter> <filter id="displacementfilter2"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" xchannelselector="b"/> </filter> <text x="10" y="60" font-size="50" filter="url(#displacementfilter)">some displaced text</t...
... specifications specification status comment filter effects module level 1the definition of 'xchannelselector' in that specification.
... working draft no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'xchannelselector' in that specification.
yChannelSelector - SVG: Scalable Vector Graphics
the ychannelselector attribute indicates which color channel from in2 to use to displace the pixels in in along the y-axis.
...is using this attribute: <fedisplacementmap> html, body, svg { height: 100%; } <svg viewbox="0 0 440 160" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" ychannelselector="r"/> </filter> <filter id="displacementfilter2"> <feimage xlink:href="https://mdn.mozillademos.org/files/12668/mdn.svg" x="0" y="0" width="100%" height="100%" result="abc"/> <fedisplacementmap in2="abc" in="sourcegraphic" scale="30" ychannelselector="b"/> </filter> <text x="10" y="60" font-size="50" filter="url(#displacementfilter)">some displaced text</t...
... specifications specification status comment filter effects module level 1the definition of 'ychannelselector' in that specification.
... working draft no change scalable vector graphics (svg) 1.1 (second edition)the definition of 'ychannelselector' in that specification.
disableautoselect - Archive of obsolete content
« xul reference home disableautoselect type: boolean if this attribute is true or omitted, the selected item on the menu will update to match what the user entered in the textbox.
... if the text does not match any of the items in the list, the menu selection is cleared.
... if this attribute is false, the selection is never updated to match the text box.
prefpane.selected - Archive of obsolete content
« xul reference home selected type: boolean this attribute will be set to true for the currently selected prefpane.
... to change the selected pane, use the prefwindow's showpane method.
... see also selected ...
selected - Archive of obsolete content
« xul reference home selected type: boolean indicates whether the element is selected or not.
...to change the selection, set either the selectedindex or selecteditem property of the containing element.
... see also visuallyselected ...
getSelectedItem - Archive of obsolete content
« xul reference home getselecteditem( index ) return type: element when multiple items are selected, you can retrieve each selected item using this method.
... the argument index specifies the index in the list of the selected items, not the row number of the item.
... the item index is zero-based, thus this example will return the first selected item: getselecteditem(0).
toggleItemSelection - Archive of obsolete content
« xul reference home toggleitemselection( item ) return type: no return value if the specified item is selected, it is deselected.
... if it is not selected, it is selected.
... other items in the list box that are selected are not affected, and retain their selected state.
selectedPanel - Archive of obsolete content
« xul reference selectedpanel type: element holds a reference to the currently selected panel within a <tabbox> element.
... assigning a value to this property will modify the selected panel.
... a select event will be sent when the selected panel is changed.
selectionStart - Archive of obsolete content
« xul reference selectionstart type: integer get or set the beginning of the selected portion of the field's text.
... use in conjuction with the selectionend property.
... the value specifies the index of the first selected character.
ExtendSelection
« nsiaccessible page summary this method extends the current selection from its current accessible anchor node to this accessible.
... void extendselection(); exceptions thrown ns_error_not_implemented always.
... see also nsiaccessible.setselected() nsiaccessible.takeselection() ...
SetSelected
« nsiaccessible page summary this method adds or remove this accessible to the current selection.
... void setselected( in boolean aisselected ); parameters aisselected[out] the current selection exceptions thrown ns_error_failure indicates that the accessible is unattached from the accessible tree.
... see also nsiaccessible.takeselection() nsiaccessible.extendselection() ...
TakeSelection
« nsiaccessible page summary this method selects this accessible node only.
... void takeselection(); exceptions thrown ns_error_failure indicates that the accessible is unattached from the accessible tree.
... see also nsiaccessible.setselected() nsiaccessible.extendselection() ...
nsIDOMXULSelectControlElement
dom/interfaces/xul/nsidomxulselectcntrlel.idlscriptable please add a summary to this article.
... inherits from: nsidomxulcontrolelement last changed in gecko 1.9 (firefox 3) method overview nsidomxulselectcontrolitemelement appenditem(in domstring label, in domstring value); long getindexofitem(in nsidomxulselectcontrolitemelement item); nsidomxulselectcontrolitemelement getitematindex(in long index); nsidomxulselectcontrolitemelement insertitemat(in long index, in domstring label, in domstring value); nsidomxulselectcontrolitemelement removeitemat(in long index); attributes attribute type description itemcount unsigned long read only.
... selectedindex long selecteditem nsidomxulselectcontrolitemelement value domstring methods appenditem() nsidomxulselectcontrolitemelement appenditem( in domstring label, in domstring value ); parameters label value return value getindexofitem() long getindexofitem( in nsidomxulselectcontrolitemelement item ); parameters item return value getitematindex() nsidomxulselectcontrolitemelement getitematindex( in long index ); parameters index return value insertitemat() nsidomxulselectcontrolitemelement insertitemat( in long index, in domstring label, in domstring value ); parameters index label value return value removeitemat() nsidomxulselectcontrolitemelement removeitemat( in long index ); parameters index return value ...
nsIDOMXULSelectControlItemElement
dom/interfaces/xul/nsidomxulselectcntrlitemel.idlscriptable please add a summary to this article.
... inherits from: nsidomxulelement last changed in gecko 1.7 attributes attribute type description accesskey domstring command domstring control nsidomxulselectcontrolelement read only.
... crop domstring disabled boolean image domstring label domstring selected boolean read only.
nsISelectionImageService
layout/base/nsiselectionimageservice.idlnot scriptable please add a summary to this article.
... inherits from: nsisupports last changed in gecko 1.7 method overview void getimage(in short selectionvalue, out imgicontainer container); void reset(); methods getimage() retrieve the image for alpha blending.
... void getimage( in short selectionvalue, out imgicontainer container ); parameters selectionvalue container reset() the current image is marked as invalid.
Document.selectedStyleSheetSet - Web APIs
the selectedstylesheetset property indicates the name of the style sheet set that's currently in use.
... syntax currentstylesheetset = document.selectedstylesheetset; document.selectedstylesheet = newstylesheetset; on return, currentstylesheetset indicates the name of the style sheet set currently in use.
... example console.log('current style sheet set: ' + document.selectedstylesheetset); document.selectedstylesheetset = 'some other style sheet'; ...
Document: selectstart event - Web APIs
the selectstart event of the selection api is fired when a user starts a new selection.
... if the event is canceled, the selection is not changed.
... bubbles yes cancelable yes interface event event handler property onselectstart examples // addeventlistener version document.addeventlistener('selectstart', () => { console.log('selection started'); }); // onselectstart version document.onselectstart = () => { console.log('selection changed.'); }; specifications specification status comment selection apithe definition of 'selectstart' in that specification.
HTMLContentElement.select - Web APIs
the htmlcontentelement.select property reflects the select attribute.
... it is a domstring containing a space-separated list of css selectors that select the content to insert in place of the <content> element.
... syntax object.select = "cssselector cssselector ..."; example // select <h1> elements and elements with class="error" mycontentobject.select = "h1 .error"; specifications this feature is no longer defined by any standards.
HTMLSelectElement.autofocus - Web APIs
the htmlselectelement.autofocus property is a boolean that reflects the autofocus html attribute, which indicates whether the associated <select> element will get input focus when the page loads, unless the user overrides it.
... setting this property doesn't set the focus to the associated <select> element: it merely tells the browser to focus to it when the element is inserted in the document.
... syntaxedit abool = aselectelement.autofocus; // get the value of autofocus aselectelement.autofocus = abool; // set the value of autofocus example html <select id="myselect" autofocus> <option>option 1</option> <option>option 2</option> </select> javascript // check if the autofocus attribute on the <select> var hasautofocus = document.getelementbyid('myselect').autofocus; specifications specification status comment html living standardthe definition of 'autofocus' in that specification.
HTMLSelectElement.checkValidity() - Web APIs
the htmlselectelement.checkvalidity() method checks whether the element has any constraints and whether it satisfies them.
... syntax var result = selectelt.checkvalidity(); specifications specification status comment html living standardthe definition of 'htmlselectelement.checkvalidity()' in that specification.
... html5the definition of 'htmlselectelement.checkvalidity()' in that specification.
HTMLSelectElement.labels - Web APIs
the htmlselectelement.labels read-only property returns a nodelist of the <label> elements associated with the <select> element.
... syntax var labelelements = select.labels; return value a nodelist containing the <label> elements associated with the <select> element.
... example html <label id="label1" for="test">label 1</label> <select id="test"> <option value="1">option 1</option> <option value="2">option 2</option> </select> <label id="label2" for="test">label 2</label> javascript window.addeventlistener("domcontentloaded", function() { const select = document.getelementbyid("test"); for(var i = 0; i < select.labels.length; i++) { console.log(select.labels[i].textcontent); // "label 1" and "label 2" } }); specifications specification status comment html living standardthe definition of 'labels' in that specification.
HTMLSelectElement.options - Web APIs
the htmlselectelement.options read-only property returns a htmloptionscollection of the <option> elements contained by the <select> element.
... syntax var options = select.options; return value a htmloptionscollection containing the <option> elements contained by the <select> element.
... example html <label for="test">label</label> <select id="test"> <option value="1">option 1</option> <option value="2">option 2</option> </select> javascript window.addeventlistener("domcontentloaded", function() { const select = document.getelementbyid("test"); for(var i = 0; i < select.options.length; i++) { console.log(select.options[i].label); // "option 1" and "option 2" } }); specifications specification status comment html living standardthe definition of 'options' in that specification.
Selection.anchorOffset - Web APIs
the selection.anchoroffset read-only property returns the number of characters that the selection's anchor is offset within the selection.anchornode.
...if the selection begins with the first character in the selection.anchornode, 0 is returned.
... syntax number = sel.anchoroffset specifications specification status comment selection apithe definition of 'selection.anchoroffset' in that specification.
Selection.collapseToEnd() - Web APIs
the selection.collapsetoend() method collapses the selection to the end of the last range in the selection.
... if the content of the selection is focused and editable, the caret will blink there.
... specifications specification status comment selection apithe definition of 'selection.collapsetoend()' in that specification.
Selection.collapseToStart() - Web APIs
the selection.collapsetostart() method collapses the selection to the start of the first range in the selection.
... if the content of the selection is focused and editable, the caret will blink there.
... specifications specification status comment selection apithe definition of 'selection.collapsetostart()' in that specification.
Selection.focusOffset - Web APIs
the selection.focusoffset read-only property returns the number of characters that the selection's focus is offset within the selection.focusnode.
...if the selection ends with the first character in the selection.focusnode, 0 is returned.
... syntax offset = sel.focusoffset specifications specification status comment selection apithe definition of 'selection.focusoffset' in that specification.
Selection.getRangeAt() - Web APIs
the selection.getrangeat() method returns a range object representing one of the ranges currently selected.
...a negative number or a number greater than or equal to selection.rangecount will result in an error.
... example let ranges = []; sel = window.getselection(); for(let i = 0; i < sel.rangecount; i++) { ranges[i] = sel.getrangeat(i); } /* each item in the ranges array is now * a range object representing one of the * ranges in the current selection */ specifications specification status comment selection apithe definition of 'selection: getrangeat()' in that specification.
Selection.removeAllRanges() - Web APIs
the selection.removeallranges() method removes all ranges from the selection, leaving the anchornode and focusnode properties equal to null and leaving nothing selected.
... specifications specification status comment selection apithe definition of 'selection.removeallranges()' in that specification.
... see also selection, the interface it belongs to.
USBDevice.selectConfiguration() - Web APIs
the selectconfiguration() method of the usbdevice interface returns a promise that resolves when the specified configuration is selected.
... syntax var promise = usbdevice.selectconfiguration(configurationvalue) parameters configurationvalue the number of a device-specific configuration.
... specifications specification status comment webusbthe definition of 'selectconfiguration' in that specification.
VideoTrack.selected - Web APIs
the videotrack property selected controls whether or not a particular video track is active.
... syntax isvideoselected = videotrack.selected; videotrack.selected = true | false; value the selected property is a boolean whose value is true if the track is active.
... specifications specification status comment html living standardthe definition of 'videotrack: selected' in that specification.
VideoTrackList.selectedIndex - Web APIs
the read-only videotracklist property selectedindex returns the index of the currently selected track, if any, or -1 otherwise.
... syntax var index = videotracklist.selectedindex; value a number indicating the index of the currently selected track, if any, or -1 otherwise.
... specifications specification status comment html living standardthe definition of 'videotracklist: selectedindex' in that specification.
Using the :target pseudo-class in selectors - CSS: Cascading Style Sheets
for example, the url http://developer.mozilla.org/en/docs/using_the_:target_selector#example contains the fragment identifier #example.
...thus, to add a border to the #example fragment, we would write: #example:target { border: 1px solid black; } targeting all elements if the intent is to create a "blanket" style that will apply to all targeted elements, then the universal selector comes in handy: :target { color: red; } example in the following example, there are five links that point to elements in the same document.
... selecting the "first" link, for example, will cause <h1 id="one"> to become the target element.
afterselected - Archive of obsolete content
« xul reference home afterselected type: boolean this is set to true if the tab is immediately after the currently selected tab.
...this is primarily useful for themes so that they can adjust the appearance of the area around the selected tab.
beforeselected - Archive of obsolete content
« xul reference home beforeselected type: boolean this is set to true if the tab is immediately before the currently selected tab.
...this is primarily useful for themes so that they can adjust the appearance of the area around the selected tab.
suppressonselect - Archive of obsolete content
« xul reference home suppressonselect type: boolean if this attribute is not specified, a select event is fired whenever an item is selected, either by the user or by calling one of the select methods.
... if set to true, the select event is never fired.
tab.selected - Archive of obsolete content
« xul reference home selected type: boolean this attribute is set to true if the tab is selected by default.
... see also selected ...
tabs.onselect - Archive of obsolete content
« xul reference home onselect type: script code this event is sent to the tabs element when this tab is changed.
... see also onselect ...
advanceSelectedTab - Archive of obsolete content
« xul reference home advanceselectedtab( dir, wrap ) return type: no return value if the argument dir is set to 1, the currently selected tab changes to the next tab.
... if the argument dir is set to -1, the currently selected tab changes to the previous tab.
clearSelection - Archive of obsolete content
« xul reference home clearselection() return type: no return value deselects all of the items.
... a select event is sent before the items are deselected.
invertSelection - Archive of obsolete content
« xul reference home invertselection() return type: no return value reverses the selected state of all items.
... selected items become deselected, and deselected items become selected.
menulist.select - Archive of obsolete content
« xul reference home select() return type: no return value select all the text in the menulist's textbox.
... see also select ...
selectAll - Archive of obsolete content
« xul reference home selectall() return type: no return value selects all of the items.
... a select event is sent after the selection is made.
selectItem - Archive of obsolete content
« xul reference home selectitem( item ) return type: no return value deselects all of the currently selected items and selects the given item.
... a select event is sent after the selection is made.
setSelectionRange - Archive of obsolete content
« xul reference home setselectionrange( start, end ) return type: no return value sets the selected portion of the textbox, where the start argument is the index of the first character to select and the end argument is the index of the character after the selection.
... set both arguments to the same value to move the cursor to the corresponding position without selecting text.
timedSelect - Archive of obsolete content
« xul reference home timedselect( item, timeout ) return type: no return value selects the item specified by the argument item after the number of milliseconds given by the timeout argument.
... all other items are deselected.
deck.selectedPanel - Archive of obsolete content
selectedpanel type: element holds a reference to the currently selected panel within a deck element.
... assigning a value to this property will modify the selected panel.
selectedTab - Archive of obsolete content
« xul reference selectedtab type: tab element a reference to the currently selected tab, which will always be one of the tab elements in the tabs element.
... assign a value to this property to modify the currently selected tab.
Selector (CSS) - MDN Web Docs Glossary: Definitions of Web-related terms
a css selector is the part of a css rule that describes what elements in a document the rule will match.
... consider this css: p { color: green; } div.warning { width: 100%; border: 2px solid yellow; color: white; background-color: darkred; padding: 0.8em 0.8em 0.6em; } #customized { font: 16px lucida grande, arial, helvetica, sans-serif; } the selectors here are "p" (which applies the color green to the text inside any <p> element), "div.warning" (which makes any <div> element with the class "warning" look like a warning box), and "#customized", which sets the base font of the element with the id "customized" to 16-pixel tall lucida grande or one of a few fallback fonts.
Document: selectionchange event - Web APIs
the selectionchange event of the selection api is fired when the current text selection on a document is changed.
... bubbles no cancelable no interface event event handler property onselectionchange examples // addeventlistener version document.addeventlistener('selectionchange', () => { console.log(document.getselection()); }); // onselectionchange version document.onselectionchange = () => { console.log(document.getselection()); }; specifications specification status comment selection apithe definition of 'selectionchange' in that specification.
Comparison of CSS Selectors and XPath - XPath
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes this article seeks to document the difference between css selectors and xpath for web developers to be able to better choose the right tool for the right job.
... xpath feature css equivalent ancestor, parent or preceding-sibling axis :has() selector attribute axis attribute selectors child axis child combinator descendant axis descendant combinator following-sibling axis general sibling combinator or adjacent sibling combinator self axis :scope or :host selector ...
completeselectedindex - Archive of obsolete content
« xul reference home completeselectedindex type: boolean if true, the text in the text field will be autocompleted as the user selects from the popup list.
lastSelected - Archive of obsolete content
« xul reference home lastselected type: string set this to the id of the last selected pane.
onselect - Archive of obsolete content
see tabs.onselect tree.onselect ...
selectedIndex - Archive of obsolete content
« xul reference home selectedindex type: integer gets and sets the index of the currently selected panel.
addItemToSelection - Archive of obsolete content
« xul reference home additemtoselection( item ) return type: no return value selects the given item, without deselecting any other items that are already selected.
ensureSelectedElementIsVisible - Archive of obsolete content
« xul reference home ensureselectedelementisvisible() return type: no return value if the currently selected element in the list box is not currently visible to the user, the list box view is scrolled so that it is.
removeItemFromSelection - Archive of obsolete content
« xul reference home removeitemfromselection( item ) return type: no return value deselects the specified item without deselecting other items.
select - Archive of obsolete content
ArchiveMozillaXULMethodselect
« xul reference home select() return type: no return value selects all the text in the textbox.
selectTabAtIndex - Archive of obsolete content
« xul reference home selecttabatindex( index, event ) return type: no return value selects the tab at the given index.
clickSelectsAll - Archive of obsolete content
« xul reference clickselectsall type: boolean if set to true, the contents of the textbox are selected when focused; otherwise, the cursor is left unchanged.
disableautoselect - Archive of obsolete content
« xul reference disableautoselect type: boolean gets and sets the value of the disableautoselect attribute.
lastSelected - Archive of obsolete content
« xul reference lastselected type: string set this to the id of the last selected pane.
selected - Archive of obsolete content
« xul reference selected type: boolean this property's value is true if this element is selected, or false if it is not.
selectedBrowser - Archive of obsolete content
« xul reference selectedbrowser type: browser element this read-only property returns the currently displayed browser element.
selectedCount - Archive of obsolete content
« xul reference selectedcount type: integer returns the number of items that are currently selected.
selectedItems - Archive of obsolete content
« xul reference selecteditems type: array of listitems returns an array of the selected items in the list.
suppressOnSelect - Archive of obsolete content
« xul reference suppressonselect type: boolean gets and sets the value of the suppressonselect attribute.
ui.textSelectBackground
ui.textselectbackground saves the color in which the background of a text selection in the user interface or in content will be styled.
ui.textSelectForeground
ui.textselectforeground saves the color in which the text of a text selection in the user interface or the content will be styled.
Inspect and select colors - Firefox Developer Tools
the color picker includes an eyedropper icon: clicking this icon enables you to use the eyedropper to select a new color for the element from the page: clicking the color sample while holding down the shift key changes the color format: ...
Index - Web APIs
WebAPIIndex
136 audiocontextlatencycategory api, audio, audio context, audiocontextlatencycategory, enum, interface, media, reference, type, web audio, web audio api, latency the audiocontextlatencycategory type is an enumerated set of strings which are used to select one of a number of default values for acceptable maximum latency of an audio context.
... 388 css.escape() api, css, cssom, method, reference, static, escape() the css.escape() static method returns a cssomstring containing the escaped string passed as parameter, mostly for use as part of a css selector.
... 450 csspseudoelement.type api, csspseudoelement, experimental, property, reference, type the type read-only property of the csspseudoelement interface returns the type of the pseudo-element as a string, represented in the form of a css selector.
...And 162 more matches
Index - Archive of obsolete content
56 selection add-on sdk get and set text and html selections in the current web page.
... 205 queryselector dom no summary!
... 385 creating a mozilla extension add-ons, extensions a mozilla extension is an installable enhancement to the mozilla browser that provides additional functionality (for example linky, which adds an item to the context menu for opening multiple links in a document or selection).
...And 103 more matches
How to build custom form controls - Learn web development
for example, if you need to perform advanced styling on some controls such as the <select> element or if you want to provide custom behaviors, you may consider building your own controls.
...to that end, we will work with an example: rebuilding the <select> element.
... in our example, we will rebuild the <select> element.
...And 65 more matches
Index - Archive of obsolete content
ArchiveMozillaXULIndex
i selected items for this group because they seemed to be either shrouded in mystery, misused as concepts or terms, or underestimated according to their role in xul and cross-platform development.
... 12 afterselected xul attributes, xul reference no summary!
... 28 beforeselected xul attributes, xul reference no summary!
...And 63 more matches
Editor Embedding Guide - Archive of obsolete content
get the current command state of a given command -- getcommandstate: commandmanager->getcommandstate(acommand,acommandparams) index of commands and parameters cmd_bold toggles bold style on selection.
... getcommandstate "state_all"(boolean), "state_begin"(boolean), "state_end"(boolean), "state_mixed"(boolean), "state_enabled" (boolean) docommand no parameters example normal bold cmd_italics toggles italics style on selection.
... getcommandstate "state_all"(boolean), "state_begin"(boolean), "state_end"(boolean), "state_mixed"(boolean), "state_enabled" (boolean) docommand no parameters example normal italics cmd_underline toggles underline on selection.
...And 60 more matches
nsIHTMLEditor
o 5.0 (firefox 5.0 / thunderbird 5.0 / seamonkey 2.2) method overview void adddefaultproperty(in nsiatom aproperty, in astring aattribute, in astring avalue); void addinsertionlistener(in nsicontentfilter infilter); void align(in astring aalign); boolean breakisvisible(in nsidomnode anode); boolean candrag(in nsidomevent aevent); void checkselectionstateforanonymousbuttons(in nsiselection aselection); nsidomelement createanonymouselement(in astring atag, in nsidomnode aparentnode, in astring aanonclass, in boolean aiscreatedhidden); nsidomelement createelementwithdefaults(in astring atagname); void decreasefontsize(); void dodrag(in nsidomevent aevent); void getalignment(out boolean amixed, out...
...ring avalue, out boolean afirst, out boolean aany, out boolean aall); nsisupportsarray getlinkedobjects(); void getlistitemstate(out boolean amixed, out boolean ali, out boolean adt, out boolean add); void getliststate(out boolean amixed, out boolean aol, out boolean aul, out boolean adl); astring getparagraphstate(out boolean amixed); nsidomelement getselectedelement(in astring atagname); nsidomelement getselectioncontainer(); void ignorespuriousdragevent(in boolean aignorespuriousdragevent); void increasefontsize(); void indent(in astring aindent); void insertelementatselection(in nsidomelement aelement, in boolean adeleteselection); void insertfromdrop(in nsidomevent aevent); void inser...
...thtml(in astring ainputstring); void inserthtmlwithcontext(in astring ainputstring, in astring acontextstr, in astring ainfostr, in astring aflavor, in nsidomdocument asourcedoc, in nsidomnode adestinationnode, in long adestinationoffset, in boolean adeleteselection); void insertlinkaroundselection(in nsidomelement aanchorelement); boolean isanonymouselement(in nsidomelement aelement); void makeorchangelist(in astring alisttype, in boolean entirelist, in astring abullettype); boolean nodeisblock(in nsidomnode node); void pastenoformatting(in long aselectiontype); void rebuilddocumentfromsource(in astring asourcestring); void removealldefaultproperties(); void removeallinlineproperties(); void removedefaultp...
...And 56 more matches
richlistbox - Archive of obsolete content
note: in versions of firefox prior to firefox 3, rich list boxes support only single selection.
... firefox 3 introduced multiple selection to rich list boxes.
... attributes disabled, disablekeynavigation, preference, seltype, suppressonselect, tabindex, value properties accessibletype, currentindex, currentitem, disabled, disablekeynavigation, itemcount, scrollboxobject, selectedcount, selectedindex, selecteditem, selecteditems, seltype, suppressonselect, tabindex, value methods additemtoselection, appenditem, clearselection, ensureelementisvisible, ensureindexisvisible, getindexoffirstvisiblerow, getindexofitem, getitematindex, getnumberofvisiblerows, getrowcount, getselecteditem, insertitemat, invertselection, movebyoffset, removeitemat, removeitemfromselection, scrolltoindex, selectall, selectitem, selectitemrange, timedselect, toggleitemselection examples <richlistbox> <richlistitem> <description>a xul description!</descriptio...
...And 49 more matches
listbox - Archive of obsolete content
« xul reference home [ examples | attributes | properties | methods | related ] this element is used to create a list of items where one or more of the items may be selected.
... attributes disabled, disablekeynavigation, preference, rows, seltype, suppressonselect, tabindex, value properties accessibletype, currentindex, currentitem, disabled, disablekeynavigation, itemcount, listboxobject, selectedcount, selectedindex, selecteditem, selecteditems, seltype, suppressonselect, tabindex, value methods additemtoselection, appenditem, clearselection, ensureelementisvisible, ensureindexisvisible, getindexoffirstvisiblerow, getindexofitem, getitematinde...
...x, getnumberofvisiblerows, getrowcount, getselecteditem, insertitemat, invertselection, movebyoffset, removeitemat, removeitemfromselection, scrolltoindex, selectall, selectitem, selectitemrange, timedselect, toggleitemselection examples <listbox id="thelist"> <listitem label="ruby"/> <listitem label="emerald"/> <listitem label="sapphire" selected="true"/> <listitem label="diamond"/> </listbox> <listbox id="thelist" rows="10" width="400"> <listhead> <listheader label="1ct gem" width="240"/> <listheader label="price" width="150"/> </listhead> <listcols> <listcol/> <listcol flex="1"/> </listcols> </listbox> var thelist = document.getelementbyid('thelist'); gems = [ {gem: "ruby", price: "$3,500 - $4,600"}, {gem: "emerald", price: "$700 - 4,...
...And 48 more matches
ARIA: listbox role - Accessibility
the listbox role is used for lists from which a user may select one or more items which are static and, unlike html <select> elements, may contain images.
... description the listbox role is used to identify an element that creates a list from which a user may select one or more static items, similar to the html <select> element.
... unlike <select>, a listbox can contain images.
...And 46 more matches
Midas
in addition to the built-in commands, advanced editing can be done by manipulating the selection and range objects.
... document.querycommandindeterm determines whether the current selection is in an indetermined state.
... document.querycommandstate determines whether the given command has been executed on the current selection.
...And 44 more matches
IAccessibleTable
index ); [propget] hresult columndescription([in] long column, [out] bstr description ); [propget] hresult columnextentat([in] long row, [in] long column, [out] long ncolumnsspanned ); [propget] hresult columnheader([out] iaccessibletable accessibletable, [out] long startingrowindex ); [propget] hresult columnindex([in] long cellindex, [out] long columnindex ); [propget] hresult iscolumnselected([in] long column, [out] boolean isselected ); [propget] hresult isrowselected([in] long row, [out] boolean isselected ); [propget] hresult isselected([in] long row, [in] long column, [out] boolean isselected ); [propget] hresult modelchange([out] ia2tablemodelchange modelchange ); [propget] hresult ncolumns([out] long columncount ); [propget] hresult nrows([out] long rowcount ); [pr...
...opget] hresult nselectedchildren([out] long cellcount ); [propget] hresult nselectedcolumns([out] long columncount ); [propget] hresult nselectedrows([out] long rowcount ); [propget] hresult rowcolumnextentsatindex([in] long index, [out] long row, [out] long column, [out] long rowextents, [out] long columnextents, [out] boolean isselected ); [propget] hresult rowdescription([in] long row, [out] bstr description ); [propget] hresult rowextentat([in] long row, [in] long column, [out] long nrowsspanned ); [propget] hresult rowheader([out] iaccessibletable accessibletable, [out] long startingcolumnindex ); [propget] hresult rowindex([in] long cellindex, [out] long rowindex ); hresult selectcolumn([in] long column ); [propget] hresult selectedchildren([in] long maxchildren, [out, si...
...ze_is(,maxchildren), length_is(, nchildren)] long children, [out] long nchildren ); [propget] hresult selectedcolumns([in] long maxcolumns, [out, size_is(,maxcolumns), length_is(, ncolumns)] long columns, [out] long ncolumns ); [propget] hresult selectedrows([in] long maxrows, [out, size_is(,maxrows), length_is(, nrows)] long rows, [out] long nrows ); hresult selectrow([in] long row ); [propget] hresult summary([out] iunknown accessible ); hresult unselectcolumn([in] long column ); hresult unselectrow([in] long row ); methods accessibleat() returns the accessible object at the specified row and column in the table.
...And 36 more matches
IAccessibleTable2
method overview [propget] hresult caption([out] iunknown accessible ); [propget] hresult cellat([in] long row, [in] long column, [out] iunknown cell ); [propget] hresult columndescription([in] long column, [out] bstr description ); [propget] hresult iscolumnselected([in] long column, [out] boolean isselected ); [propget] hresult isrowselected([in] long row, [out] boolean isselected ); [propget] hresult modelchange([out] ia2tablemodelchange modelchange ); [propget] hresult ncolumns([out] long columncount ); [propget] hresult nrows([out] long rowcount ); [propget] hresult nselectedcells([out] long cellcount ); [propget] hresult nselectedcolumns([...
...out] long columncount ); [propget] hresult nselectedrows([out] long rowcount ); [propget] hresult rowdescription([in] long row, [out] bstr description ); hresult selectcolumn([in] long column ); [propget] hresult selectedcells([out, size_is(, nselectedcells,)] iunknown cells, [out] long nselectedcells ); [propget] hresult selectedcolumns([out, size_is(, ncolumns)] long selectedcolumns, [out] long ncolumns ); [propget] hresult selectedrows([out, size_is(, nrows)] long selectedrows, [out] long nrows ); hresult selectrow([in] long row ); [propget] hresult summary([out] iunknown accessible ); hresult unselectcolumn([in] long column ); hresult unselectrow([in] long row ); methods caption() returns the caption for the table.
...iscolumnselected() returns a boolean value indicating whether the specified column is completely selected.
...And 36 more matches
IME handling guide
preedit string), suggests a list of what the user attempts to input, commits composition string as a selected item off the list and commits composition string without any conversion.
... if one or more clauses were not converted as expected, the user can choose one of the clauses with arrow keys and look for the expected result form the list in the drop down menu (in the following screenshot, the clause with the thicker underline is called "selected clause").
... each clause is represented with selection in the editor.
...And 35 more matches
Document.execCommand() - Web APIs
most commands affect the document's selection (bold, italics, etc.), while others insert new elements (adding a link), or affect an entire line (indenting).
... bold toggles bold on/off for the selection or at the insertion point.
...(not supported by internet explorer.) copy copies the current selection to the clipboard.
...And 34 more matches
Inputs and input sources - Web APIs
actions include both selection actions, such as clicking on a button, and squeeze actions, such as pulling a trigger or tightening your grip while wearing haptic gloves.
...these devices include but aren't limited to: screen taps (particularly but not necessarily only on phones or tablets) can be used to simultaneously perform both targeting and selection.
... motion-sensing controllers, which use accelerometers, magnetometers, and other sensors for motion tracking and targeting and may additionally include any number of buttons, joysticks, thumbpads, touchpads, force sensors, and so on to provide additional input sources for both targeting and selection.
...And 31 more matches
Eclipse CDT
installing eclipse regarding llvm4eclipsecdt, do not install or select this toolchain for mozilla development.
...in principle, you can set the index to rebuild automatically by opening the workspace preferences, selecting "c/c++ > indexer", and reenabling "automatically update the index".
...to rebuild for changes in an individual directory (for example, to take account of some changes that you yourself made) select "index > freshen all files" on that directory.
...And 30 more matches
nsIAccessibleTable
t(in long cellindex); note: renamed from getcolumnatindex in gecko 1.9.2 void getrowandcolumnindicesat(in long cellindex, out long rowindex, out long columnindex); astring getrowdescription(in long rowindex); long getrowextentat(in long row, in long column); long getrowindexat(in long cellindex); note: renamed from getrowatindex in gecko 1.9.2 void getselectedcellindices(out unsigned long cellsarraysize, [retval, array, size_is(cellsarraysize)] out long cellsarray); note: renamed from getselectedcells in gecko 1.9.2 void getselectedcolumnindices(out unsigned long columnsarraysize, [retval, array, size_is(columnsarraysize)] out long columnsarray); note: renamed from getselectedcolumns in gecko 1.9.2 void getselectedrowindices(out uns...
...igned long rowsarraysize, [retval, array, size_is(rowsarraysize)] out long rowsarray); note: renamed from getselectedrows in gecko 1.9.2 boolean iscellselected(in long rowindex, in long columnindex); boolean iscolumnselected(in long columnindex); boolean isprobablyforlayout(); boolean isrowselected(in long rowindex); void selectcolumn(in long columnindex); void selectrow(in long rowindex); void unselectcolumn(in long columnindex); void unselectrow(in long rowindex); attributes attribute type description caption nsiaccessible the caption accessible for the table.
...obsolete since gecko 1.9.2 selectedcellcount unsigned long the total number of selected cells.
...And 30 more matches
Cascade and inheritance - Learn web development
the h1 ends up being colored blue — these rules have an identical selector and therefore carry the same specificity, so the last one in the source order wins.
... specificity specificity is how the browser decides which rule applies if multiple rules have different selectors, but could still apply to the same element.
... it is basically a measure of how specific a selector's selection will be: an element selector is less specific — it will select all elements of that type that appear on a page — so will get a lower score.
...And 29 more matches
Eclipse CDT Manual Setup
below.) initial workspace preferences when you open eclipse, it will ask you to "select a workspace" (a directory where eclipse will store files that it generates during indexing, and so on.) it's recommended that you have a separate workspace containing only a single project for each mozilla source tree [rational], and that you choose a directory outside the mozilla source.
...after selecting an appropriate directory, click ok, then close the "welcome" tab when the main eclipse window opens.
... select "general > content types", expand "text > c source file > c++ source file", click "add" and add "*.mm".
...And 29 more matches
context-menu - Archive of obsolete content
make sure that no text is selected.
...it does not occur when the user invokes the context menu on a link, image, or other non-text node, or while a selection exists.
... selectioncontext() this context occurs when the menu is invoked on a page in which the user has made a selection.
...And 28 more matches
Key Values - Web APIs
learn how to use these key values in javascript using keyboardevent.key special values | modifier keys | whitespace keys | navigation keys | editing keys | ui keys | device keys | ime and composition keys | function keys | phone keys | multimedia keys | audio control keys | tv control keys | media controller keys | speech recognition keys | document keys | application selector keys | browser control keys | numeric keypad keys special values values of key which have special meanings other than identifying a specific key or character.
...removes the currently selected input.
... appcommand_copy gdk_key_copy (0x1008ff57) qt::key_copy (0x010000cf) "crsel" [3] the cursor select key, crsel.
...And 26 more matches
<input type="file"> - HTML: Hypertext Markup Language
WebHTMLElementinputfile
value a domstring representing the path to the selected file.
... events change and input supported common attributes required additional attributes accept, capture, files, multiple idl attributes files and value dom interface htmlinputelement properties properties that apply only to elements of type file methods select() value a file input's value attribute contains a domstring that represents the path to the selected file(s).
... if the user selected multiple files, the value represents the first file in the list of files they selected.
...And 25 more matches
Making decisions in your code — conditionals - Learn web development
} — check out the following more involved example, which could be part of a simple weather forecast application: <label for="weather">select the weather type today: </label> <select id="weather"> <option value="">--make a choice--</option> <option value="sunny">sunny</option> <option value="rainy">rainy</option> <option value="snowing">snowing</option> <option value="overcast">overcast</option> </select> <p></p> const select = document.queryselector('select'); const para = document.queryselector('p'); select.addeventliste...
...ner('change', setweather); function setweather() { const choice = select.value; if (choice === 'sunny') { para.textcontent = 'it is nice and sunny outside today.
...best to stay in with a cup of hot chocolate, or go build a snowman.'; } else if (choice === 'overcast') { para.textcontent = 'it isn\'t raining, but the sky is grey and gloomy; it could turn any minute, so take a rain coat just in case.'; } else { para.textcontent = ''; } } here we've got an html <select> element allowing us to make different weather choices, and a simple paragraph.
...And 23 more matches
nsIDOMWindowUtils
uerycontenteventresult sendquerycontentevent(in unsigned long atype, in unsigned long aoffset, in unsigned long alength, in long ax, in long ay); obsolete since gecko 31.0 nsiquerycontenteventresult sendquerycontentevent(in unsigned long atype, in unsigned long aoffset, in unsigned long alength, in long ax, in long ay, [optional] in unsigned long aadditionalflags); boolean sendselectionsetevent(in unsigned long aoffset, in unsigned long alength, in boolean areverse); obsolete since gecko 31.0 boolean sendselectionsetevent(in unsigned long aoffset, in unsigned long alength, [optional] in unsigned long aadditionalflags); void sendsimplegestureevent(in astring atype, in float ax, in float ay, in unsigned long adirection, in double adelta, in long amodifiers);...
... obsolete since gecko 38.0 composition_attr_selectedrawtext 0x03 obsolete since gecko 38.0 composition_attr_convertedtext 0x04 obsolete since gecko 38.0 composition_attr_selectedconvertedtext 0x05 obsolete since gecko 38.0 query_content_flag_use_native_line_break 0x0000 one of values of aadditionalflags of sendquerycontentevent().
... query_content_flag_selection_spellcheck 0x0002 one of values of aadditionalflags of sendquerycontentevent().
...And 23 more matches
<input>: The Input (Form Input) element - HTML: Hypertext Markup Language
WebHTMLElementinput
<input type="button" name="button" /> checkbox a check box allowing single values to be selected/deselected.
... <input type="email" name="email"/> html5 file a control that lets the user select a file.
... use the accept attribute to define the types of files that the control can select.
...And 23 more matches
Manipulating Lists - Archive of obsolete content
in fact, these methods are part of the nsidomxulselectcontrolelement interface so any xul elements which implement this interface have these methods.
... list selection the nsidomxulselectcontrolelement interface provides two additonal properties, selectedindex and selecteditem.
... the former returns the index of the selected item while the latter returns the selected element.
...And 22 more matches
nsIClipboardCommands
inherits from: nsisupports last changed in gecko 1.7 method overview boolean cancopyimagecontents(); boolean cancopyimagelocation(); boolean cancopylinklocation(); boolean cancopyselection(); boolean cancutselection(); boolean canpaste(); void copyimagecontents(); void copyimagelocation(); void copylinklocation(); void copyselection(); void cutselection(); void paste(); void selectall(); void selectnone(); methods cancopyimagecontents() returns whether we can copy an image's contents.
...return value true if an image is selected, false otherwise.
...return value true if an image is selected, false otherwise.
...And 22 more matches
nsIMsgDBView
amsgwindow, in nsimsgdbviewcommandupdater acommandupdater); void sort(in nsmsgviewsorttypevalue sorttype, in nsmsgviewsortordervalue sortorder); void docommand(in nsmsgviewcommandtypevalue command); void docommandwithfolder(in nsmsgviewcommandtypevalue command, in nsimsgfolder destfolder); void getcommandstatus(in nsmsgviewcommandtypevalue command, out boolean selectable_p, out nsmsgviewcommandcheckstatevalue selected_p); void viewnavigate(in nsmsgnavigationtypevalue motion, out nsmsgkey resultid, out nsmsgviewindex resultindex, out nsmsgviewindex threadindex, in boolean wrap); boolean navigatestatus(in nsmsgnavigationtypevalue motion); nsmsgkey getkeyat(in nsmsgviewindex index); nsimsgdbhdr getmsghdrat(in nsmsgviewindex in...
...dex); nsimsgfolder getfolderforviewindex(in nsmsgviewindex index); acstring geturiforviewindex(in nsmsgviewindex index); nsimsgdbview clonedbview(in nsimessenger amessengerinstance, in nsimsgwindow amsgwindow, in nsimsgdbviewcommandupdater acommandupdater); void geturisforselection([array, size_is(count)] out string uris, out unsigned long count); void getindicesforselection([array, size_is(count)] out nsmsgviewindex indices, out unsigned long count); void loadmessagebymsgkey(in nsmsgkey amsgkey); void loadmessagebyviewindex(in nsmsgviewindex aindex); void loadmessagebyurl(in string aurl); void reloadmessage(); void reloadmessagewithallparts(); void selectmsgbykey(in nsmsgkey key); void se...
...lectfoldermsgbykey(in nsimsgfolder afolder, in nsmsgkey akey); void ondeletecompleted(in boolean succeeded); nsmsgviewindex findindexfromkey(in nsmsgkey amsgkey, in boolean aexpand); void expandandselectthreadbyindex(in nsmsgviewindex aindex, in boolean aaugment); void addcolumnhandler(in astring acolumn, in nsimsgcustomcolumnhandler ahandler); void removecolumnhandler(in astring acolumn); nsimsgcustomcolumnhandler getcolumnhandler(in astring acolumn); attributes attribute type description viewtype nsmsgviewtypevalue readonly: type of view.
...And 22 more matches
nsMsgViewCommandType
last changed in gecko 1.9 (firefox 3) constants name value description markmessagesread 0 marks the selected messages as read.
... markmessagesunread 1 mark the selected messages as unread togglemessageread 2 toggle the read flag of the selected messages flagmessages 3 flag the selected messages.
... unflagmessages 4 unflag the selected messages.
...And 22 more matches
Specificity - CSS: Cascading Style Sheets
specificity is based on the matching rules which are composed of different sorts of css selectors.
... specificity is a weight that is applied to a given css declaration, determined by the number of each selector type in the matching selector.
... selector types the following list of selector types increases by specificity: type selectors (e.g., h1) and pseudo-elements (e.g., ::before).
...And 22 more matches
Introduction to events - Learn web development
for example, if the user selects a button on a webpage, you might want to respond to that action by displaying an information box.
...for example: the user selects a certain element or hovers the cursor over a certain element.
...in the following example, we have a single <button>, which when pressed, makes the background change to a random color: <button>change color</button> button { margin: 10px }; the javascript looks like so: const btn = document.queryselector('button'); function random(number) { return math.floor(math.random() * (number+1)); } btn.onclick = function() { const rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; document.body.style.backgroundcolor = rndcol; } in this code, we store a reference to the button inside a constant called btn, using the document.queryselector() function.
...And 21 more matches
Document - Web APIs
WebAPIDocument
has the value null until the style sheet is changed by setting the value of selectedstylesheetset.
... document.selectedstylesheetset returns which style sheet set is currently in use.
... document.onselectionchange is an eventhandler representing the code to be called when the selectionchange event is raised.
...And 21 more matches
:is() (:matches(), :any()) - CSS: Cascading Style Sheets
WebCSS:is
the :is() css pseudo-class function takes a selector list as its argument, and selects any element that can be selected by one of the selectors in that list.
... this is useful for writing large selectors in a more compact form.
...:any() works in exactly the same way as :matches()/:is(), except that it requires vendor prefixes and doesn't support complex selectors.
...And 21 more matches
menulist - Archive of obsolete content
the user may select one of the elements displayed in the menulist.
... the currently selected choice is displayed on the menulist element.
...the command event may be used to execute code when the menulist selection changes.
...And 20 more matches
<input type="radio"> - HTML: Hypertext Markup Language
WebHTMLElementinputradio
only one radio button in a given group can be selected at the same time.
... radio buttons are typically rendered as small circles, which are filled or highlighted when selected.
... note: checkboxes are similar to radio buttons, but with an important distinction: radio buttons are designed for selecting one value out of a set, whereas checkboxes let you turn individual values on and off.
...And 20 more matches
Textbox (XPFE autocomplete) - Archive of obsolete content
e properties accessible, alwaysopenpopup, autofill, autofillaftermatch, completedefaultindex, crop, disableautocomplete, disabled, editable, focused, forcecomplete, highlightnonmatches, ignoreblurwhilesearching, inputfield, issearching, iswaiting, label, maxlength, maxrows, minresultsforpopup, nomatch, open, popup, popupopen, resultspopup, searchcount, searchparam, searchsessions, selectionend, selectionstart, sessioncount, showcommentcolumn, showpopup, size, tabindex, tabscrolling, textlength, textvalue, timeout, type, useraction, value methods addsession, clearresults, getdefaultsession, getresultat, getresultcount, getresultvalueat, getsession, getsessionbyname, getsessionresultat, getsessionstatusat, getsessionvalueat, removesession, select, setselectionrange,...
...if false, the default, the value will not be filled in until the user selects an item.
...if false, the default, the value will not be filled in until the user selects an item.
...And 19 more matches
UI pseudo-classes - Learn web development
this included some usage of pseudo-classes, for example using :checked to target a checkbox only when it is selected.
... the original pseudo-classes available to us (as of css 2.1) that are relevant to forms are: :hover: selects an element only when it is being hovered over by a mouse pointer.
... :focus: selects an element only when it is focused (i.e.
...And 19 more matches
source-editor.jsm
operations number getcharcount(); string getindentationstring(); string getlinedelimiter(); number getlinecount(); number getlineend(number alineindex, boolean aincludedelimiter); number getlinestart(number alineindex); string getmode(); string gettext([optional] number astart, [optional] number aend); string getselectedtext(); void setmode(string amode); void settext(string atext, [optional] number astart, [optional] number aend); selection operations void dropselection(); number getcaretoffset(); object getcaretposition(); object getselection(); void setcaretoffset(number aoffset); void setcaretposition(number aline, [optional] nu...
...mber acolumn, [optional] number aalign); void setselection(number astart, number aend); breakpoint management void addbreakpoint(number alineindex, [optional] string acondition); array getbreakpoints(); boolean removebreakpoint(number alineindex); properties attribute type description dirty boolean set this value to false whenever you save the text; the editor will update it to true when the content is changed.
... sourceeditor.events.selection "selection" fired when the current selection in the editor changes.
...And 19 more matches
Event reference
clipboard events event name fired when cut the selection has been cut and copied to the clipboard copy the selection has been copied to the clipboard paste the item from the clipboard has been pasted keyboard events event name fired when keydown any key is pressed keypress any key (except shift, fn, or capslock) is in a pressed position (fired continuously).
... select some text is being selected.
... drag & drop events event name fired when drag an element or text selection is being dragged (fired continuously every 350ms).
...And 19 more matches
Combinators - Learn web development
previous overview: building blocks next the final selectors we will look at are called combinators, because they combine other selectors in a way that gives them a useful relationship to each other and the location of content in the document.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the different combinator selectors that can be used in css.
... descendant combinator the descendant combinator — typically represented by a single space ( ) character — combines two selectors such that elements matched by the second selector are selected if they have an ancestor (parent, parent's parent, parent's parent's parent, etc) element matching the first selector.
...And 18 more matches
Index - Learn web development
css is what you use to selectively style html elements.
... for example, this css selects paragraph text, setting the color to red: 38 dealing with files beginner, codingscripting, files, guide, html, l10n:priority, theory, website when you are working on a website locally on your computer, you should keep all the related files in a single folder that mirrors the published website's file structure on the server.
...for example, if the user selects a button on a webpage, you might want to respond to that action by displaying an information box.
...And 18 more matches
Handling common accessibility problems - Learn web development
you could do this manually by just removing the css from your code, but the easiest way is to use browser features, for example: firefox: select view > page style > no style from the main menu.
... safari: select develop > disable styles from the main menu (to enable the develop menu, choose safari > preferences > advanced > show develop menu in menu bar).
...click the gear icon that will appear, then select css > disable all styles.
...And 18 more matches
textbox (Toolkit autocomplete) - Archive of obsolete content
attributes accesskey, autocompletepopup, autocompletesearch, autocompletesearchparam, completedefaultindex, completeselectedindex,crop, disableautocomplete, disabled, disablekeynavigation, enablehistory, focused, forcecomplete, highlightnonmatches, ignoreblurwhilesearching, inputtooltiptext, label, maxlength, maxrows, minresultsforpopup, nomatch, onchange, oninput, onsearchcomplete, ontextentered, ontextreverted, open, readonly,showcommentcolumn, showimagecolumn, size, tabindex, tabscrolling, timeout, type, value ...
... properties accessibletype, completedefaultindex, controller, crop, disableautocomplete, disablekeynavigation, disabled, editable, focused, forcecomplete, highlightnonmatches, ignoreblurwhilesearching, inputfield, label, maxlength, maxrows, minresultsforpopup, open, popup, popupopen, searchcount, searchparam, selectionend, selectionstart, showcommentcolumn, showimagecolumn,size, tabindex, tabscrolling, textlength, textvalue, timeout, type, value methods getsearchat, onsearchcomplete, ontextentered, ontextreverted, select, setselectionrange examples <textbox type="autocomplete" autocompletesearch="history"/> attributes accesskey type: character this should be set to a character that is used as a shortcut key.
...if set to false or omitted, the value must be selected from the list.
...And 17 more matches
Mobile accessibility - Learn web development
for example: single-tapping an app will select it, and the device will read out what the app is.
... double-tapping anywhere will open the app/select the option.
... once you've selected the option you want, double-click to choose that option.
...And 17 more matches
Pseudo-classes and pseudo-elements - Learn web development
previous overview: building blocks next the next set of selectors we will look at are referred to as pseudo-classes and pseudo-elements.
...once again the relevant mdn page for each selector is helpful in explaining browser support.
... prerequisites: basic computer literacy, basic software installed, basic knowledge of working with files, html basics (study introduction to html), and an idea of how css works (study css first steps.) objective: to learn about the pseudo-class and pseudo-element selectors.
...And 17 more matches
Index
MozillaTechXPCOMIndex
scripts typically select this with the "language" attribute.
... 256 extendselection this method extends the current selection from its current accessible anchor node to this accessible.
... 285 setselected this method adds or remove this accessible to the current selection.
...And 17 more matches
Border-image generator - CSS: Cascading Style Sheets
tle"> border-image-outset </div> </div> <!-- other-settings --> <div id="aditional-properties" class="category"> <div class="title"> aditional-properties </div> <div class="property"> <div class="name"> repeat-x </div> <div class="ui-dropdown border-repeat" data-topic="image-repeat-x" data-selected="2"> <div data-value="0">repeat</div> <div data-value="0">stretch</div> <div data-value="0">round</div> </div> </div> <div class="property"> <div class="name"> repeat-y </div> <div class="ui-dropdown border-repeat" data-topic="image-...
...repeat-y" data-selected="2"> <div data-value="1">repeat</div> <div data-value="1">stretch</div> <div data-value="1">round</div> </div> </div> <div class="property"> <div class="ui-input-slider" data-topic="font-size" data-info="em size" data-unit="px" data-value="12" data-sensivity="3"> </div> </div> <div class="property"> <div class="ui-input-slider" data-topic="preview-width" data-info="width" data-unit=" px" data-min="10" data-max="10000" data-sensivity="3"></div> </div> <div class="property"> ...
... (trigger haslayout) */ } /* grid column setup * ========================================================================== */ .col { display: block; float:left; margin: 1% 0 1% 1.6%; } .col:first-child { margin-left: 0; } /* all browsers except ie6 and lower */ /* * ui component */ .ui-input-slider { height: 20px; font-family: "segoe ui", arial, helvetica, sans-serif; -moz-user-select: none; user-select: none; } .ui-input-slider * { float: left; height: 100%; line-height: 100%; } /* input slider */ .ui-input-slider > input { margin: 0; padding: 0; width: 50px; text-align: center; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; box-sizing: border-box; } .ui-input-slider-info { width: 90px; padding: 0px 10px 0px 0px; text-align: right; text-trans...
...And 17 more matches
Box-shadow generator - CSS: Cascading Style Sheets
="wrap-left"> <div class="colorpicker category"> <div class="title"> </div> <div id="colorpicker" class="group"> <div id="gradient" class="gradient"> <div id="gradient_picker"> </div> </div> <div id="hue" data-topic="hue" class="hue"> <div id="hue_selector"> </div> </div> <div class="info"> <div class="input" data-topic="hue" data-title='h:' data-action="hsv"></div> <div class="input" data-topic="saturation" data-title='s:' data-action="hsv"></div> <div class="input" data-topic="value" data-title='v:' data-action="hsv"></div> ...
... </div> <div class="alpha"> <div id="alpha" data-topic="alpha"> <div id="alpha_selector"> </div> </div> </div> <div class="info"> <div class="input" data-topic="r" data-title='r:' data-action="rgb"></div> <div class="input" data-topic="g" data-title='g:' data-action="rgb"></div> <div class="input" data-topic="b" data-title='b:' data-action="rgb"></div> </div> <div class="preview block"> <div id="output_color"> </div> </div> <div class="block info"> <div cla...
...r haslayout) */ } /* grid column setup * ========================================================================== */ .col { display: block; float:left; margin: 1% 0 1% 1.6%; } .col:first-child { margin-left: 0; } /* all browsers except ie6 and lower */ /* * ui slider */ .slidergroup { height: 20px; margin: 10px 0; font-family: "segoe ui", arial, helvetica, sans-serif; -moz-user-select: none; user-select: none; } .slidergroup * { float: left; height: 100%; line-height: 100%; } /* slider */ .ui-slider { height: 10px; width: 200px; margin: 4px 10px; display: block; border: 1px solid #999; border-radius: 3px; background: #eee; } .ui-slider:hover { cursor: pointer; } .ui-slider-name { width: 90px; padding: 0 10px 0 0; text-align: right; text-transform: lowercas...
...And 17 more matches
HTML attribute: multiple - HTML: Hypertext Markup Language
valid for the email and file input types and the <select>, the manner by which the user opts for multiple values depends on the form control.
...in firefox, the file input reads "no files selected" when the attribute is present and "no file selected" when not, when no files are selected.
... most browsers displaying a scrolling list box for a <select> control with the multiple attribute set versus a single line dropdown when the attribute is ommitted.
...And 17 more matches
<input type="datetime-local"> - HTML: Hypertext Markup Language
methods select(), stepdown(), stepup() value a domstring representing the value of the date entered into the input.
... you can also get and set the date value in javascript using the htmlinputelement.value property, for example: var datecontrol = document.queryselector('input[type="datetime-local"]'); datecontrol.value = '2017-06-01t08:30'; there are several methods provided by javascript's date that can be used to convert numeric date information into a properly-formatted string, or you can do it manually.
...in the following example we are setting a minimum datetime of 2017-06-01t08:30 and a maximum datetime of 2017-06-30t16:30: <form> <label for="party">enter a date and time for your party booking:</label> <input id="party" type="datetime-local" name="partydate" min="2017-06-01t08:30" max="2017-06-30t16:30"> </form> the result here is that: only days in june 2017 can be selected — only the "days" part of the date value will be editable, and dates outside june can't be scrolled to in the datepicker widget.
...And 17 more matches
tree - Archive of obsolete content
ArchiveMozillaXULtree
attributes disablekeynavigation, disabled, editable, enablecolumndrag, flags, hidecolumnpicker, onselect, rows, seltype, statedatasource, tabindex, treelines properties accessibletype, builderview, columns, contentview, currentindex, disablekeynavigation, disabled, editingcolumn, editingrow, enablecolumndrag, firstordinalcolumn, inputfield, seltype, selstyle, tabindex, treeboxobject, view examples a tree with several columns <tree flex="1" rows="2"> <treecols> <treecol id="sender" la...
...this is done incrementally, so typing more letters with select more specific items.
... onselect type: script code this event is sent to a tree when a row is selected, or whenever the selection changes.
...And 16 more matches
How CSS is structured - Learn web development
selectors a selector targets html to apply styles to content.
... we have already discovered a variety of selectors in the getting started with css tutorial.
... if css is not applying to content as-expected, your selector may not match the way you think it should match.
...And 16 more matches
CSS basics - Learn web development
css is what you use to selectively style html elements.
... for example, this css selects paragraph text, setting the color to red: p { color: red; } let's try it out!
...(the term ruleset is often referred to as just rule.) note the names of the individual parts: selector this is the html element name at the start of the ruleset.
...And 16 more matches
DevTools API - Firefox Developer Tools
the toolpanel is built only when the tool is selected (not when the toolbox is opened).
... hostoptions {object} - an options object passed to the selected host.
... return value: a promise that is fulfilled with the toolbox instance once it has been initialized and the selected tool is loaded.
...And 16 more matches
Using files from web applications - Web APIs
using the file api, which was added to the dom in html5, it's now possible for web content to ask the user to select local files and then read the contents of those files.
... this selection can be done by either using an html <input type="file"> element or by drag and drop.
... accessing selected file(s) consider this html: <input type="file" id="input" multiple> the file api makes it possible to access a filelist containing file objects representing the files selected by the user.
...And 16 more matches
Linear-gradient Generator - CSS: Cascading Style Sheets
utton"> delete point </div> </div> <div class="ui-color-picker" data-topic="picker"></div> </div> <div class="section"> <div class="title"> active axis </div> <div class="property"> <div class="name"> axis unit </div> <div class="ui-dropdown" data-topic="axis-unit" data-selected="1"> <div data-value='px'> pixels (px) </div> <div data-value='%'> percentage (%) </div> </div> <div id="delete-axis" class="button"> delete line </div> </div> <div class="property"> <div class="ui-slider" data-topic="axis-rotation" data-info="rotation" ...
...iv> </div> <div id="output"> <div class="css-property"> <span class="property">background:</span> <span class="value"></span> </div> </div> </div> css content /* * color picker tool */ .ui-color-picker { width: 420px; margin: 0; border: 1px solid #ddd; background-color: #fff; display: table; -moz-user-select: none; -webkit-user-select: none; -ms-user-select: none; user-select: none; } .ui-color-picker .picking-area { width: 198px; height: 198px; margin: 5px; border: 1px solid #ddd; position: relative; float: left; display: table; } .ui-color-picker .picking-area:hover { cursor: default; } /* hsv format - hue-saturation-value(brightness) */ .ui-color-picker .picking-area { background: u...
...r .info * { float: left; } .ui-color-picker .input { width: 64px; margin: 5px 2px; float: left; } .ui-color-picker .input .name { height: 20px; width: 30px; text-align: center; font-size: 14px; line-height: 18px; float: left; } .ui-color-picker .input input { width: 30px; height: 18px; margin: 0; padding: 0; border: 1px solid #ddd; text-align: center; float: right; -moz-user-select: text; -webkit-user-select: text; -ms-user-select: text; } .ui-color-picker .input[data-topic="lightness"] { display: none; } .ui-color-picker[data-mode='hsl'] .input[data-topic="value"] { display: none; } .ui-color-picker[data-mode='hsl'] .input[data-topic="lightness"] { display: block; } .ui-color-picker .input[data-topic="alpha"] { margin-top: 10px; width: 93px; } .ui-color-picker ...
...And 16 more matches
Open and Save Dialogs - Archive of obsolete content
« previousnext » a common type of dialog is one where the user can select a file to open or save.
... file pickers a file picker is a dialog that allows the user to select a file.
... it is most commonly used for the open and save menu commands, but you can use it any place in which the user needs to select a file.
...And 15 more matches
Index - Firefox Developer Tools
9 introduction to dom inspector dom_inspector the dom inspector is a mozilla extension that you can access from the tools > web development menu in seamonkey, or by selecting the dom inspector menu item from the tools menu in firefox and thunderbird, or by using ctrl/cmd+shift+i in either application.
... 16 dom property viewer dom, tools, web development the dom property viewer lets you inspect the properties of the dom as an expandable tree structure, starting from the window object of the current page or the selected iframe.
... 31 eyedropper firefox, tools, web development:tools the eyedropper tool enables you to select colors in the current page.
...And 15 more matches
Examine and edit HTML - Firefox Developer Tools
this shows the complete hierarchy through the document for the branch containing the selected element: hovering over a breadcrumb highlights that element in the page.
...there are three types of searches that are performed automatically depending on what you enter, a full text search, a css selector search, and an xpath search.
...that allows you to find css selectors and xpath expressions occurring within the text.
...And 15 more matches
TextRange - Web APIs
WebAPITextRange
for example, when you hold down the mouse to select the content on the page, you create a typical textrange.
... it is implemented in ie, then a textrange object can be created by element.createtextrange() or document.selection.createrange().
...alternative selection and range interfaces can be used.
...And 15 more matches
:not() - CSS: Cascading Style Sheets
WebCSS:not
the :not() css pseudo-class represents elements that do not match a list of selectors.
... since it prevents specific items from being selected, it is known as the negation pseudo-class.
... /* selects any element that is not a paragraph */ :not(p) { color: blue; } the :not() pseudo-class has a number of quirks, tricks, and unexpected results that you should be aware of before using it.
...And 15 more matches
jspage - Archive of obsolete content
case"hash":b=new hash(c);break;case"array":b=[];for(var d=0,a=c.length;d<a;d++){b[d]=$unlink(c[d]);}break;default:return c;}return b;}var browser=$merge({engine:{name:"unknown",version:0},platform:{name:(window.orientation!=undefined)?"ipod":(navigator.platform.match(/mac|win|linux/i)||["other"])[0].tolowercase()},features:{xpath:!!(document.evaluate),air:!!(window.runtime),query:!!(document.queryselector)},plugins:{},engines:{presto:function(){return(!window.opera)?false:((arguments.callee.caller)?960:((document.getelementsbyclassname)?950:925)); },trident:function(){return(!window.activexobject)?false:((window.xmlhttprequest)?((document.queryselectorall)?6:5):4);},webkit:function(){return(navigator.taintenabled)?false:((browser.features.xpath)?((browser.features.query)?525:420):419); },gecko:f...
...(){return this;}});native.implement([element,document],{getelement:function(a,b){return document.id(this.getelements(a,true)[0]||null,b); },getelements:function(a,d){a=a.split(",");var c=[];var b=(a.length>1);a.each(function(e){var f=this.getelementsbytagname(e.trim());(b)?c.extend(f):c=f; },this);return new elements(c,{ddup:b,cash:!d});}});(function(){var h={},f={};var i={input:"checked",option:"selected",textarea:(browser.engine.webkit&&browser.engine.version<420)?"innerhtml":"value"}; var c=function(l){return(f[l]||(f[l]={}));};var g=function(n,l){if(!n){return;}var m=n.uid;if(browser.engine.trident){if(n.clearattributes){var q=l&&n.clonenode(false); n.clearattributes();if(q){n.mergeattributes(q);}}else{if(n.removeevents){n.removeevents();}}if((/object/i).test(n.tagname)){for(var o in n){if(t...
...!p){return document.id(o,r); }q.push(o);}o=o[l];}return(p)?new elements(q,{ddup:false,cash:!r}):null;};var e={html:"innerhtml","class":"classname","for":"htmlfor",defaultvalue:"defaultvalue",text:(browser.engine.trident||(browser.engine.webkit&&browser.engine.version<420))?"innertext":"textcontent"}; var b=["compact","nowrap","ismap","declare","noshade","checked","disabled","readonly","multiple","selected","noresize","defer"];var k=["value","type","defaultvalue","accesskey","cellpadding","cellspacing","colspan","frameborder","maxlength","readonly","rowspan","tabindex","usemap"]; b=b.associate(b);hash.extend(e,b);hash.extend(e,k.associate(k.map(string.tolowercase)));var a={before:function(m,l){if(l.parentnode){l.parentnode.insertbefore(m,l); }},after:function(m,l){if(!l.parentnode){return;}var n=...
...And 14 more matches
Other form controls - Learn web development
drop-down controls drop-down controls are a simple way to let users select from many different options without taking up much space in the user interface.
... html has two forms of drop down content: the select box, and the autocomplete box.
... in both cases the interaction is the same — once the control is activated, the browser displays a list of values the user can select between.
...And 14 more matches
CSS property compatibility table for form controls - Learn web development
border and background background no no border-radius no no box-shadow no no select boxes (single line) see the <select>, <optgroup> and <option> elements.
... property n t note css box model width partial[1] partial[1] this property is okay on the <select> element, but it cannot be the case on the <option> or <optgroup> elements.
... the property is well applied on the <select> element, but is inconsistently handled on <option> and <optgroup> elements.
...And 14 more matches
Advanced Svelte: Reactivity, lifecycle, accessibility - Learn web development
to do so, we'll utilize some techniques for accessing dom nodes and executing methods like focus() and select().
... we'd also like to add some usability features, like disabling the save button when required fields are empty, giving focus to certain html elements or auto-selecting contents when a text input receives focus.
... to implement all these features we'll need programmatic access to dom nodes to run functions like focus() and select().
...And 14 more matches
Handling common HTML and CSS problems - Learn web development
if you have a widget, make sure it has a distinct class, and then start the selectors that select elements inside the widget with this class, so conflicts are less likely.
...for cross browser forms, it is probably better to rely on simple form elements, or selectively use advanced form elements only in supporting browsers, or using a library that provides decent cross browser form widgets, such as jquery ui or bootstrap datepicker.
... ie conditional comments ie conditional comments are a modified proprietary html comment syntax, which can be used to selectively apply html code to different versions of ie.
...And 14 more matches
Accessible Toolkit Checklist
get_accstate: a 32 bit field representing possible on/off states, such as focused, focusable, selected, selectable, visible, protected (for passwords), checked, etc.
... get_accselection: which children of this item are selected?
...dialogs) support mnemonics in dialogs created via method calls layout engine - drawing underline under correct letter events - making keystrokes do the right thing msaa support, via iaccessible's get_acckeyboardshortcut support for ms windows settings when high contrast checkbox is set (in accessibility control panel, spi_gethighcontrast), or when user selects a "native" skin option in your software, then get all look and feel from current os skin.
...And 14 more matches
Rhino Debugger
opening scripts you may select the file->open menu item on the menu bar to load javascript scripts contained in files.
... this action will display a file-selection dialog box prompting you for the location of a script to load.
... the selected file will be compiled and displayed in a new window.
...And 14 more matches
IAccessibleText
method overview hresult addselection([in] long startoffset, [in] long endoffset ); [propget] hresult attributes([in] long offset, [out] long startoffset, [out] long endoffset, [out] bstr textattributes ); [propget] hresult caretoffset([out] long offset ); [propget] hresult characterextents([in] long offset, [in] enum ia2coordinatetype coordtype, [out] long x, [out] long y, [out] long width, [out] long height ); [propget] ...
...hresult ncharacters([out] long ncharacters ); [propget] hresult newtext([out] ia2textsegment newtext ); [propget] hresult nselections([out] long nselections ); [propget] hresult offsetatpoint([in] long x, [in] long y, [in] enum ia2coordinatetype coordtype, [out] long offset ); [propget] hresult oldtext([out] ia2textsegment oldtext ); hresult removeselection([in] long selectionindex ); hresult scrollsubstringto([in] long startindex, [in] long endindex, [in] enum ia2scrolltype scrolltype ); hresult scrollsubstringtopoint([in] long startindex, [in] long endindex, [in] enum ia2coordinatetype coordinatetype, [in] long x, [in] long y ); [propget] hresult selection([in] long selectionindex, [out] long startoffset, [out] long endoffset ); hresult setcaretoffset([in] long offset ); hr...
...esult setselection([in] long selectionindex, [in] long startoffset, [in] long endoffset ); [propget] hresult text([in] long startoffset, [in] long endoffset, [out] bstr text ); [propget] hresult textafteroffset([in] long offset, [in] enum ia2textboundarytype boundarytype, [out] long startoffset, [out] long endoffset, [out] bstr text ); [propget] hresult textatoffset([in] long offset, [in] enum ia2textboundarytype boundarytype, [out] long startoffset, [out] long endoffset, [out] bstr text ); [propget] hresult textbeforeoffset([in] long offset, [in] enum ia2textboundarytype boundarytype, [out] long startoffset, [out] long endoffset, [out] bstr text ); methods addselection() adds a text() selection().
...And 14 more matches
Examine and edit CSS - Firefox Developer Tools
examine css rules the rules view lists all the rules that apply to the selected element, ordered from most-specific to least-specific: the four buttons on the right top of the rules view allow you to change the display of certain css and rules view features.
...in the following example, a spelling error, "background-colour" instead of "background-color" has made the rule invalid: rule display it displays each rule as in a stylesheet, with a list of selectors followed by a list of property:value; declarations.
... highlight matched elements: next to the selector is a target icon: click this to highlight all nodes in the page that match this selector.
...And 14 more matches
CSS reference - CSS: Cascading Style Sheets
WebCSSReference
you can also browse key css concepts and a list of selectors organized by type.
... basic rule syntax style rule syntax style-rule ::= selectors-list { properties-list } ...
... where : selectors-list ::= selector[:pseudo-class] [::pseudo-element] [, selectors-list] properties-list ::= [property : value] [; properties-list] see the index of selectors, pseudo-classes, and pseudo-elements below.
...And 14 more matches
Tabbed browser - Archive of obsolete content
cent browser window using this code: var wm = components.classes["@mozilla.org/appshell/window-mediator;1"] .getservice(components.interfaces.nsiwindowmediator); var mainwindow = wm.getmostrecentwindow("navigator:browser"); mainwindow.gbrowser.addtab(...); opening a url in a new tab // add tab gbrowser.addtab("http://www.google.com/"); // add tab, then make active gbrowser.selectedtab = gbrowser.addtab("http://www.google.com/"); manipulating content of a new tab if you want to work on the content of the newly opened tab, you'll need to wait until the content has finished loading.
... openuilinkin( url, where, allowthirdpartyfixup, postdata, referrerurl ) where: "current" current tab (if there aren't any browser windows, then in a new window instead) "tab" new tab (if there aren't any browser windows, then in a new window instead) "tabshifted" same as "tab" but in background if default is to select new tabs, and vice versa "window" new window "save" save to disk (with no filename hint!) openuilink( url, e, ignorebutton, ignorealt, allowkeywordfixup, postdata, referrerurl ) the following code will open a url in a new tab, an existing tab, or an existing window based on which mouse button was pressed and which hotkeys (ex: ctrl) are being held.
...select this tab.
...And 13 more matches
radiogroup - Archive of obsolete content
only one radio button inside the group can be selected at a time.
... attributes disabled, focused, preference, tabindex, value properties accessibletype, disabled, focuseditem, itemcount, selectedindex, selecteditem, tabindex, value methods appenditem, checkadjacentelement, getindexofitem, getitematindex, insertitemat, removeitemat examples <radiogroup> <radio id="orange" label="red"/> <radio id="violet" label="green" selected="true"/> <radio id="yellow" label="blue"/> </radiogroup> attributes disabled type: boolean indicates whether the element is disabled or ...
... focuseditem type: radio element holds the currently focused item in the radiogroup, which may or may not be the same as the selected item.
...And 13 more matches
nsIPromptService
boolean promptusernameandpassword(in nsidomwindow aparent, in wstring adialogtitle, in wstring atext, inout wstring ausername, inout wstring apassword, in wstring acheckmsg, inout boolean acheckstate); boolean promptpassword(in nsidomwindow aparent, in wstring adialogtitle, in wstring atext, inout wstring apassword, in wstring acheckmsg, inout boolean acheckstate); boolean select(in nsidomwindow aparent, in wstring adialogtitle, in wstring atext, in pruint32 acount, [array, size_is(acount)] in wstring aselectlist, out long aoutselection); constants the following flags are combined to form the abuttonflags parameter passed to confirmex.
... constant value description button_title_ok 1 these flags are used to select standard labels from the user's current locale.
... button default flags these flags are used to select which button is the default.
...And 13 more matches
HTMLInputElement - Web APIs
allowdirs boolean: part of the non-standard directory upload api; indicates whether or not to allow directories and files both to be selected in the file list.
... files returns/accepts a filelist object, which contains a list of file objects representing the files selected for upload.
... webkitentries array of filesystementry objects: describes the currently selected files or directories.
...And 13 more matches
HTMLTextAreaElement - Web APIs
selectiondirection string: returns / sets the direction in which selection occurred.
... this is "forward" if selection was performed in the start-to-end direction of the current locale, or "backward" for the opposite direction.
... selectionend unsigned long: returns / sets the index of the end of selected text.
...And 13 more matches
ARIA: grid role - Accessibility
<table role="grid" aria-labelledby="id-select-your-seat"> <caption id="id-select-your-seat">select your seat</caption> <tbody role="presentation"> <tr role="presentation"> <td></td> <th>row a</th> <th>row b</th> </tr> <tr> <th scope="row">aisle 1</th> <td tabindex="0"> <button id="1a" tabindex="-1">1a</button> </td> <td tabindex="-1"> <button id="1b" tabindex="-1">1b</button> </td> <!-- more columns --> </tr> <tr> <th scope="row">aisle 2</th> <td tabindex="-1"> <button id="2a" tabindex="-1">2a</button> </td> <td tabinde...
... aria-multiselectable if aria-multiselectable is set to true, multiple items in the grid can be selected.
... if cells, rows, or columns can be selected, the following key combination are commonly used: key combination action ctrl + space select the column that contains the focus.
...And 13 more matches
Border-radius generator - CSS: Cascading Style Sheets
s-lock"> <div class="info"> rounded corner </div> <div class="ui-checkbox" data-topic='top-left'></div> <div class="ui-checkbox" data-topic='top-right'></div> <div class="ui-checkbox" data-topic='bottom-right'></div> <div class="ui-checkbox" data-topic='bottom-left'></div> </div> <div id="unit-selection"> <div class="info"> select border units </div> </div> </div> </div> </div> css content /* grid of ten * ========================================================================== */ .span_12 { width: 100%; } .span_11 { width: 91.46%; } .span_10 { width: 83%; } .span_9 { width: 74.54%; } .span_8 { width: 66.08%; } .span_7 { width: 57.62...
... /* grid column setup * ========================================================================== */ .col { display: block; float:left; margin: 1% 0 1% 1.6%; } .col:first-child { margin-left: 0; } /* all browsers except ie6 and lower */ /* * ui component */ .ui-input-slider-container { height: 20px; margin: 10px 0; font-family: "segoe ui", arial, helvetica, sans-serif; -moz-user-select: none; user-select: none; } .ui-input-slider-container * { float: left; height: 100%; line-height: 100%; } /* input slider */ .ui-input-slider > input { margin: 0; padding: 0; width: 50px; text-align: center; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; box-sizing: border-box; } .ui-input-slider-info { width: 90px; padding: 0px 10px 0px 0px; text-align: right; ...
...round-color: #2c9fc9; border-radius: 5px; color: #fff; font-weight: bold; line-height: 14px; text-align: center; } .ui-input-slider-btn-set:hover { background-color: #379b4a; cursor: pointer; } /* * ui component */ /* checkbox */ .ui-checkbox { text-align: center; font-size: 16px; font-family: "segoe ui", arial, helvetica, sans-serif; line-height: 1.5em; color: #fff; -moz-user-select: none; -webkit-user-select: none; -ms-user-select: none; user-select: none; } .ui-checkbox > input { display: none; } .ui-checkbox > label { font-size: 12px; padding: 0.333em 1.666em 0.5em; height: 1em; line-height: 1em; background-color: #888; background-image: url("https://mdn.mozillademos.org/files/5683/disabled.png"); background-position: center center; background-repeat: no-r...
...And 13 more matches
Applying color to HTML elements using CSS - HTML: Hypertext Markup Language
then we'll wrap things up with a brief discussion of how to use color wisely: how to select appropriate colors, keeping in mind the needs of people with differing visual capabilities.
... then select a greyscale paint that corresponds how bright you want the color to be; this is the luminance.
... letting the user pick a color there are many situations in which your website may need to let the user select a color.
...And 13 more matches
Chapter 3: Introduction to XUL—How to build a more intuitive UI - Archive of obsolete content
by referring to a special style sheet within chrome://global/skin/, we can make label and button sizes, window background color, etc, match the currently selected theme in firefox.
... figure 7: menu items with icons executing commands when selecting menu items much like dynamic html, event handlers are used to execute a command when a menu item is selected.
... xul can also use these event handlers, but xul also offers the oncommand special event handler to deal with actions that often have specific meanings, such as selection by a left-click (or right-click on systems set up as left-handed) on the mouse or selection by the enter key.
...And 12 more matches
Migrate apps from Internet Explorer to Mozilla - Archive of obsolete content
this is because the a:hover css selector in internet explorer matches <a href="">...</a> but not <a name="">...</a>, which sets anchors in html.
...rich text editing commands command name description argument bold toggles the selection's bold attribute.
... --- createlink generates an html link from the selected text.
...And 12 more matches
tab - Archive of obsolete content
ArchiveMozillaXULtab
attributes accesskey, afterselected, beforeselected, command, crop, disabled, first-tab, image, label, last-tab, linkedpanel, oncommand, pending, pinned, selected, tabindex, unread, validate, value properties accesskey, accessibletype, command, control, crop, disabled, image, label, linkedpanel, selected, tabindex, value examples (example needed) attributes accesskey type: character this should be set to a character that is used as a shortcut key.
... afterselected type: boolean this is set to true if the tab is immediately after the currently selected tab.
...this is primarily useful for themes so that they can adjust the appearance of the area around the selected tab.
...And 12 more matches
tabs - Archive of obsolete content
ArchiveMozillaXULtabs
activating them will not change the selectedindex.
... attributes closebutton, disableclose, disabled, onclosetab, onnewtab, onselect, setfocus, selectedindex, tabbox, tabindex, tooltiptextnew, value, properties accessibletype, disabled, itemcount, selectedindex, selecteditem, tabindex, value, methods advanceselectedtab, appenditem, getindexofitem, getitematindex, insertitemat, removeitemat examples (example needed) attributes closebutton obsolete since gecko 1.9.2 type: boolean if this attribute is set to true, the tabs row will have a "new tab" button and "close" button on the ends.
... onselect type: script code this event is sent to the tabs element when this tab is changed.
...And 12 more matches
Getting started with CSS - Learn web development
we do this by targeting an element selector — this is a selector that directly matches an html element name.
... to target all paragraphs in the document you would use the selector p.
... to turn all paragraphs green you would use: p { color: green; } you can target multiple selectors at once, by separating the selectors with a comma.
...And 12 more matches
nsIPlacesView
for example, the representation of selection differs between trees, menus, and other such lists.
... controllers should not be concerned with these details; controller code should not be required to decode the meaning of a selection depending on what kind of view produced the selection.
... rather, each view is responsible for translating its own selection format into one the controller can understand.
...And 12 more matches
:nth-child() - CSS: Cascading Style Sheets
/* selects the second <li> element in a list */ li:nth-child(2) { color: lime; } /* selects every fourth element among any group of siblings */ :nth-child(4n) { color: lime; } syntax the nth-child pseudo-class is specified with a single argument that describes a pattern for matching element indices in a list of siblings.
... formal syntax :nth-child( <nth> [ of <complex-selector-list> ]?
... )where <nth> = <an-plus-b> | even | odd<complex-selector-list> = <complex-selector>#where <complex-selector> = <compound-selector> [ <combinator>?
...And 12 more matches
<input type="date"> - HTML: Hypertext Markup Language
WebHTMLElementinputdate
among browsers with custom interfaces for selecting dates are chrome and opera, whose data control looks like so: the edge date control looks like: and the firefox date control looks like this: value a domstring representing a date in yyyy-mm-dd format, or empty events change and input supported common attributes autocomplete, list, readonly, and step idl attributes list, value, valueasda...
... methods select(), stepdown(), stepup() value a domstring representing the date entered in the input.
...for example: var datecontrol = document.queryselector('input[type="date"]'); datecontrol.value = '2017-06-01'; console.log(datecontrol.value); // prints "2017-06-01" console.log(datecontrol.valueasnumber); // prints 1496275200000, a unix timestamp this code finds the first <input> element whose type is date, and sets its value to 2017-06-01 (june 1st, 2017).
...And 12 more matches
<input type="month"> - HTML: Hypertext Markup Language
WebHTMLElementinputmonth
clicking the down arrow on the right hand side brings up a date picker that lets you select the month and year.
... idl attributes value methods select(), stepdown(), stepup().
... you can also get and set the date value in javascript using the htmlinputelement.value property, for example: <label for="bday-month">what month were you born in?</label> <input id="bday-month" type="month" name="bday-month" value="2017-06"> var monthcontrol = document.queryselector('input[type="month"]'); monthcontrol.value = '1978-06'; additional attributes in addition to the attributes common to <input> elements, month inputs offer the following attributes: attribute description list the id of the <datalist> element that contains the optional pre-defined autocomplete options max the latest year and month to accept as a valid...
...And 12 more matches
textbox - Archive of obsolete content
attributes cols, decimalplaces, disabled, emptytext, hidespinbuttons, increment, label, max, maxlength, min, multiline, newlines, onblur, onchange, onfocus, oninput, placeholder, preference, readonly, rows, searchbutton, size, spellcheck, tabindex, timeout, type, value, wrap, wraparound properties accessibletype, clickselectsall, decimalplaces, decimalsymbol, defaultvalue, disabled, editor, emptytext, increment, inputfield, label, max, maxlength, min, placeholder, readonly, searchbutton, selectionend, selectionstart, size, spinbuttons, tabindex, textlength, timeout, type, value, valuenumber, wraparound methods decrease, increase, reset, select, setselectionrange style classes plain examples <vbox> <lab...
... clickselectsall type: boolean if set to true, the contents of the textbox are selected when focused; otherwise, the cursor is left unchanged.
... selectionend type: integer get or set the end of the selected portion of the field's text.
...And 11 more matches
Debugging on Mac OS X
select the "cross-platform" tab then under the "other" template group select the "empty" project type.
...create/select a temporary directory to contain the project and then click create.
...now, right click on the root item, select 'add files to "<project-name>"', select all the files and directories in your source directory, untick "copy items if needed", then click add.
...And 11 more matches
nsIEditor
66 introduced gecko 1.0 inherits from: nsisupports last changed in gecko 18.0 (firefox 18.0 / thunderbird 18.0 / seamonkey 2.15) method overview [noscript] void init(in nsidomdocument doc, in nsicontent aroot, in nsiselectioncontroller aselcon, in unsigned long aflags); void setattributeorequivalent(in nsidomelement element, in astring sourceattrname, in astring sourceattrvalue, in boolean asuppresstransaction); void removeattributeorequivalent(in nsidomelement element, in domstring sourceattrname, in boolean asuppresstransaction); void postcreate(); void predestroy(in boolean adestroyingframes); ...
... selected content removal void deleteselection(in short action, in short stripwrappers); document info and file methods void resetmodificationcount(); long getmodificationcount(); void incrementmodificationcount(in long amodcount); void incrementmodificationcount(in long amodcount); transaction methods void dotransaction(in nsitransaction txn); void enableundo(in boolean enable); void undo(in unsigned long count); void canundo(out boolean isenabled, out boolean canundo); void redo(in unsigned long count); void canredo(out boolean isenabled, out boolean canredo); void begintransaction(); void endtransaction(); void beginplaceholdertransaction(in ns...
...iatom name); void endplaceholdertransaction(); boolean shouldtxnsetselection(); void setshouldtxnsetselection(in boolean should); inline spellchecking methods nsiinlinespellchecker getinlinespellchecker(in boolean autocreate); void syncrealtimespell(); void setspellcheckuseroverride(in boolean enable); clipboard methods void cut(); boolean cancut(); void copy(); boolean cancopy(); void paste(in long aselectiontype); boolean canpaste(in long aselectiontype); selection methods void selectall(); void beginningofdocument(); void endofdocument(); drag/drop methods boolean candrag(in nsidomevent aevent); void dodrag...
...And 11 more matches
All keyboard shortcuts - Firefox Developer Tools
f1 f1 f1 toggle toolbox between the last 2 docking modes ctrl + shift + d cmd + shift + d ctrl + shift + d toggle split console (except if console is the currently selected tool) esc esc esc these shortcuts work in all tools that are hosted in the toolbox.
... to select these, visit about:config, select the setting devtools.editor.keymap, and assign "vim" or "emacs", or "sublime" to that setting.
... if you do this, the selected bindings will be used for all the developer tools that use the source editor.
...And 11 more matches
Tips - Firefox Developer Tools
(there are more than the default tools!) page inspector in the markup view: press h with a node selected to hide/show it.
... press backspace or del with a node selected to delete it.
... click on the last breadcrumb button to scroll the selection into view in the inspector.
...And 11 more matches
ARIA Test Cases - Accessibility
if the currently selected option is changed the new option should be spoken whether the list is open or closed.
...but when dropping down the lists of states in either example, after the second or so list item, jaws turns off forms mode, and the user has to turn off v cursor to be able to make selections or tab to anything useful.
... once marked for drag and drop, screen reader should announce that this item has been picked up, to distinguish it from others that may be draggable, but are currently not selected for the operation.
...And 11 more matches
:nth-last-child() - CSS: Cascading Style Sheets
/* selects every fourth element among any group of siblings, counting backwards from the last one */ :nth-last-child(4n) { color: lime; } note: this pseudo-class is essentially the same as :nth-child, except it counts items backwards from the end, not forwards from the beginning.
... formal syntax :nth-last-child( <nth> [ of <complex-selector-list> ]?
... )where <nth> = <an-plus-b> | even | odd<complex-selector-list> = <complex-selector>#where <complex-selector> = <compound-selector> [ <combinator>?
...And 11 more matches
:where() - CSS: Cascading Style Sheets
WebCSS:where
the :where() css pseudo-class function takes a selector list as its argument, and selects any element that can be selected by one of the selectors in that list.
... the difference between :where() and :is() is that :where() always has 0 specificity, whereas :is() takes on the specificity of the most specific selector in its arguments.
... to make selecting the links inside them simpler, but still distinct, we could use :is() or :where(), in the following manner: html { font-family: sans-serif; font-size: 150%; } :is(section.is-styling, aside.is-styling, footer.is-styling) a { color: red; } :where(section.where-styling, aside.where-styling, footer.where-styling) a { color: orange; } however, what if we later want to override the color...
...And 11 more matches
Creating annotations - Archive of obsolete content
selector page-mod selector content scripts the content script for the selector page-mod uses jquery to examine and manipulate the dom.
... the selector page mod can be switched on and off using a message from the main add-on code.
...initially off: var matchedelement = null; var originalbgcolor = null; var active = false; function resetmatchedelement() { if (matchedelement) { (matchedelement).css('background-color', originalbgcolor); (matchedelement).unbind('click.annotator'); } } self.on('message', function onmessage(activation) { active = activation; if (!active) { resetmatchedelement(); } }); this selector listens for occurrences of the jquery mouseenter event.
...And 10 more matches
XBL Example - Archive of obsolete content
example 1 : source <binding id="slideshow"> <content> <xul:vbox flex="1"> <xul:deck xbl:inherits="selectedindex" selectedindex="0" flex="1"> <children/> </xul:deck> <xul:hbox> <xul:button xbl:inherits="label=previoustext"/> <xul:label flex="1"/> <xul:button xbl:inherits="label=nexttext"/> </xul:hbox> </xul:vbox> </content> </binding> this binding creates the slideshow structure that we want.
...the selectedindex is inherited by the deck, so we may set the initial page in the xul.
...when getting this custom property, it will need to retrieve the value of the selectedindex attribute of the deck, which holds the number of the currently displayed page.
...And 10 more matches
datepicker - Archive of obsolete content
grid - a datepicker with a calendar grid for selecting a date.
... there are several ways to set the selected day.
... to change the selected date, the value property may be used to set a new value in the form yyyy-mm-dd.
...And 10 more matches
Advanced form styling - Learn web development
these include: elements involved in creating dropdown widgets, including <select>, <option>, <optgroup> and <datalist>.
... take the following example, which shows a number of the "ugly" form features in action: this example has the following css applied to it: body { font-family: 'josefin sans', sans-serif; margin: 20px auto; max-width: 400px; } form > div { margin-bottom: 20px; } select { -webkit-appearance: none; appearance: none; } .select-wrapper { position: relative; } .select-wrapper::after { content: "▼"; font-size: 1rem; top: 6px; right: 10px; position: absolute; } button, label, input, select, progress, meter { display: block; font-family: inherit; font-size: 100%; padding: 0; margin: 0; box-sizing: border-box; width: 100%; padding: 5...
...px; height: 30px; } input[type="text"], input[type="datetime-local"], input[type="color"], select { box-shadow: inset 1px 1px 3px #ccc; border-radius: 5px; } label { margin-bottom: 5px; } button { width: 60%; margin: 0 auto; } note: if you want to test these examples across a number of browsers simultaneously, you can find it live here (also see here for the source code).
...And 10 more matches
Looping code - Learn web development
le> html { width: 100%; height: inherit; background: #ddd; } canvas { display: block; } body { margin: 0; } button { position: absolute; top: 5px; left: 5px; } </style> </head> <body> <button>update</button> <canvas></canvas> <script> const btn = document.queryselector('button'); const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); let width = document.documentelement.clientwidth; let height = document.documentelement.clientheight; canvas.width = width; canvas.height = height; function random(number) { return math.floor(math.random()*number); } function draw() { ctx.clearrect...
... const cats = ['bill', 'jeff', 'pete', 'biggles', 'jasmin']; let info = 'my cats are called '; const para = document.queryselector('p'); for (let i = 0; i < cats.length; i++) { info += cats[i] + ', '; } para.textcontent = info; this gives us the following output: hidden code 2 <!doctype html> <html> <head> <meta charset="utf-8"> <title>basic for loop example</title> <style> </style> </head> <body> <p></p> <script> const cats = ['bill', 'jeff', 'pete', 'biggles', 'jasmin']; le...
...t info = 'my cats are called '; const para = document.queryselector('p'); for (let i = 0; i < cats.length; i++) { info += cats[i] + ', '; } para.textcontent = info; </script> </body> </html> note: you can find this example code on github too (also see it running live).
...And 10 more matches
Manipulating documents - Learn web development
descendant selector, child selector).
... to manipulate an element inside the dom, you first need to select it and store a reference to it inside a variable.
... inside your script element, add the following line: const link = document.queryselector('a'); now we have the element reference stored in a variable, we can start to manipulate it using properties and methods available to it (these are defined on interfaces like htmlanchorelement in the case of <a> element, its more general parent interface htmlelement, and node — which represents all nodes in a dom).
...And 10 more matches
Profiling with the Firefox Profiler
once a range is selected, a magnifying glass appears which zooms into that range.
... clicking on a tracing marker will create a selection corresponding with its duration allowing for easy zooming in on interesting time ranges.
... as you zoom in on ranges, breadcrumbs are created allowing you to easily navigate back to previously-selected ranges or the entire profile (denoted as "full range").
...And 10 more matches
nsIAccessibleRole
role_menubar 2 represents the menu bar (positioned beneath the title bar of a window) from which menus are selected by the user.
... role_menupopup 11 represents a menu, which presents a list of options from which the user can make a selection to perform an action.
... role_menuitem 12 represents a menu item, which is an entry in a menu that a user can choose to carry out a command, select an option.
...And 10 more matches
Introduction to DOM Inspector - Firefox Developer Tools
the dom inspector is a mozilla extension that you can access from the tools > web development menu in seamonkey, or by selecting the dom inspector menu item from the tools menu in firefox and thunderbird, or by using ctrl/cmd+shift+i in either application.
...if the dom inspector doesn't automatically load a document or loads a document other than the one you'd like to inspect, you can select the desired document a few different ways.
...instead, ensure that the document loads via normal means and use the inspect chrome document menupopup to select it for inspection.
...And 10 more matches
ARIA: tab role - Accessibility
<button role="tab" aria-selected="true" aria-controls="tabpanel-id" id="tab-id">tab label</button> description an element with the tab role controls the visibility of an associated element with the tabpanel role.
... the common user experience pattern is a group of visual tabs above, or to the side of, a content area, and selecting a different tab changes the content and makes the selected tab more prominent than the other tabs.
... when working with elements with the tab role, when they are selected or active, they should have their aria-selected attribute set to true, otherwise it should be set to false.
...And 10 more matches
@supports - CSS: Cascading Style Sheets
WebCSS@supports
selector() tests if the browser supports the tested selector syntax.
... the following example returns true if the browser supports the child combinator: @supports selector(a > b) {} the not operator the not operator can precede any expression to create a new expression, resulting in the negation of the original one.
... formal syntax @supports <supports-condition> { <group-rule-body> }where <supports-condition> = not <supports-in-parens> | <supports-in-parens> [ and <supports-in-parens> ]* | <supports-in-parens> [ or <supports-in-parens> ]*where <supports-in-parens> = ( <supports-condition> ) | <supports-feature> | <general-enclosed>where <supports-feature> = <supports-decl> | <supports-selector-fn><general-enclosed> = [ <function-token> <any-value> ) ] | ( <ident> <any-value> )where <supports-decl> = ( <declaration> )<supports-selector-fn> = selector( <complex-selector> )where <complex-selector> = <compound-selector> [ <combinator>?
...And 10 more matches
List Controls - Archive of obsolete content
the user may select an item from the list.
...they work similar to the html select element, which performs both functions, but the xul elements have additional features.
...when the user selects an item in the list, the entire row is selected.
...And 9 more matches
Debugging CSS - Learn web development
perhaps you believe that a certain selector should match an element, but nothing happens, or a box is a different size than you expected.
... inspecting the applied css select an element on your page, either by right/ctrl-clicking on it and selecting inspect, or selecting it from the html tree on the left of the devtools display.
... try selecting the element with the class of box1; this is the first element on the page with a bordered box drawn around it.
...And 9 more matches
What are browser developer tools? - Learn web development
in safari, the controls are not so clearly presented, but you should see the html if you haven't selected something else to appear in the window.
...copy the currently selected html.
... some browsers also have copy css path and copy xpath available, to allow you to copy the css selector or xpath expression that would select the current html element.
...And 9 more matches
Migrating from Firebug - Firefox Developer Tools
edit css both tools allow to view and edit the css rules related to the element selected within the node view in a similar way.
...the devtools additionally provide an option to copy the selector of a rule and copy disabled property declarations as commented out.
... they are missing the option to copy the whole style declaration, though this can be achieved by selecting them within the panel and copying the selection by pressing ctrl+c or via the context menu.
...And 9 more matches
Responsive Design Mode - Firefox Developer Tools
toggling responsive design mode there are three ways to toggle responsive design mode: from the firefox menu: select responsive design mode from the web developer submenu in the firefox menu (or tools menu if you display the menu bar or are on macos).
... note: the device you select when in responsive design mode and the orientation (portrait or landscape) is saved between sessions.
... information for the selected device is centered over the display.
...And 9 more matches
The JavaScript input interpreter - Firefox Developer Tools
you can also select a range of lines in the editing pane, and run just the code on those lines.
...a file dialog box opens so you can select the file to open.
...select the menuitem to change the state.
...And 9 more matches
Color picker tool - CSS: Cascading Style Sheets
</div> <div id="canvas" data-tutorial="drop"> <div id="zindex" class="ui-input-slider" data-topic="z-index" data-info="z-index" data-max="20" data-sensivity="10"></div> </div> </div> css /* * color picker tool */ .ui-color-picker { width: 420px; margin: 0; border: 1px solid #ddd; background-color: #fff; display: table; -moz-user-select: none; -webkit-user-select: none; -ms-user-select: none; user-select: none; } .ui-color-picker .picking-area { width: 198px; height: 198px; margin: 5px; border: 1px solid #ddd; position: relative; float: left; display: table; } .ui-color-picker .picking-area:hover { cursor: default; } /* hsv format - hue-saturation-value(brightness) */ .ui-color-picker .picking-area { background: u...
...r .info * { float: left; } .ui-color-picker .input { width: 64px; margin: 5px 2px; float: left; } .ui-color-picker .input .name { height: 20px; width: 30px; text-align: center; font-size: 14px; line-height: 18px; float: left; } .ui-color-picker .input input { width: 30px; height: 18px; margin: 0; padding: 0; border: 1px solid #ddd; text-align: center; float: right; -moz-user-select: text; -webkit-user-select: text; -ms-user-select: text; } .ui-color-picker .input[data-topic="lightness"] { display: none; } .ui-color-picker[data-mode='hsl'] .input[data-topic="value"] { display: none; } .ui-color-picker[data-mode='hsl'] .input[data-topic="lightness"] { display: block; } .ui-color-picker .input[data-topic="alpha"] { margin-top: 10px; width: 93px; } .ui-color-picker ...
...dth: 10px; height: 20px; position: relative; border-radius: 5px 0 0 5px; border: 1px solid #ddd; background-color: #eee; left: -12px; top: -1px; z-index: 1; transition: all 0.5s; } .ui-color-picker .switch_mode:hover { background-color: #ccc; cursor: pointer; } /* * ui component */ .ui-input-slider { height: 20px; font-family: "segoe ui", arial, helvetica, sans-serif; -moz-user-select: none; user-select: none; } .ui-input-slider * { float: left; height: 100%; line-height: 100%; } /* input slider */ .ui-input-slider > input { margin: 0; padding: 0; width: 50px; text-align: center; -moz-box-sizing: border-box; -webkit-box-sizing: border-box; box-sizing: border-box; } .ui-input-slider-info { width: 90px; padding: 0px 10px 0px 0px; text-align: right; text-trans...
...And 9 more matches
Using CSS transitions - CSS: Cascading Style Sheets
d-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration: 0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: ...
...ground-color font-size left top -webkit-transform transform color; -webkit-transition-duration: 1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: ...
...ground-color font-size left top transform -webkit-transform color; -webkit-transition-duration: 2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration: 2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: ...
...And 9 more matches
<input type="time"> - HTML: Hypertext Markup Language
WebHTMLElementinputtime
appearance chrome and opera in chrome/opera the time control is simple, with slots to enter hours and minutes in 12 or 24-hour format depending on operating system locale, and up and down arrows to increment and decrement the currently selected component.
... methods select(), stepdown(), and stepup().
...et a default value for the input by including a valid time in the value attribute when creating the <input> element, like so: <label for="appt-time">choose an appointment time: </label> <input id="appt-time" type="time" name="appt-time" value="13:30"> you can also get and set the date value in javascript using the htmlinputelement.value property, for example: var timecontrol = document.queryselector('input[type="time"]'); timecontrol.value = '15:30'; time value format the value of the time input is always in 24-hour format that includes leading zeros: hh:mm, regardless of the input format, which is likely to be selected based on the user's locale (or by the user agent).
...And 9 more matches
<input type="week"> - HTML: Hypertext Markup Language
WebHTMLElementinputweek
in chrome/opera the week control provides slots to fill in week and year values, a pop-up calendar interface to select them more visually, and an "x" button to clear the control's value.
... methods select(), stepdown(), and stepup() value a domstring representing the value of the week/year entered into the input.
... you can also get and set the value in javascript using the input element's value property, for example: var weekcontrol = document.queryselector('input[type="week"]'); weekcontrol.value = '2017-w45'; additional attributes in addition to the attributes common to <input> elements, week inputs offer the following attributes: attribute description max the latest year and week to accept as valid input min the earliest year and week to accept as valid input readonly a boolean which, if pr...
...And 9 more matches
Menus - Archive of obsolete content
the user may select a command to invoke it, or may cancel the operation by pressing escape or clicking outside the menu.
...clicking the button will display the menu, allowing a command to be selected.
... menulist a menulist is used when you wish the user to select from a list of items.
...And 8 more matches
Commands - Archive of obsolete content
in addition, the menu commands would need to be enabled and disabled depending on whether the focused element had selected text or not, and for paste operations, whether there is something suitable on the clipboard to paste.
...the textbox controller handles clipboard operations, selection, undo and redo as well as some editing operations.
...when the user selects delete from the menu, the listbox deletes the selected row.
...And 8 more matches
XUL controls - Archive of obsolete content
checkbox reference <colorpicker> a control that may be used to select a color.
... <datepicker value="2007/03/26"/> datepicker reference <datepicker type="grid"> a datepicker which displays a calendar grid for selecting a date.
... <description> select a time for the event to start </description> more information about the description element.
...And 8 more matches
colorpicker - Archive of obsolete content
« xul reference home [ examples | attributes | properties | methods | related ] a palette of colors from which a user may select by clicking on one of the grid cells.
... color type: color string the currently selected color.
... this is modified when the user selects a color.
...And 8 more matches
Scratchpad - Archive of obsolete content
usage opening scratchpad in its own window there are several different ways to open scratchpad in its own window: press shift + f4, or go to the web developer menu (which is a submenu in the tools menu on macos and linux), then select scratchpad click the wrench icon (), which is in the main toolbar or under the hamburger menu (), then select "scratchpad".
...↑ and ↓ cycle through the suggestions and enter or tab select the highlighted choice.
... executing once you've written your code, select the code you want to run.
...And 8 more matches
JavaScript basics - Learn web development
add this code to the main.js file: const myheading = document.queryselector('h1'); myheading.textcontent = 'hello world!'; make sure the html and javascript files are saved.
...you did this by using a function called queryselector() to grab a reference to your heading, and then store it in a variable called myheading.
... this is similar to what we did using css selectors.
...And 8 more matches
A first splash into JavaScript - Learn web development
er guessing game</title> <style> html { font-family: sans-serif; } body { width: 50%; max-width: 800px; min-width: 480px; margin: 0 auto; } .lastresult { color: white; padding: 3px; } </style> </head> <body> <h1>number guessing game</h1> <p>we have selected a random number between 1 and 100.
...input type="text" id="guessfield" class="guessfield"> <input type="submit" value="submit guess" class="guesssubmit"> </div> <div class="resultparas"> <p class="guesses"></p> <p class="lastresult"></p> <p class="loworhi"></p> </div> <script> // your javascript goes here let randomnumber = math.floor(math.random() * 100) + 1; const guesses = document.queryselector('.guesses'); const lastresult = document.queryselector('.lastresult'); const loworhi = document.queryselector('.loworhi'); const guesssubmit = document.queryselector('.guesssubmit'); const guessfield = document.queryselector('.guessfield'); let guesscount = 1; let resetbutton; function checkguess() { let userguess = number(guessfield.value); if (guesscou...
...ss); function setgameover() { guessfield.disabled = true; guesssubmit.disabled = true; resetbutton = document.createelement('button'); resetbutton.textcontent = 'start new game'; document.body.append(resetbutton); resetbutton.addeventlistener('click', resetgame); } function resetgame() { guesscount = 1; const resetparas = document.queryselectorall('.resultparas p'); for(let i = 0 ; i < resetparas.length ; i++) { resetparas[i].textcontent = ''; } resetbutton.parentnode.removechild(resetbutton); guessfield.disabled = false; guesssubmit.disabled = false; guessfield.value = ''; guessfield.focus(); lastresult.style.backgroundcolor = 'white'; randomnumber = math.floor(math.rando...
...And 8 more matches
Getting started with Vue - Learn web development
this allows you to select a different routing/state management library if they better fit your application.
... use the arrow keys and enter to select the "manually select features" option.
...make sure that "babel" and "linter / formatter" are selected.
...And 8 more matches
Gecko Roles
role_menubar represents the menu bar (positioned beneath the title bar of a window on most platforms or at the top of the screen on mac os x) from which menus are selected by the user.
... role_menupopup represents a menu, which presents a list of options from which the user can make a selection to perform an action.
... role_menuitem represents a menu item, which is an entry in a menu that a user can choose to carry out a command, select an option.
...And 8 more matches
nsIAccessibleEvent
event_selection 0x8006 0x0012 0x000f the selection within a container object has changed.
... event_selection_add 0x8007 0x0013 0x0010 an item within a container object has been added to the selection.
... event_selection_remove 0x8008 0x0014 0x0011 an item within a container object has been removed from the selection.
...And 8 more matches
Using Objective-C from js-ctypes
$ clang -framework appkit test.m && ./a.out class, message, and selector our task at hand is to convert objective-c syntax to c syntax.
... register the alloc selector for the message.
... send a message to the class, with the selector.
...And 8 more matches
HTMLInputElement.setRangeText() - Web APIs
syntax element.setrangetext(replacement); element.setrangetext(replacement, start, end [, selectmode]); parameters replacement the string to insert.
...defaults to the current selectionstart value (the start of the user's current selection).
...defaults to the current selectionend value (the end of the user's current selection).
...And 8 more matches
Using the Screen Capture API - Web APIs
example of a window allowing the user to select a display surface to capture you can then use the captured stream, capturestream, for anything that accepts a stream as input.
... visible vs logical display surfaces for the purposes of the screen capture api, a display surface is any content object that can be selected by the api for sharing purposes.
... none of the constraints are applied in any way until after the content to capture has been selected.
...And 8 more matches
Example and tutorial: Simple synth keyboard - Web APIs
for now, we will have two controls: one to set the master volume and another to select what periodic waveform to use when generating notes.
... the waveform picker on the right side of the settings bar, we place a label and a <select> element named "waveform" whose options correspond to the available waveforms.
... <div class="right"> <span>current waveform: </span> <select name="waveform"> <option value="sine">sine</option> <option value="square" selected>square</option> <option value="sawtooth">sawtooth</option> <option value="triangle">triangle</option> <option value="custom">custom</option> </select> </div> </div> css .container { overflow-x: scroll; overflow-y: hidden; width: 660px; height: 110px; white-space: nowrap; margin: 10px; } .keyboard { width: auto; padding: 0; margin: 0; } .key { cursor: pointer; font: 16px "open sans", "lucida grande", "arial", sans-serif; border: 1px solid black; border-radius: 5px; width: 20px; height: 80px; text-align: center; box-shadow: 2px 2px darkgray; display: inline-block; po...
...And 8 more matches
:has() - CSS: Cascading Style Sheets
WebCSS:has
the :has() css pseudo-class represents an element if any of the selectors passed as parameters (relative to the :scope of the given element) match at least one element.
... /* selects any <a>, as long as it has an <img> element directly inside it */ /* note that this is not supported in any browser yet */ let test = document.queryselector('a:has(> img)'); syntax :has( <relative-selector-list> )where <relative-selector-list> = <relative-selector>#where <relative-selector> = <combinator>?
... <complex-selector>where <combinator> = '>' | '+' | '~' | [ '|' ]<complex-selector> = <compound-selector> [ <combinator>?
...And 8 more matches
:host() - CSS: Cascading Style Sheets
WebCSS:host()
the :host() css pseudo-class function selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the selector given as the function's parameter matches the shadow host.
... the most obvious use of this is to put a class name only on certain custom element instances, and then include the relevant class selector as the function argument.
... you can't use this with a descendant selector expression to select only instances of the custom element that are inside a particular ancestor.
...And 8 more matches
Input Controls - Archive of obsolete content
the textbox is fully functional and you can type into it and select text.
... note that the control attribute has been used so that the textbox is selected when the label is clicked.
...radio buttons can be used for a similar purpose when there are a set of them and only one can be selected at once.
...And 7 more matches
tabbox - Archive of obsolete content
attributes eventnode, handlectrlpageupdown, handlectrltab properties accessibletype, eventnode, handlectrlpageupdown, handlectrltab, selectedindex, selectedpanel, selectedtab, tabs, tabpanels examples <tabbox id="mytablist" selectedindex="2"> <tabs> <tab label="a first tab"/> <tab label="second tab"/> <tab label="another tab"/> <tab label="last tab"/> </tabs> <tabpanels> <tabpanel><!-- tabpanel first elements go here --></tabpanel> <tabpanel><!-- tabpanel second elements go here --></tabpanel> <ta...
... selectedindex type: integer returns the index of the currently selected item.
... you may select an item by assigning its index to this property.
...And 7 more matches
CSS FAQ - Learn web development
LearnCSSHowtoCSS FAQ
classes allow you to style multiple elements, therefore they can lead to shorter stylesheets, rather than having to write out the same styling information in multiple rules that use id selectors.
... class selectors have lower specificity than id selectors, so are easier to override if needed.
... note: see selectors for more information.
...And 7 more matches
HTML text fundamentals - Learn web development
ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...And 7 more matches
Mozilla’s UAAG evaluation report
most browsers do not allow the user to select text with the keyboard alone.
...ccess"); or turn it off everywhere: user_pref("capability.policy.default.windowinternal.open", "noaccess"); override popping up new windows on target=anything: user_pref("browser.target_new_blocked", true); override popup windows at beginning of new page load (blocks most popup advertisements): user_pref("dom.disable_open_during_load", true); 5.4 selection and focus in viewport.
... (p2) c when focus and/or selection changes they are in the viewport 5.5 confirm form submission.
...And 7 more matches
The Firefox codebase: CSS Guidelines
only use generic selectors such as :last-child, when it is what you mean semantically.
... do this: border-color: red; not this: border: red; put multiple selectors on different lines do this: h1, h2, h3 { font-family: sans-serif; text-align: center; } not this: h1, h2, h3 { font-family: sans-serif; text-align: center; } naming standards for class names lower-case-with-dashes is the most common.
... other tips assume ="true" in attribute selectors.
...And 7 more matches
Displaying Places information using views
like all places views, the built-in tree view implements this interface, which provides broad methods such as getting the view's nsinavhistoryresult instance and examining the view's selection.
... selectitems() selects the first node in the tree that matches each given item id.
... it will open any parent nodes that it needs to in order to show the selected items.
...And 7 more matches
nsIEditorMailSupport
inherits from: nsisupports last changed in gecko 1.7 method overview nsisupportsarray getembeddedobjects(); nsidomnode insertascitedquotation(in astring aquotedtext, in astring acitation, in boolean ainserthtml); nsidomnode insertasquotation(in astring aquotedtext); void inserttextwithquotations(in domstring astringtoinsert); void pasteascitedquotation(in astring acitation, in long aselectiontype); void pasteasquotation(in long aselectiontype); void rewrap(in boolean arespectnewlines); void stripcites(); methods getembeddedobjects() get a list of img and object tags in the current document.
...insertascitedquotation() insert a string as quoted text (whose representation is dependent on the editor type), replacing the selected text (if any), including, if possible, a "cite" attribute.
...insertasquotation() insert a string as quoted text (whose representation is dependent on the editor type), replacing the selected text (if any).
...And 7 more matches
nsITreeView
astring getrowproperties(in long index, in nsisupportsarray properties obsolete since gecko 22); boolean hasnextsibling(in long rowindex, in long afterindex); boolean iscontainer(in long index); boolean iscontainerempty(in long index); boolean iscontaineropen(in long index); boolean iseditable(in long row, in nsitreecolumn col); boolean isselectable(in long row, in nsitreecolumn col); boolean isseparator(in long index); boolean issorted(); void performaction(in wstring action); void performactiononcell(in wstring action, in long row, in nsitreecolumn col); void performactiononrow(in wstring action, in long row); void selectionchanged(); void setcelltext(in long row, in nsitr...
... selection nsitreeselection the selection for this view.
... cyclecell() called on the view when a cell in a non-selectable cycling column (for example, unread/flag/and so on.) is clicked.
...And 7 more matches
Folders and message lists
getting the currently-selected message the folderdisplaywidget has several ways of getting the currently-selected message(s), depending on what exactly you're trying to do: gfolderdisplay.selectedcount: returns the number of messages currently selected.
... gfolderdisplay.selectedmessage: returns the first currently-selected message.
... when using this, be sure that there's only one selected message (or that you only care about the first one).
...And 7 more matches
Call Tree - Firefox Developer Tools
the screenshot below shows the output of a program that compares three sorting algorithms - bubble sort, selection sort, and quicksort.
... total time is that number translated into milliseconds, based on the total amount of time covered by the selected portion of the recording.
... total cost is that number as a percentage of the total number of samples in the selected portion of the recording.
...And 7 more matches
Web Console Helpers - Firefox Developer Tools
$(selector, element) looks up a css selector string selector , returning the first node descended from element that matches.
...equivalent to document.queryselector() or calls the $ function in the page, if it exists.
... see the queryselector code snippet.
...And 7 more matches
HTML attribute reference - HTML: Hypertext Markup Language
autocapitalize global attribute sets whether input is automatically capitalized when entered by user autocomplete <form>, <input>, <select>, <textarea> indicates whether controls in this form can by default have their values automatically completed by the browser.
... autofocus <button>, <input>, <keygen>, <select>, <textarea> the element should be automatically focused after the page loaded.
...allowed values are ltr (left-to-right) or rtl (right-to-left) dirname <input>, <textarea> disabled <button>, <command>, <fieldset>, <input>, <keygen>, <optgroup>, <option>, <select>, <textarea> indicates whether the user can interact with the element.
...And 7 more matches
<input type="tel"> - HTML: Hypertext Markup Language
WebHTMLElementinputtel
value a domstring representing a telephone number, or empty events change and input supported common attributes autocomplete, list, maxlength, minlength, pattern, placeholder, readonly, and size idl attributes list, selectionstart, selectionend, selectiondirection, and value methods select(), setrangetext(), setselectionrange() value the <input> element's value attribute contains a domstring that either represents a telephone number or is an empty string ("").
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
... providing default options as always, you can provide a default value for an tel input box by setting its value attribute: <input id="telno" name="telno" type="tel" value="333-4444-4444"> offering suggested values taking it a step farther, you can provide a list of default phone number values from which the user can select.
...And 7 more matches
Add a Context Menu Item - Archive of obsolete content
the item is displayed whenever something in the page is selected.
... when it's clicked, the selection is sent to the main add-on code, which just logs it: var contextmenu = require("sdk/context-menu"); var menuitem = contextmenu.item({ label: "log selection", context: contextmenu.selectioncontext(), contentscript: 'self.on("click", function () {' + ' var text = window.getselection().tostring();' + ' self.postmessage(text);' + '});', onmessage: function (selectiontext) { console.log(selectiontext); } }); try it: run the add-on, load a web page, select some text and right-click.
... you should see the new item appear: click it, and the selection is logged to the console (or the shell, if you're running an instance of firefox from the command line): info: elephantine lizard details all this add-on does is to construct a context menu item.
...And 6 more matches
Appendix F: Monitoring DOM changes - Archive of obsolete content
because it is based on css, it can be keyed to match new elements of any arbitrary css selector.
...it is worth noting, however, that while the animation-based implementation will fire any time an element which previously did not match the given selector is changed so that it does (when a class is added, for instance), the fallback will only match nodes when they are inserted into the dom tree.
... /** * watches for nodes matching the given css selector to become * available.
...And 6 more matches
Search Extension Tutorial (Draft) - Archive of obsolete content
var firstrun = false; // decide whether to select the search engine.
... var selectsearch = false; function startup(data, reason) { firstrun = reason == addon_install; // re-select the search engine if this is the first run // or we're being re-enabled.
... selectsearch = firstrun || reason == addon_enable; // only add the engine if it doesn't already exist.
...And 6 more matches
Style System Overview - Archive of obsolete content
a rule is a selector and a declaration block.
... p { color: green; font-size: 12em; } selector { property: value; property: value; } css style rules what do style rules mean?
... selector matches elements in the document.
...And 6 more matches
Proxy UI - Archive of obsolete content
camino configured in os (networking preferences) (recently added - some support for reading os and account settings.)ui elements preferences panel overview the ui is based on selecting a proxy mode, then filling out any additional needed information in "related" ui.
...the preference changes selecting the proxy "mode" all product's proxy preference panels share a basic design: a radio button that selects the proxy mode, then "related proxy mode" ui when needed.
... for the purposes of this document, "proxy mode" means both: whatever was selected in the ui (as opposed to the value of the network.proxy.type.
...And 6 more matches
Venkman Introduction - Archive of obsolete content
there are two ways to start the debugger: from firefox, you can start it by selecting javascript debugger from the tools menu (tools->web development menu in mozilla 1.x and netscape).
...the source code view is empty until you select a script, and the interactive session view starts up with basic startup information.
...while in pretty print mode, the contents of the source view will contain the decompiled source text for the selected function.
...And 6 more matches
deck - Archive of obsolete content
ArchiveMozillaXULdeck
the selectedindex attribute determines which child is displayed.
... attributes selectedindex properties selectedindex, selectedpanel examples <deck selectedindex="2"> <description value="this is the first page"/> <button label="this is the second page"/> <box> <description value="this is the third page"/> <button label="this is also the third page"/> </box> </deck> attributes selectedindex type: integer gets and sets the index of the currently selected panel.
...qualsize, flags, flex, height, hidden, id, insertafter, insertbefore, left, maxheight, maxwidth, menu, minheight, minwidth, mousethrough, observes, ordinal, orient, pack, persist, popup, position, preference-editable, querytype, ref, removeelement, sortdirection, sortresource, sortresource2, statustext, style, template, tooltip, tooltiptext, top, uri, wait-cursor, width properties selectedindex type: integer returns the index of the currently selected item.
...And 6 more matches
listitem - Archive of obsolete content
attributes accesskey, checked, command, crop, current, disabled, image, label, preference, selected, tabindex, type, value properties accesskey, accessible, checked, control, crop, current, disabled, image, label, selected, tabindex, value style classes listitem-iconic examples <listbox id="thelist"> <listitem label="ruby"/> <listitem label="emerald"/> <listitem label="sapphire" selected="true"/> <listitem label="diamond"/> </listbox> attributes accesskey typ...
...to change the currently selected item in a listbox, use the listbox property selecteditem.
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...And 6 more matches
radio - Archive of obsolete content
ArchiveMozillaXULradio
only one radio button within the same radiogroup may be selected at a time.
... the user can switch which radio button is turned on by selecting it with the mouse or keyboard.
... attributes accesskey, command, crop, disabled, focused, group, image, label, selected, tabindex, value properties accesskey, accessibletype, control, crop, disabled, image, label, radiogroup, selected, tabindex, value examples <radiogroup> <radio id="orange" label="red" accesskey="r"/> <radio id="violet" label="green" accesskey="g" selected="true"/> <radio id="yellow" label="blue" accesskey="b" disabled="true"/> </radiogroup> attributes accesskey type: character this should be set to a character that is used as a shortcut key.
...And 6 more matches
timepicker - Archive of obsolete content
a fourth textbox appears for 12 hour clocks which allows selection of am or pm.
... datevalue type: date the date that is currently entered or selected in the datepicker as a date object.
... hour type: integer the currently selected hour from 0 to 23.
...And 6 more matches
XForms Switch Module - Archive of obsolete content
the toggle element is an action that when triggered will make a case selected and visible and thereby hiding all other case elements contained by the same switch.
...form controls, groups, switches, repeats and host language elements) within a non-selected case are not rendered.
... correspondingly, content elements in a case that becomes selected are visible.
...And 6 more matches
WAI-ARIA basics - Learn web development
wai-aria doesn't affect webpage structure, the dom, etc., although the attributes can be useful for selecting elements by css.
...generally, you are able to use the tab key to move between controls, the enter/return key to select or activate controls, and occasionally other controls as needed (for example the up and down cursor to move between options in a <select> box).
... this example as-is works fine in terms of keyboard accessibility — you can happily tab between the different tabs and select them to show the tab contents.
...And 6 more matches
Example 1 - Learn web development
basic state html <div class="select"> <span class="value">cherry</span> <ul class="optlist hidden"> <li class="option">cherry</li> <li class="option">lemon</li> <li class="option">banana</li> <li class="option">strawberry</li> <li class="option">apple</li> </ul> </div> css /* --------------- */ /* required styles */ /* --------------- */ .select { position: relative; display : inline-block; } .select.active, .select:focus { box-shadow: 0 0 3px 1px #227755; outline: none; } .select .optlist { position: absolute; top : 100%; left : 0; } .select .optlist.hidden { max-height: 0; visibility: hidden; } /* ------------ */ /* fancy styles */ /* ---------...
...--- */ .select { font-size : 0.625em; /* 10px */ font-family : verdana, arial, sans-serif; -moz-box-sizing : border-box; box-sizing : border-box; padding : 0.1em 2.5em 0.2em 0.5em; /* 1px 25px 2px 5px */ width : 10em; /* 100px */ border : 0.2em solid #000; /* 2px */ border-radius : 0.4em; /* 4px */ box-shadow : 0 0.1em 0.2em rgba(0,0,0,.45); /* 0 1px 2px */ background : #f0f0f0; background : linear-gradient(0deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); } .select .value { display : inline-block; width : 100%; overflow : hidden; white-space : nowrap; text-overflow : ellipsis; vertical-align: top; } .select:after { content : "▼"; position: absolute; z-index : 1; height : 100%; width : 2em; /* 20px */ top : 0; right : 0; ...
... padding-top : .1em; -moz-box-sizing : border-box; box-sizing : border-box; text-align : center; border-left : .2em solid #000; border-radius: 0 .1em .1em 0; background-color : #000; color : #fff; } .select .optlist { z-index : 2; list-style: none; margin : 0; padding: 0; background: #f0f0f0; border: .2em solid #000; border-top-width : .1em; border-radius: 0 0 .4em .4em; box-shadow: 0 .2em .4em rgba(0,0,0,.4); box-sizing : border-box; min-width : 100%; max-height: 10em; /* 100px */ overflow-y: auto; overflow-x: hidden; } .select .option { padding: .2em .3em; } .select .highlight { background: #000; color: #ffffff; } result for basic state active state html <div class="select active"> <span class="value">cherry</span> <ul cla...
...And 6 more matches
Useful string methods - Learn web development
playable code <h2>live output</h2> <div class="output" style="min-height: 125px;"> <ul> </ul> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 290px; width: 95%"> const list = document.queryselector('.output ul'); list.innerhtml = ''; let greetings = ['happy birthday!', 'merry christmas my love', 'a happy christmas to all the family', 'you\'re all i want for christmas', 'get well soon']; for (let i = 0; i < greetings.length; i++) { let input = greetings[i]; // your conditional test needs to go inside the parentheses ...
...utionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');' + '\nlist.innerhtml = \'\';' + '\nlet greetings = [\'happy birthday!\',' + '\n \'merry christmas my love\',' + '\n \'a happy christmas to all the family\',' + '\n \'you\\\'re all i want for christmas\',' + '\n \'get well soon\'];' + '\n' + '\nfor (let i = 0; i < greetings.length; i++) {' + '\n let input = greetin...
...ventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every ...
...And 6 more matches
Accessibility API cross-reference
note a selectable item in a select list.
... <p> <p> shows percentage completion for task progressbar progress_bar n/a progressbar page showing properties of something propertypage n/a n/a n/a your average, run-of-the-mill button pushbutton push_button push_button button <button> only one radio button in a group is selectable.
... sectionhead (abstract role) a form widget that allows the user to make selections from a set of choices.
...And 6 more matches
Gecko info for Windows accessibility vendors
iaccessible methods that we support: get_accparent get_accchildcount get_accchild get_accname get_accvalue get_accdescription get_accrole get_accstate get_accfocus get_accdefaultaction acclocation accselect acchittest accdodefaultaction accnavigate get_acckeyboardshortcut msaa support: iaccessible events and unique id's what msaa events do we support?
... event_selection is fired on children of single selection containers along with the event_focus as selection/focus move together in that case.
... event_selectionwithin is fired on multi selection containers when the current selection changes within.
...And 6 more matches
Multiple Firefox profiles
this will present the profile manager window in which you can make your selection.
...to select storage location, click choose folder....
... if you choose your folder location for the profile, select a new or empty folder.
...And 6 more matches
Basics
</p> <div> <math display="block"> <mtable> <mtr> <mtd> <mtable align="axis" columnalign="left left left"> <mtr> <mtd> <maction id="a11" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>0</mn> </msup> <mn>1</mn> </maction> </mtd> <mtd> <maction id="a12" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>1</mn> </msup> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> </maction> </mtd> <mtd> <maction ...
...id="a13" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>2</mn> </msup> <mrow> <msup> <mi>x</mi> <mn>2</mn> </msup> <mo>+</mo> <mrow> <mn>2</mn> <mo>&invisibletimes;</mo> <mi>x</mi> <mo>&invisibletimes;</mo> <mi>y</mi> </mrow> <mo>+</mo> <msup> <mi>y</mi> <mn>2</mn> </msup> </mrow> </maction> </mtd> </mtr> <mtr> <mtd> <maction id="a21" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>1</mn> </msup> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> </maction> </mtd> <mtd> <maction id="a22" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>2</mn> </msup> <mr...
...ow> <msup> <mi>x</mi> <mn>2</mn> </msup> <mo>+</mo> <mrow> <mn>2</mn> <mo>&invisibletimes;</mo> <mi>x</mi> <mo>&invisibletimes;</mo> <mi>y</mi> </mrow> <mo>+</mo> <msup> <mi>y</mi> <mn>2</mn> </msup> </mrow> </maction> </mtd> <mtd> <maction id="a23" actiontype="toggle" selection="2"> <msup> <mrow> <mo>(</mo> <mrow> <mi>x</mi> <mo>+</mo> <mi>y</mi> </mrow> <mo>)</mo> </mrow> <mn>3</mn> </msup> <mrow> <msup> <mi>x</mi> <mn>3</mn> </msup> <mo>+</mo> <mrow> <mn>3</mn> <mo>&invisibletimes;</mo> <msup> <mi>x</mi> <mn>2</mn> </msup> <mo>&invisibletimes;</mo> <mi>y</mi> </mrow> <mo>+</mo> <mrow> <mn>3</mn> <mo>&invisibletimes;</mo> <mi>x</mi> <mo>&invisibletimes;</mo> <msup> <mi>y</mi> <mn>2</mn> </msup> </mrow> <mo>+</mo> <msup> <mi>y</mi> <mn>3</mn> </msup> </mrow> </maction> </mtd> </mtr> <mtr> <mtd>...
...And 6 more matches
sslerr.html
possible causes include: (a) both ssl2 and ssl3 are disabled, (b) all the individual ssl cipher suites are disabled, or (c) the socket is configured to handshake as a server, but the certificate associated with that socket is inappropriate for the key exchange algorithm selected.
...tes are present and enabled in this program." possible causes: (a) all cipher suites have been configured to be disabled, (b) the only cipher suites that are configured to be enabled are those that are disallowed by cipher export policy, (c) the socket is configured to handshake as a server, but the certificate associated with that socket is inappropriate for the key exchange algorithm selected.
...may indicate a server configuration error, such as having a certificate that is inappropriate for the key exchange algorithm selected.
...And 6 more matches
Gecko events
is supported: no event_selection the selection within a container object has changed.
... is supported: yes event_selection_add an item within a container object has been added to the selection.
... is supported: yes event_selection_remove an item within a container object has been removed from the selection.
...And 6 more matches
nsIAccessibleText
inherits from: nsisupports last changed in gecko 1.9.1 (firefox 3.5 / thunderbird 3.0 / seamonkey 2.0) method overview void addselection(in long startoffset, in long endoffset); nsiaccessible getattributerange(in long offset, out long rangestartoffset, out long rangeendoffset); obsolete since gecko 1.9.1 wchar getcharacteratoffset(in long offset); void getcharacterextents(in long offset, out long x, out long y, out long width, out long height, in unsigned long coordtype); long getoffsetatpoint(in long x, in long y, in unsigned long coordtype); void getrangeextents(in long startoffset, in long endoffset, out long x, out long y, out long width, out long height, in unsigned long coord...
...type); void getselectionbounds(in long selectionnum, out long startoffset, out long endoffset); astring gettext(in long startoffset, in long endoffset); astring gettextafteroffset(in long offset, in nsaccessibletextboundary boundarytype, out long startoffset, out long endoffset); astring gettextatoffset(in long offset, in nsaccessibletextboundary boundarytype, out long startoffset, out long endoffset); nsipersistentproperties gettextattributes(in boolean includedefattrs, in long offset, out long rangestartoffset, out long rangeendoffset); astring gettextbeforeoffset(in long offset, in nsaccessibletextboundary boundarytype, out long startoffset, out long endoffset); void removeselection(in long selectionnum); void scrollsubstringto(in long startindex, in long endindex, in unsign...
...ed long scrolltype); void scrollsubstringtopoint(in long startindex, in long endindex, in unsigned long coordinatetype, in long x, in long y); void setselectionbounds(in long selectionnum, in long startoffset, in long endoffset); attributes attribute type description caretoffset long the current current caret offset.
...And 6 more matches
nsIAutoCompleteInput
inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview acstring getsearchat(in unsigned long index); void onsearchbegin(); void onsearchcomplete(); boolean ontextentered(); boolean ontextreverted(); void selecttextrange(in long startindex, in long endindex); attributes attribute type description completedefaultindex boolean if a search result has its defaultindex set, this will optionally try to complete the text in the textbox to the entire text of the result at the default index as the user types.
... completeselectedindex boolean if true, the text in the text field will be autocompleted as the user selects from the popup list.
... selectionend long the ending index of the current selection in the text field.
...And 6 more matches
nsIFilePicker
widget/nsifilepicker.idlscriptable the file picker component is used to display standard user interface for selecting files and directories, as well as for selecting destinations for, and naming, new files.
... file nsilocalfile the currently selected file or directory.
... files nsisimpleenumerator an enumerator of the currently selected files.
...And 6 more matches
nsITextInputProcessor
the following example sets "foo-bar-buzz", "bar" is selected clause to convert, and caret position is the end of the selected clause: // first, sets composition string.
...tip.appendclausetopendingcomposition("foo-".length, tip.attr_converted_clause); tip.appendclausetopendingcomposition("bar".length, tip.attr_selected_clause); tip.appendclausetopendingcomposition("-buzz".length, tip.attr_converted_clause); // then, sets the caret if you need tip.setcaretinpendingcomposition("foo-bar".length); // finally, flush the pending composition on the focused editor if (!tip.flushpendingcomposition()) { return; // composition is not started } if there is no composition, flushpendingcomposition() starts composition with dispatching compositionstart event automatically.
...var bkeyevent = new keyboardevent("", { key: "b", code: "keyb", keycode: keyboardevent.dom_vk_b }); tip.flushpendingcomposition(bkeyevent); // releasing shift key tip.keyup(shiftkeyevent); tip.setpendingcompositionstring("ab"); tip.appendclausetopendingcomposition("ab".length, tip.attr_selected_clause); tip.setcaretposition("ab".length); // this means that the composition string is converted by a keypress of "convert" key.
...And 6 more matches
Accessibility Inspector - Firefox Developer Tools
select the accessibility tab in the developer tools toolbox.
... on the right-hand side, you can see further information about the currently selected item.
...you can click on the "target" icon that comes after it to select the node in the page inspector.
...And 6 more matches
Element - Web APIs
WebAPIElement
element.closest() returns the element which is the closest ancestor of the current element (or the current element itself) which matches the selectors given in parameter.
... element.matches() returns a boolean indicating whether or not the element would be selected by the specified selector string.
... element.pseudo() returns a csspseudoelement representing the child pseudo-element matched by the specified pseudo-element selector.
...And 6 more matches
Option() - Web APIs
syntax var optionelementreference = new option(text, value, defaultselected, selected); parameters text optional a domstring representing the content of the element, i.e.
...for the associated <select> element's value when the form is submitted to the server.
... defaultselected optional a boolean that sets the selected attribute value, i.e.
...And 6 more matches
Drag Operations - Web APIs
these include text selections, images, and links.
...for other elements, they must be part of a selection for a default drag to occur.
... to see this in effect, select an area of a webpage, and then click and hold the mouse and drag the selection.
...And 6 more matches
XRSession - Web APIs
WebAPIXRSession
select an event of type xrinputsourceevent which is sent to the session when one of the session's input sources has successfully completed a primary action.
...the select event is sent after the selectstart event is sent and immediately before the selectend event is sent.
... if select is not sent, then the select action was aborted before being completed.
...And 6 more matches
<input type="color"> - HTML: Hypertext Markup Language
WebHTMLElementinputcolor
value a 7-character domstring specifying a <color> in lower-case hexadecimal notation events change and input supported common attributes autocomplete and list idl attributes list and value methods select() value the value of an <input> element of type color is always a domstring which contains a 7-character string specifying an rgb color in hexadecimal format.
... here's an example that watches changes over time to the color value: colorpicker.addeventlistener("input", updatefirst, false); colorpicker.addeventlistener("change", watchcolorpicker, false); function watchcolorpicker(event) { document.queryselectorall("p").foreach(function(p) { p.style.color = event.target.value; }); } selecting the value if the <input> element's implementation of the color type on the user's browser doesn't support a color well, but is instead a text field for entering the color string directly, you can use the select() method to select the text currently in the edit field.
... if the browser instead uses a color well, select() does nothing.
...And 6 more matches
HTML documentation index - HTML: Hypertext Markup Language
WebHTMLIndex
classes allow css and javascript to select and access specific elements via the class selectors or functions like the dom method document.getelementsbyclassname.
...part names allows css to select and style specific elements in a shadow tree via the ::part pseudo-element.
...valid for the email and file input types and the <select>, the manner by which the user opts for multiple values depends on the form control.
...And 6 more matches
PI Parameters - XSLT: Extensible Stylesheet Language Transformations
<?xslt-param name="color" value="blue"?> <?xslt-param name="size" select="2"?> <?xml-stylesheet type="text/xsl" href="style.xsl"?> note that these pis have no effect when transformation is done using the xsltprocessor object in javascript.
... select an xpath expression for the parameter.
... if both value and select are present or if neither value nor select are present the pi is ignored.
...And 6 more matches
Menu - Archive of obsolete content
ArchiveMozillaJetpackUIMenu
individual menus are drawn from the set using on(): on(selector) returns a new contextmenuset whose context menus are those that arise from nodes that match the given css selector(s).
... the selector must be a true css selector, not a jquery or other type of pseudo-selector.
... note: selectors don't automatically include the children of nodes they match.
...And 5 more matches
Modifying a XUL Interface - Archive of obsolete content
note: if you're creating the checkbox dynamically and it's not yet added to the dom, you must use setattribute("checked", "false") instead, because the xbl isn't initiated yet.) example 6 : source view <button label="change" oncommand="this.nextsibling.checked = !this.nextsibling.checked;"/> <checkbox label="check for messages"/> radio buttons may be selected as well using properties, however since only one in a group may be selected at a time, the others must all be unchecked when one is checked.
...the radiogroup's selectedindex property may be used to do this.
... the selectedindex property may be used to retrieve the index of the selected radio button in the group and well as change it.
...And 5 more matches
menuitem - Archive of obsolete content
attributes acceltext, accesskey, allowevents, autocheck, checked, closemenu, command, crop, description, disabled, image, key, label, name, selected, tabindex, type, validate, value properties accessibletype, accesskey, command, control, crop, disabled, image, label, labelelement, parentcontainer, selected, tabindex, value style classes menuitem-iconic, menuitem-non-iconic examples <menulist> <menupopup> <menuitem label="option 1" value="1"/> <menuitem label="option 2" value="2"/> <menuitem label="option 3" value="3"/...
...a workaround is to set the autocheck attribute to false, then programmatically set the checked attribute when the user selects the item, and set it to false instead of removing the attribute (i.e.
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...And 5 more matches
tabbrowser - Archive of obsolete content
attributes autocompleteenabled, autocompletepopup, autoscroll, contentcontextmenu, contenttooltip, handlectrlpageupdown, onbookmarkgroup, onnewtab, tabmodalpromptshowing properties browsers, cangoback, cangoforward, contentdocument, contenttitle, contentvieweredit, contentviewerfile, contentwindow, currenturi, docshell, documentcharsetinfo, homepage, markupdocumentviewer, securityui, selectedbrowser, selectedtab, sessionhistory, tabcontainer, tabs, visibletabs, webbrowserfind, webnavigation, webprogress methods addprogresslistener, addtab, addtabsprogresslistener,appendgroup, getbrowseratindex, getbrowserindexfordocument, getbrowserfordocument, getbrowserfortab, geticon, getnotificationbox, gettabforbrowser, gettabmodalpromptbox, goback, gobackgroup, goforward, goforwardgroup, goh...
...ome, gotoindex, loadgroup, loadonetab, loadtabs, loaduri, loaduriwithflags, movetabto, pintab, reload, reloadalltabs, reloadtab, reloadwithflags, removealltabsbut, removecurrenttab, removeprogresslistener, removetab, removetabsprogresslistener,replacegroup, selecttabatindex, seticon, showonlythesetabs, stop, unpintab attributes autocompleteenabled type: boolean set to true to enable autocomplete of fields.
... selectedbrowser type: browser element this read-only property returns the currently displayed browser element.
...And 5 more matches
tabpanels - Archive of obsolete content
attributes selectedindex properties selectedindex, selectedpanel examples (example needed) attributes selectedindex type: integer gets and sets the index of the currently selected panel.
... selectedindex type: integer returns the index of the currently selected item.
... you may select an item by assigning its index to this property.
...And 5 more matches
Building a Theme - Archive of obsolete content
when writing a theme, the easiest way to determine what css selectors you need to write is to use the dom inspector which you should have installed in the setup step.
... pick the first document with a web page title, like "firefox start page" and select it.
...select the node finding tool (the arrow-plus-box in the top-left corner of the dom inspector), and click on any unused space on a toolbar.
...And 5 more matches
Example 4 - Learn web development
change states html content <form class="no-widget"> <select name="myfruit"> <option>cherry</option> <option>lemon</option> <option>banana</option> <option>strawberry</option> <option>apple</option> </select> <div class="select"> <span class="value">cherry</span> <ul class="optlist hidden"> <li class="option">cherry</li> <li class="option">lemon</li> <li class="option">banana</li> <li class="option">strawberry</li> <li class="option">apple</li> </ul> </div> </form> css content .widget select, .no-widget .select { position : absolute; left : -5000em; height : 0; overflow : hidden; } /* --------------- */ /* required styles */ /...
...* --------------- */ .select { position: relative; display : inline-block; } .select.active, .select:focus { box-shadow: 0 0 3px 1px #227755; outline: none; } .select .optlist { position: absolute; top : 100%; left : 0; } .select .optlist.hidden { max-height: 0; visibility: hidden; } /* ------------ */ /* fancy styles */ /* ------------ */ .select { font-size : 0.625em; /* 10px */ font-family : verdana, arial, sans-serif; -moz-box-sizing : border-box; box-sizing : border-box; padding : 0.1em 2.5em 0.2em 0.5em; /* 1px 25px 2px 5px */ width : 10em; /* 100px */ border : 0.2em solid #000; /* 2px */ border-radius : 0.4em; /* 4px */ box-shadow : 0 0.1em 0.2em rgba(0,0,0,.45); /* 0 1px 2px */ background : #f0f0f0; background : -webkit...
...-linear-gradient(90deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); background : linear-gradient(0deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); } .select .value { display : inline-block; width : 100%; overflow : hidden; white-space : nowrap; text-overflow : ellipsis; vertical-align: top; } .select:after { content : "▼"; position: absolute; z-index : 1; height : 100%; width : 2em; /* 20px */ top : 0; right : 0; padding-top : .1em; -moz-box-sizing : border-box; box-sizing : border-box; text-align : center; border-left : .2em solid #000; border-radius: 0 .1em .1em 0; background-color : #000; color : #fff; } .select .optlist { z-index : 2; list-style: none; margin : 0; padding: 0; background: #f0f0f0; border: .2em solid #000; border-t...
...And 5 more matches
Example 5 - Learn web development
change states html content <form class="no-widget"> <select name="myfruit"> <option>cherry</option> <option>lemon</option> <option>banana</option> <option>strawberry</option> <option>apple</option> </select> <div class="select" role="listbox"> <span class="value">cherry</span> <ul class="optlist hidden" role="presentation"> <li class="option" role="option" aria-selected="true">cherry</li> <li class="option" role="option">lemon</li> <li class="option" role="option">banana</li> <li class="option" role="option">strawberry</li> <li class="option" role="option">apple</li> </ul> </div> </form> css content .widget select, .no-widget .select { posi...
...tion : absolute; left : -5000em; height : 0; overflow : hidden; } /* --------------- */ /* required styles */ /* --------------- */ .select { position: relative; display : inline-block; } .select.active, .select:focus { box-shadow: 0 0 3px 1px #227755; outline: none; } .select .optlist { position: absolute; top : 100%; left : 0; } .select .optlist.hidden { max-height: 0; visibility: hidden; } /* ------------ */ /* fancy styles */ /* ------------ */ .select { font-size : 0.625em; /* 10px */ font-family : verdana, arial, sans-serif; -moz-box-sizing : border-box; box-sizing : border-box; padding : 0.1em 2.5em 0.2em 0.5em; /* 1px 25px 2px 5px */ width : 10em; /* 100px */ border : 0.2em solid #000; /* 2px */ border-radius : 0.4...
...em; /* 4px */ box-shadow : 0 0.1em 0.2em rgba(0,0,0,.45); /* 0 1px 2px */ background : #f0f0f0; background : -webkit-linear-gradient(90deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); background : linear-gradient(0deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); } .select .value { display : inline-block; width : 100%; overflow : hidden; white-space : nowrap; text-overflow : ellipsis; vertical-align: top; } .select:after { content : "▼"; position: absolute; z-index : 1; height : 100%; width : 2em; /* 20px */ top : 0; right : 0; padding-top : .1em; -moz-box-sizing : border-box; box-sizing : border-box; text-align : center; border-left : .2em solid #000; border-radius: 0 .1em .1em 0; background-color : #000; color : #fff; } .select .optlist { ...
...And 5 more matches
Implementing feature detection - Learn web development
-printshiv.min.js and html5shiv.min.js files into your example directory, and link to one of the files by putting the following under your <title> element: <script src="html5shiv.min.js"></script> have a look at your example css files — you'll see that basic-styling.css handles all the styling that we want to give to every browser, whereas the other two css files contain the css we want to selectively apply to browser depending on their support levels.
... give it the following contents: const conditional = document.queryselector('.conditional'); const testelem = document.createelement('div'); if (testelem.style.flex !== undefined && testelem.style.flexflow !== undefined) { conditional.setattribute('href', 'flex-layout.css'); } else { conditional.setattribute('href', 'float-layout.css'); } here we are grabbing a reference to the second <link> element, and creating a <div> element as part of our test.
...this works in a similar manner to media queries (see also responsive design problems) — except that instead of selectively applying css depending on a media feature like a resolution, screen width or aspect ratio, it selectively applies css depending on whether a css feature is supported.
...And 5 more matches
Debugging on Windows
in the visual studio, select debug > attach to process.
...you can then select the process from dialog opened from "attach to process".
... changing/setting the executable to debug vc++ 6.0: to change or set the executable to debug, go to project > settings..., debug tab and select general from the drop down list.
...And 5 more matches
Sqlite.jsm
however, it can have drastic implications for select statements.
... if your select statement could return lots of data, this buffering of returned rows could result in excessive memory usage.
... therefore, it's recommended to use onrow with select statements.
...And 5 more matches
nsIAccessibleProvider
xformsselect 0x00002009 used for select and select1 that are implemented using host document's native widget.
... for example, a select1 in a xhtml document may be represented by the native html control html:select.
... xformsselectfull 0x00002011 used for xforms full select/select1 elements that may be represented by group of checkboxes and radiogroup.
...And 5 more matches
CSS Flexbox Inspector: Examine Flexbox layouts - Firefox Developer Tools
clicking the icon toggles the display of an overlay on the page, which appears over the selected flex container that displays an outline around each flex item: the overlay will still be shown when you select other elements from the inspector panel, so you can edit related css properties and see how the flex items are affected by your changes.
...if you expand the section without selecting a flexbox container, it will only display the message, "select a flex container or item to continue".
... once you select an element whose display is defined as flex, the panel will include a number of options for viewing details about the flex container and flex items within it.
...And 5 more matches
Page inspector keyboard shortcuts - Firefox Developer Tools
command windows macos linux select the element under the mouse and cancel picker mode click click click select the element under the mouse and stay in picker mode shift+click shift+click shift+click html pane these shortcuts work while you're in the inspector's html pane.
... command windows macos linux delete the selected node delete delete delete undo delete of a node ctrl + z cmd + z ctrl + z redo delete of a node ctrl + shift + z / ctrl + y cmd + shift + z / cmd + y ctrl + shift + z / ctrl + y move to next node (expanded nodes only) down arrow down arrow down arrow move to previous node up arrow up arrow up arrow move to first node in the tree.
... end end end expand currently selected node right arrow right arrow right arrow collapse currently selected node left arrow left arrow left arrow (when a node is selected) move inside the node so you can start stepping through attributes.
...And 5 more matches
UI Tour - Firefox Developer Tools
it covers the three top-level components of the inspector's ui: the "select element" button the html pane the css pane this guide is intentionally kept as short as possible.
... select element button the inspector gives you detailed information about the currently selected element.
... the select element button is one way you can select an element for inspection: note that it's actually part of the main toolbox toolbar, so it's immediately accessible from any tool, not just the inspector.
...And 5 more matches
Console messages - Firefox Developer Tools
this is not shown by default: you can opt to see timestamps by selecting show timestamps in the console settings menu (gear icon in the console toolbar).
... copy message copies the selected message to the clipboard.
... select all selects all messages available in the message display pane.
...And 5 more matches
DocumentOrShadowRoot.activeElement - Web APIs
often activeelement will return a htmlinputelement or htmltextareaelement object if it has the text selection at the time.
... if so, you can get more detail by using the object's selectionstart and selectionend properties.
... other times the focused element might be a <select> element (menu) or an <input> element, of type "button", "checkbox", or "radio".
...And 5 more matches
SubtleCrypto.exportKey() - Web APIs
*/ async function exportcryptokey(key) { const exported = await window.crypto.subtle.exportkey( "raw", key ); const exportedkeybuffer = new uint8array(exported); const exportkeyoutput = document.queryselector(".exported-key"); exportkeyoutput.textcontent = `[${exportedkeybuffer}]`; } /* generate an encrypt/decrypt secret key, then set up an event listener on the "export" button.
... */ window.crypto.subtle.generatekey( { name: "aes-gcm", length: 256, }, true, ["encrypt", "decrypt"] ).then((key) => { const exportbutton = document.queryselector(".raw"); exportbutton.addeventlistener("click", () => { exportcryptokey(key); }); }); pkcs #8 export this example exports an rsa private signing key as a pkcs #8 object.
...*/ async function exportcryptokey(key) { const exported = await window.crypto.subtle.exportkey( "pkcs8", key ); const exportedasstring = ab2str(exported); const exportedasbase64 = window.btoa(exportedasstring); const pemexported = `-----begin private key-----\n${exportedasbase64}\n-----end private key-----`; const exportkeyoutput = document.queryselector(".exported-key"); exportkeyoutput.textcontent = pemexported; } /* generate a sign/verify key pair, then set up an event listener on the "export" button.
...And 5 more matches
SubtleCrypto.verify() - Web APIs
*/ function getmessageencoding() { const messagebox = document.queryselector(".rsassa-pkcs1 #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } /* fetch the encoded message-to-sign and verify it against the stored signature.
...*/ async function verifymessage(publickey) { const signaturevalue = document.queryselector(".rsassa-pkcs1 .signature-value"); signaturevalue.classlist.remove("valid", "invalid"); let encoded = getmessageencoding(); let result = await window.crypto.subtle.verify( "rsassa-pkcs1-v1_5", publickey, signature, encoded ); signaturevalue.classlist.add(result ?
...*/ function getmessageencoding() { const messagebox = document.queryselector(".rsa-pss #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } /* fetch the encoded message-to-sign and verify it against the stored signature.
...And 5 more matches
Using the Web Speech API - Web APIs
var diagnostic = document.queryselector('.output'); var bg = document.queryselector('html'); var hints = document.queryselector('.hints'); var colorhtml= ''; colors.foreach(function(v, i, a){ console.log(v, i); colorhtml += '<span style="background-color:' + v + ';"> ' + v + ' </span>'; }); hints.innerhtml = 'tap/click then say a color to change the background color of the app.
...the <select> element is initially empty, but is populated with <option>s via javascript (see later on.) <h1>speech synthesiser</h1> <p>enter some text in the input below and press return to hear it.
..." class="txt"> <div> <label for="rate">rate</label><input type="range" min="0.5" max="2" value="1" step="0.1" id="rate"> <div class="rate-value">1</div> <div class="clearfix"></div> </div> <div> <label for="pitch">pitch</label><input type="range" min="0" max="2" value="1" step="0.1" id="pitch"> <div class="pitch-value">1</div> <div class="clearfix"></div> </div> <select> </select> </form> javascript let's investigate the javascript that powers this app.
...And 5 more matches
:host-context() - CSS: Cascading Style Sheets
the :host-context() css pseudo-class function selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the selector given as the function's parameter matches the shadow host's ancestor(s) in the place it sits inside the dom hierarchy.
... one typical use of this is with a descendant selector expression — for example h1 — to select only instances of the custom element that are inside an <h1>.
... /* selects a shadow root host, only if it is a descendant of the selector argument given */ :host-context(h1) { font-weight: bold; } :host-context(main article) { font-weight: bold; } /* changes paragraph text color from black to white when a .dark-theme class is applied to the document body */ p { color: #000; } :host-context(body.dark-theme) p { color: #fff; } syntax :host-context( <compound-selector-list> )where <compound-selector-list> = <compound-selector>#where <compound-selector> = [ <type-selector>?
...And 5 more matches
Child combinator - CSS: Cascading Style Sheets
the child combinator (>) is placed between two css selectors.
... it matches only those elements matched by the second selector that are the direct children of elements matched by the first.
... /* list items that are children of the "my-things" list */ ul.my-things > li { margin: 2em; } elements matched by the second selector must be the immediate children of the elements matched by the first selector.
...And 5 more matches
Content categories - Developer guides
t>, <del>, <details>, <dfn>, <div>, <dl>, <em>, <embed>, <fieldset>, <figure>, <footer>, <form>, <h1>, <h2>, <h3>, <h4>, <h5>, <h6>, <header>, <hgroup>, <hr>, <i>, <iframe>, <img>, <input>, <ins>, <kbd>, <keygen>, <label>, <main>, <map>, <mark>, <math>, <menu>, <meter>, <nav>, <noscript>, <object>, <ol>, <output>, <p>, <picture>, <pre>, <progress>, <q>, <ruby>, <s>, <samp>, <script>, <section>, <select>, <small>, <span>, <strong>, <sub>, <sup>, <svg>, <table>, <template>, <textarea>, <time>, <ul>, <var>, <video>, <wbr> and text.
... elements belonging to this category are <abbr>, <audio>, <b>, <bdo>, <br>, <button>, <canvas>, <cite>, <code>, <command>, <data>, <datalist>, <dfn>, <em>, <embed>, <i>, <iframe>, <img>, <input>, <kbd>, <keygen>, <label>, <mark>, <math>, <meter>, <noscript>, <object>, <output>, <picture>, <progress>, <q>, <ruby>, <samp>, <script>, <select>, <small>, <span>, <strong>, <sub>, <sup>, <svg>, <textarea>, <time>, <var>, <video>, <wbr> and plain text (not only consisting of white spaces characters).
...elements that belong to this category include: <a>, <button>, <details>, <embed>, <iframe>, <keygen>, <label>, <select>, and <textarea>.
...And 5 more matches
Constraint validation - Developer guides
max range, number a valid number the value must be less than or equal to the value rangeoverflow constraint violation date, month, week a valid date datetime, datetime-local, time a valid date and time required text, search, url, tel, email, password, date, datetime, datetime-local, month, week, time, number, checkbox, radio, file; also on the <select> and <textarea> elements none as it is a boolean attribute: its presence means true, its absence means false there must be a value (if set).
...the constraint validation is done in the following ways: by a call to the checkvalidity() or reportvalidity() method of a form-associated dom interface, (htmlinputelement, htmlselectelement, htmlbuttonelement, htmloutputelement or htmltextareaelement), which evaluates the constraints only on this element, allowing a script to get this information.
... as an example, we will add a script checking the constraint validation for this simple form: <form> <label for="zip">zip : </label> <input type="text" id="zip"> <label for="country">country : </label> <select id="country"> <option value="ch">switzerland</option> <option value="fr">france</option> <option value="de">germany</option> <option value="nl">the netherlands</option> </select> <input type="submit" value="validate"> </form> this displays the following form: first, we write a function checking the constraint itself: function checkzip() { // for each country...
...And 5 more matches
HTML attribute: accept - HTML: Hypertext Markup Language
tion/msword,application/vnd.openxmlformats-officedocument.wordprocessingml.document"> whereas if you're accepting a media file, you may want to be include any format of that media type: <input type="file" id="soundfile" accept="audio/*"> <input type="file" id="videofile" accept="video/*"> <input type="file" id="imagefile" accept="image/*"> the accept attribute doesn't validate the types of the selected files; it simply provides hints for browsers to guide users towards selecting the correct file types.
... it is still possible (in most cases) for users to toggle an option in the file chooser that makes it possible to override this and select any file they wish, and then choose incorrect file types.
... examples when set on a file input type, the native file picker that opens up should only enable selecting files of the correct file type.
...And 5 more matches
<colgroup> - HTML: Hypertext Markup Language
WebHTMLElementcolgroup
note: do not try to set the text-align property on a selector giving a <colgroup> element.
... if the table doesn't use a colspan attribute, use one td:nth-child(an+b) css selector per column, where a is the total number of the columns in the table and b is the ordinal position of this column in the table.
... only after this selector the text-align property can be used.
...And 5 more matches
Miscellaneous - Archive of obsolete content
se and key events https://developer.mozilla.org/samples/domref/dispatchevent.html also, new in firefox 3 / gecko 1.9: var utils = window.queryinterface(components.interfaces.nsiinterfacerequestor) .getinterface(components.interfaces.nsidomwindowutils); utils.sendmouseevent("mousedown", 10, 10, 0, 1, 0); utils.sendmouseevent("mouseup", 10, 10, 0, 1, 0); getting the currently selected text from browser.xul overlay context: var selectedtext = document.commanddispatcher.focusedwindow.getselection().tostring(); or: content.getselection(); // |window| object is implied; i.e., window.content.getselection() or: getbrowserselection(); // |window| object is implied; i.e., window.getbrowserselection() this final option massages the selection to remove leading and trailing w...
...note that it returns the empty string (""), not false, when nothing is selected.
... getbrowserselection() is not implemented on some platforms, such as thunderbird and songbird.
...And 4 more matches
Chapter 6: Firefox extensions and XUL applications - Archive of obsolete content
starting up select “javascript debugger” from the tools menu.
...then select tools:quicknote:float to display it in its own window.
... using venkman read in source code activate venkman, and then select open windows:quicknote.xul:files on the top-left of the screen.
...And 4 more matches
Chapter 5: Let's build a Firefox extension - Archive of obsolete content
some of these preferences do not exist—to create them, right-click, select “new>boolean”, and type in the name and set the value accordingly.
... open the dom inspector by selecting the tools > dom inspector menu item.
... click the spots numbered 1 and 2 in figure 5, in that order; the menu element (3) will then be selected.
...And 4 more matches
CSS3 - Archive of obsolete content
some modules, like selectors 4 or css borders and backgrounds level 4 already have an editor's draft, though they haven't yet reached the first published working draft status.
... selectors level 3 recommendation since september 29th, 2011 adds: substring matching attribute selectors, e[attribute^="value"], e[attribute$="value"], e[attribute*="value"] .
... the next iteration of the selectors specification is already in progress, though it still hasn't reached the first public working draft stage.
...And 4 more matches
Creating a Microsummary - Archive of obsolete content
irefox download count"> <template> <transform xmlns="http://www.w3.org/1999/xsl/transform" version="1.0"> <output method="text"/> <template match="/"> </template> </transform> </template> </generator> including the download count to include the download count in the output of the xslt transform sheet, we need to add an xslt <value-of> element to the template whose select attribute contains an xpath expression that points to the node containing the count.
... install the extension (restarting firefox to complete installation) then go to the spread firefox home page, find the firefox download count (a large number at the bottom of the right-hand column), context click on the number, and select view xpath from the context menu.
... add a <value-of> element to the xslt <template> element whose select attribute contains that xpath expression: <?xml version="1.0" encoding="utf-8"?> <generator xmlns="http://www.mozilla.org/microsummaries/0.1" name="firefox download count"> <template> <transform xmlns="http://www.w3.org/1999/xsl/transform" version="1.0"> <output method="text"/> <template match="/"> <value-of select="id('download-count')"/> </template> </transform> </template> </generator> adding text to include the label fx downloads in the microsummary, we need to add an xslt <text> element to the x...
...And 4 more matches
Content states and the style system - Archive of obsolete content
this is done by walking the list of all css2.1 simple selectors in all style sheets applied to the page that have a state-dependent pseudo-class as part of the selector.
...for each selector in this list we check whether it might have stopped matching the node or started matching it.
... the way we determine whether the selector might have stopped or started matching the node is by just checking whether it matches with the caveat that all the state-dependent pseudo-classes corresponding to the states that changed must be treated as matching (whether they actually do and whether they're negated or not).
...And 4 more matches
Keyboard Shortcuts - Archive of obsolete content
in the example below, the file menu can be selected by pressing alt + f together (or some other key combination for a specific platform).
... once the file menu is open, the close menu item can be selected by pressing c.
...when the key is pressed in this case, the button is selected.
...And 4 more matches
Using Remote XUL - Archive of obsolete content
the categorized links are analogous to menu items organized into menus, where clicking the link/selecting the menu item performs some function, so we'll use xul menu elements to implement them in our document.
... source | rendered step 4: menu items menus aren't terribly useful unless they contain selectable items.
...the menuitem element represents a selectable item within the popup.
...And 4 more matches
How to enable locale switching in a XULRunner application - Archive of obsolete content
include a xul control for the locale selection the next step is to add a xul control to your application which lists the available locales in the package and makes it possible for the user to select one of them.
...the dynamic list population requires an xpcom to query the currently selected locale as well as all locales available in the application package.
... here is a code snippet showing how this is done: the definition of the xul control: <listbox id="locale-listbox"> <!-- generated list items go in here --> </listbox> <button label="&switchlocale.button;" oncommand="changelocale()"/> the javascript code to populate the control: try { // query available and selected locales var chromeregservice = components.classes["@mozilla.org/chrome/chrome-registry;1"].getservice(); var xulchromereg = chromeregservice.queryinterface(components.interfaces.nsixulchromeregistry); var toolkitchromereg = chromeregservice.queryinterface(components.interfaces.nsitoolkitchromeregistry); var selectedlocale = xulchromereg.getselectedlocale("localeswitchdemo"); var availablelocales = toolkitchromereg.getlocalesforpackage("localeswitchdemo"); // rend...
...And 4 more matches
Theme changes in Firefox 2 - Archive of obsolete content
#search-container[chromedir="rtl"] .search-go-button #search-container[chromedir="rtl"] .searchbar-engine-button .search-go-button .search-go-button:hover .search-go-button:hover:active .search-go-button[disabled="true"] .searchbar-engine-button .searchbar-engine-button:hover .searchbar-engine-button[addengines="true"] .searchbar-engine-button[open="true"] .searchbar-engine-menuitem[selected="true"] > .menu-iconic-text .searchbar-left you may of course wish to make changes to other styles as well.
...eme: #browserstartuphomepage #browserstartuphomepage #panedownloads description #panegeneral description radio[pane=panedownloads] radio[pane=panedownloads]:active the following styles need to be added to your theme to make it compatible with firefox 2: #panecontent description #panemain description #panesecurity description radio[pane=paneadvanced]:hover radio[pane=paneadvanced][selected="true"] radio[pane=panecontent]:hover radio[pane=panecontent][selected="true"] radio[pane=panefeeds] radio[pane=panefeeds]:active radio[pane=panefeeds]:hover radio[pane=panefeeds][selected="true"] radio[pane=panegeneral]:hover radio[pane=panegeneral][selected="true"] radio[pane=panemain] radio[pane=panemain]:active radio[pane=panemain]:hover radio[pane=panemain][selected="true"] ra...
...dio[pane=paneprivacy]:hover radio[pane=paneprivacy][selected="true"] radio[pane=panesecurity] radio[pane=panesecurity]:active radio[pane=panesecurity]:hover radio[pane=panesecurity][selected="true"] radio[pane=panetabs]:hover radio[pane=panetabs][selected="true"] you may of course wish to change other styles as well.
...And 4 more matches
HTML: A good basis for accessibility - Learn web development
his: <div>play video</div> but as you'll see in greater detail later on, it makes sense to use the correct element for the job: <button>play video</button> not only do html <button>s have some suitable styling applied by default (which you will probably want to override), they also have built-in keyboard accessibility — users can navigate between buttons using the tab key and activate their selection using return or enter.
... there are other issues too beyond accessibility — it is harder to style the content using css, or manipulate it with javascript, for example, because there are no elements to use as selectors.
...other form elements have different controls, for example, the <select> element can have its options displayed and cycled between using the up and down arrow keys.
...And 4 more matches
HTML: A good basis for accessibility - Learn web development
his: <div>play video</div> but as you'll see in greater detail later on, it makes sense to use the correct element for the job: <button>play video</button> not only do html <button>s have some suitable styling applied by default (which you will probably want to override), they also have built-in keyboard accessibility — users can navigate between buttons using the tab key and activate their selection using return or enter.
... there are other issues too beyond accessibility — it is harder to style the content using css, or manipulate it with javascript, for example, because there are no elements to use as selectors.
...other form elements have different controls, for example, the <select> element can have its options displayed and cycled between using the up and down arrow keys.
...And 4 more matches
Advanced text formatting - Learn web development
solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value ...
...ventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every ...
... solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); const code = textarea.value; const userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value ...
...And 4 more matches
What is JavaScript? - Learn web development
cing: 1px; text-transform: uppercase; text-align: center; border: 2px solid rgba(0,0,200,0.6); background: rgba(0,0,200,0.3); color: rgba(0,0,200,0.6); box-shadow: 1px 1px 2px rgba(0,0,200,0.4); border-radius: 10px; padding: 3px 10px; display: inline-block; cursor: pointer; } and finally, we can add some javascript to implement dynamic behaviour: const para = document.queryselector('p'); para.addeventlistener('click', updatename); function updatename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } try clicking on this last version of the text label to see what happens (note also that you can find this demo on github — see the source code, or run it live)!
...for example, let's return to the block of javascript we saw in our first example: const para = document.queryselector('p'); para.addeventlistener('click', updatename); function updatename() { let name = prompt('enter a new name'); para.textcontent = 'player 1: ' + name; } here we are selecting a text paragraph (line 1), then attaching an event listener to it (line 3) so that when the paragraph is clicked, the updatename() code block (lines 5–8) is run.
...r <script> element to make the page do something more interesting — add the following code just below the "// javascript goes here" line: document.addeventlistener("domcontentloaded", function() { function createparagraph() { let para = document.createelement('p'); para.textcontent = 'you clicked the button!'; document.body.appendchild(para); } const buttons = document.queryselectorall('button'); for(let i = 0; i < buttons.length ; i++) { buttons[i].addeventlistener('click', createparagraph); } }); save your file and refresh the browser — now you should see that when you click the button, a new paragraph is generated and placed below.
...And 4 more matches
Profile Manager
an individual profile can be linked to a specific installation of firefox, so that version of firefox will be launched when that profile is selected.
... a dialog will appear that allows you to specify the profile's name, and optionally the profile's path, and the version of firefox (or other application) that will be used with this profile: launching firefox with a profile to launch firefox with a specific profile, select the profile in the main window, and hit the "start firefox" button: firefox will be launched with that profile, and profile manager will terminate.
... to backup a profile: select the profile you want to backup, and choose "backup to->backup folder" from the toolbar's backup menu.
...And 4 more matches
Setting up CDT to work on SpiderMonkey
select "new > makefile project with existing code" from the "file" menu.
... give the project a name that you like ("spidermonkey" has a nice ring to it) and use the "browser…" button to select your checkout's js/src folder for the "existing code location".
... step 3 - index all the code to let cdt know about the build, it has to invoke make itself (or, as is done in the guide for the whole mozilla codebase on mdn, read a log of the build), which can be setup with these simple steps: open the project's properties by selecting its root and clicking "properties" in the "file" menu and select "c/c++ build".
...And 4 more matches
Gecko states
state_selected the object is selected, i.e.
... indicates this object is the child of an object that allows its children to be selected and that this child is one of those children that has been selected.
... applied to: role_menuitem, role_cell, role_outlineitem, xxx: continue events: event_state_change Сoncomitant state: state_selectable state_focused the object is focused applied to: events: concomitant state: state_focusable state_pressed the object is pressed.
...And 4 more matches
Setting up the Gecko SDK
creating a new project after launching visual c++, select new from the file menu.
... then, from the new dialog, select "win32 dynamic-link library".
...express edition is free.) new dialog select ok.
...And 4 more matches
nsICompositionStringSynthesizer
to create an instance for this: var domwindowutils = window.windowutils; var compositionstringsynthesizer = domwindowutils.createcompositionstringsynthesizer(); for example, when you create a composition whose composing string is "foo-bar-buzz" and "bar" is selected to convert, then, first, you need to start composition: domwindowutils.sendcompositionevent("compositionstart", "", ""); next, dispatch composition string with crause information and caret information (optional): // set new composition string with .setstring().
...compositionstringsynthesizer.appendclause("foo-".length, compositionstringsynthesizer.attr_convertedtext); compositionstringsynthesizer.appendclause("bar".length, compositionstringsynthesizer.attr_selectedconvertedtext); compositionstringsynthesizer.appendclause("-buzz".length, compositionstringsynthesizer.attr_convertedtext); // set caret position in the composition string.
...for example, if the "bar" is converted to "bar": compositionstringsynthesizer.setstring("foo-bar-buzz"); compositionstringsynthesizer.appendclause("foo-".length, compositionstringsynthesizer.attr_convertedtext); compositionstringsynthesizer.appendclause("bar".length, compositionstringsynthesizer.attr_selectedconvertedtext); compositionstringsynthesizer.appendclause("-buzz".length, compositionstringsynthesizer.attr_convertedtext); compositionstringsynthesizer.setcaret("foo-bar".length, 0); compositionstringsynthesizer.dispatchevent(); finally, when you commits composition with the last composition string "foo-bar-buzz": // deprecated in 36, first, dispatch commit string without clause information c...
...And 4 more matches
nsIEditorSpellCheck
y(); void getdictionarylist([array, size_is(count)] out wstring dictionarylist, out pruint32 count); wstring getnextmisspelledword(); void getpersonaldictionary(); wstring getpersonaldictionaryword(); wstring getsuggestedword(); void ignorewordalloccurrences(in wstring word); void initspellchecker(in nsieditor editor, in boolean enableselectionchecking); void removewordfromdictionary(in wstring word); void replaceword(in wstring misspelledword, in wstring replaceword, in boolean alloccurrences); void savedefaultdictionary(); obsolete since gecko 9.0 void setcurrentdictionary(in astring dictionary); void setfilter(in nsitextservicesfilter filter); void uninitspellchecker(); ...
...void initspellchecker( in nsieditor editor, in boolean enableselectionchecking ); parameters editor the nsieditor on which to enable spell checking.
... enableselectionchecking if true, the spell checker is initialized only for checking the current selection; otherwise, it's initialized for checking the entire document.
...And 4 more matches
Work with animations - Firefox Developer Tools
right-click in the box and select "inspect element" make sure the selected element is the <div class="channel"> switch over to the "animations" tab play the animation let's take a closer look at the contents of the animation inspector here: it shows a synchronized timeline for every animation applied to the selected element or its children.
... the animation's fill the playback rate of the animation information about the animated element to the left of each bar is a selector for the element that the animation applies to.
... if you hover over this selector, the element is highlighted in the page.
...And 4 more matches
Flame Chart - Firefox Developer Tools
here's a screenshot showing the flame chart for a section of a profile: first of all, you'll see that, in the recording overview pane, we've selected a small slice of the recording to view in the flame chart.
...there are two main controls you can use to navigate the flame chart: zoom: increase/decrease the selected portion of the complete profile that's displayed in the flame chart 1) mouse wheel up/down in the flame chart.
... pan: move the selected portion of the complete profile left and right 1) click and drag the selected portion in the recording overview pane.
...And 4 more matches
Toolbox - Firefox Developer Tools
there are a few different ways to open the toolbox: select "toggle tools" from the web developer menu (under "tools" on os x and linux, or "firefox" on windows) click the wrench icon (), which is in the main toolbar or under the hamburger menu (), then select "toggle tools" activate any tool hosted in the toolbox (for example, the javascript debugger or the page inspector) press ctrl + shift + i on windows and linux, or cmd + opt + i on os x.
...this lets you select a page element for inspection.
... see "selecting elements".
...And 4 more matches
CSSStyleSheet.insertRule() - Web APIs
what the inserted rule must contain depends on its type: for rule-sets, both a selector and a style declaration.
...tant rules ], ['.myclass', ['background-color', 'yellow'] ] ]); */ function addstylesheetrules (rules) { var styleel = document.createelement('style'); // append <style> element to <head> document.head.appendchild(styleel); // grab style element's sheet var stylesheet = styleel.sheet; for (var i = 0; i < rules.length; i++) { var j = 1, rule = rules[i], selector = rule[0], propstr = ''; // if the second argument of a rule is an array of arrays, correct our variables.
...' !important' : '') + ';\n'; } // insert css rule stylesheet.insertrule(selector + '{' + propstr + '}', stylesheet.cssrules.length); } } polyfill the below polyfill will correct the input of the arguments of insertrule() to standardize them in internet explorer 5–8.
...And 4 more matches
DragEvent - Web APIs
WebAPIDragEvent
event types drag this event is fired when an element or text selection is being dragged.
... dragenter this event is fired when a dragged element or text selection enters a valid drop target.
... dragexit this event is fired when an element is no longer the drag operation's immediate selection target.
...And 4 more matches
Element.closest() - Web APIs
WebAPIElementclosest
the closest() method traverses the element and its parents (heading toward the document root) until it finds a node that matches the provided selector string.
... syntax var closestelement = targetelement.closest(selectors); parameters selectors is a domstring containing a selector list.
... ex: p:hover, .toto + q return value closestelement is the element which is the closest ancestor of the selected element.
...And 4 more matches
GlobalEventHandlers - Web APIs
globaleventhandlers.onselect is an eventhandler representing the code to be called when the select event is raised.
... globaleventhandlers.onselectstart is an eventhandler representing the code to be called when the selectionchange event is raised, i.e.
... when the user starts to make a new text selection on a web page.
...And 4 more matches
HTMLOptionElement - Web APIs
htmloptionelement.defaultselected is a boolean that contains the initial value of the selected html attribute, indicating whether the option is selected by default or not.
... htmloptionelement.disabled is a boolean representing the value of the disabled html attribute, which indicates that the option is unavailable to be selected.
... htmloptionelement.form read only is a htmlformelement representing the same value as the form of the corresponding <select> element, if the option is a descendant of a <select> element, or null if none is found.
...And 4 more matches
Timing element visibility with the Intersection Observer API - Web APIs
although many aspects of this example will not match real world usage (in particular, the articles all have the same text and aren't loaded from a database, and there are just a handful of simple text-only ads that are selected from an array), this should provide enough understanding of the api to quickly learn how to apply the intersection observer api to your own site.
... setting up to set things up, we run the startup() function below when the page loads: window.addeventlistener("load", startup, false); function startup() { contentbox = document.queryselector("main"); document.addeventlistener("visibilitychange", handlevisibilitychange, false); let observeroptions = { root: null, rootmargin: "0px", threshold: [0.0, 0.75] }; adobserver = new intersectionobserver(intersectioncallback, observeroptions); buildcontents(); refreshintervalid = window.setinterval(handlerefreshinterval, 1000); } first, a refer...
...this is handled by passing the ad's element into the drawadtimer() function: function drawadtimer(adbox) { let timerbox = adbox.queryselector(".timer"); let totalseconds = adbox.dataset.totalviewtime / 1000; let sec = math.floor(totalseconds % 60); let min = math.floor(totalseconds / 60); timerbox.innertext = min + ":" + sec.tostring().padstart(2, "0"); } this code finds the ad's timer using its id, "timer", and computes the number of seconds elapsed by dividing the ad's totalviewtime by 1000.
...And 4 more matches
Intersection Observer API - Web APIs
creating an intersection observer create the intersection observer by calling its constructor and passing it a callback function to be run whenever a threshold is crossed in one direction or the other: let options = { root: document.queryselector('#scrollarea'), rootmargin: '0px', threshold: 1.0 } let observer = new intersectionobserver(callback, options); a threshold of 1.0 means that when 100% of the target is visible within the element specified by the root option, the callback is invoked.
... targeting an element to be observed once you have created the observer, you need to give it a target element to watch: let target = document.queryselector('#listitem'); observer.observe(target); // the callback we setup for the observer will be executed now for the first time // it waits until we assign a target to our observer (even if the target is currently not visible) whenever the target meets a threshold specified for the intersectionobserver, the callback is invoked.
... background-color: rgba(255, 255, 255, 0.7); border: 1px solid rgba(0, 0, 0, 0.7); width: 3em; height: 18px; padding: 2px; text-align: center; } .topleft { left: 2px; top: 2px; } .topright { right: 2px; top: 2px; } .bottomleft { bottom: 2px; left: 2px; } .bottomright { bottom: 2px; right: 2px; } let observers = []; startup = () => { let wrapper = document.queryselector(".wrapper"); // options for the observers let observeroptions = { root: null, rootmargin: "0px", threshold: [] }; // an array of threshold sets for each of the boxes.
...And 4 more matches
RTCIceTransport - Web APIs
the value of state can be used to determine whether the ice agent has made an initial connection using a viable candidate pair ("connected"), made its final selection of candidate pairs ("completed"), or in an error state ("failed"), among other states.
... getselectedcandidatepair() returns a rtcicecandidatepair object that identifies the two candidates—one for each end of the connection—that have been selected so far.
... it's possible that a better pair will be found and selected later; if you need to keep up with this, watch for the selectedcandidatepairchange event.
...And 4 more matches
Advanced techniques: Creating and sequencing audio - Web APIs
>attack</label> <input name="attack" id="attack" type="range" min="0" max="1" value="0.2" step="0.1" /> <label for="release">release</label> <input name="release" id="release" type="range" min="0" max="1" value="0.5" step="0.1" /> now we can create some variables over in javascript and have them change when the input values are updated: let attacktime = 0.2; const attackcontrol = document.queryselector('#attack'); attackcontrol.addeventlistener('input', function() { attacktime = number(this.value); }, false); let releasetime = 0.5; const releasecontrol = document.queryselector('#release'); releasecontrol.addeventlistener('input', function() { releasetime = number(this.value); }, false); the final playsweep() function now we can expand our playsweep() function.
... let pulsehz = 880; const hzcontrol = document.queryselector('#hz'); hzcontrol.addeventlistener('input', function() { pulsehz = number(this.value); }, false); let lfohz = 30; const lfocontrol = document.queryselector('#lfo'); lfocontrol.addeventlistener('input', function() { lfohz = number(this.value); }, false); the final playpulse() function here's the entire playpulse() function: let pulsetime = 1; function playpulse() { let osc = audi...
...the user to adjust them via range inputs and event handlers just like in previous sections: <label for="duration">duration</label> <input name="duration" id="duration" type="range" min="0" max="2" value="1" step="0.1" /> <label for="band">band</label> <input name="band" id="band" type="range" min="400" max="1200" value="1000" step="5" /> let noiseduration = 1; const durcontrol = document.queryselector('#duration'); durcontrol.addeventlistener('input', function() { noiseduration = number(this.value); }, false); let bandhz = 1000; const bandcontrol = document.queryselector('#band'); bandcontrol.addeventlistener('input', function() { bandhz = number(this.value); }, false); the final playnoise() function here's the entire playnoise() function: function playnoise() { const buffers...
...And 4 more matches
Implementing a Microsoft Active Accessibility (MSAA) Server - Accessibility
[important] get_accstate: a 32 bit field representing possible on/off states, such as focused, focusable, selected, selectable, visible, protected (for passwords), checked, etc.
...[important] get_accselection: which children of this item are selected?
... accselect: select the item associated with this iaccessible.
...And 4 more matches
Alternative style sheets - CSS: Cascading Style Sheets
firefox lets the user select the stylesheet using the view > page style submenu.
...et" type="text/css"> <link href="default.css" rel="stylesheet" type="text/css" title="default style"> <link href="fancy.css" rel="alternate stylesheet" type="text/css" title="fancy"> <link href="basic.css" rel="alternate stylesheet" type="text/css" title="basic"> in this example, the styles "default style", "fancy", and "basic" will be listed in the page style submenu, with "default style" pre-selected.
... when the user selects a different style, the page will immediately be re-rendered using that style sheet.
...And 4 more matches
Descendant combinator - CSS: Cascading Style Sheets
the descendant combinator — typically represented by a single space ( ) character — combines two selectors such that elements matched by the second selector are selected if they have an ancestor (parent, parent's parent, parent's parent's parent, etc) element matching the first selector.
... selectors that utilize a descendant combinator are called descendant selectors.
... /* list items that are descendants of the "my-things" list */ ul.my-things li { margin: 2em; } the descendant combinator is technically one or more css white space characters — the space character and/or one of four control characters: carriage return, form feed, new line, and tab characters — between two selectors in the absence of another combinator.
...And 4 more matches
<color> - CSS: Cascading Style Sheets
activetext text of active links buttonface background of push buttons buttontext text of push buttons canvas background of application content or documents canvastext text in application content or documents field background of input fields fieldtext text in input fields graytext text that is disabled highlight background of items that are selected in a control highlighttext text of items that are selected in a control linktext text of non-active, non-visited links visitedtext text of visited links deprecated system color keywords the following keywords were defined in earlier versions of the css color module.
... -moz-cellhighlight background color for selected item in a tree widget.
... -moz-cellhighlighttext text color for a selected item in a tree.
...And 4 more matches
<col> - HTML: Hypertext Markup Language
WebHTMLElementcol
note: to achieve the same effect as the left, center, right or justify values: do not try to set the text-align property on a selector giving a <col> element.
... if the table doesn't use a colspan attribute, use the td:nth-child(an+b) css selector.
... if the table does use a colspan attribute, the effect can be achieved by combining adequate css attribute selectors like [colspan=n], though this is not trivial.
...And 4 more matches
<input type="checkbox"> - HTML: Hypertext Markup Language
WebHTMLElementinputcheckbox
a checkbox allows you to select single values for submission in a form (or not).
... note: radio buttons are similar to checkboxes, but with an important distinction — radio buttons are grouped into a set in which only one radio button can be selected at a time, whereas checkboxes allow you to turn single values on and off.
... where multiple controls exist, radio buttons allow one to be selected out of them all, whereas checkboxes allow multiple values to be selected.
...And 4 more matches
Assertions - JavaScript
for selecting appropriate fruits we can use the filter method with an arrow function.
... let fruits = ["apple", "watermelon", "orange", "avocado", "strawberry"]; // select fruits started with 'a' by /^a/ regex.
... let fruits = ["apple", "watermelon", "orange", "avocado", "strawberry"]; // selecting fruits that dose not start by 'a' by a /^[^a]/ regex.
...And 4 more matches
tabs/utils - Archive of obsolete content
globals functions activatetab(tab, window) set the specified tab as the active, or selected, tab.
... getactivetab(window) given a browser window, get the active, or selected, tab.
... returns tab : the currently selected tab.
...And 3 more matches
Creating Reusable Modules - Archive of obsolete content
here we'll write an add-on that lets the user select a file on disk and calculates its hash.
... file picker to let the user select a file we'll use nsifilepicker.
... the documentation for that interface includes an example which we can adapt like this: var {cc, ci} = require("chrome"); function promptforfile() { const nsifilepicker = ci.nsifilepicker; var fp = cc["@mozilla.org/filepicker;1"] .createinstance(nsifilepicker); var window = require("sdk/window/utils").getmostrecentbrowserwindow(); fp.init(window, "select a file", nsifilepicker.modeopen); fp.appendfilters(nsifilepicker.filterall | nsifilepicker.filtertext); var rv = fp.show(); if (rv == nsifilepicker.returnok || rv == nsifilepicker.returnreplace) { var file = fp.file; // get the path as string.
...And 3 more matches
Index of archived content - Archive of obsolete content
vel apis addon-page base64 clipboard context-menu hotkeys indexed-db l10n notifications page-mod page-worker panel passwords private-browsing querystring request selection self simple-prefs simple-storage system tabs timers ui url widget windows low-level apis /loader chrome console/plain-text console/tr...
... javascript timers javascript daemons management label and description lookupnamespaceuri lookupprefix miscellaneous modules on page load page loading post data to window preferences progress listeners queryselector rosetta running applications svg animation svg general scrollbar sidebar stringview tabbox toolbar tree uri parsing view source for xul applications windows xml-related code snippets xml:...
... api accounts.jsm browserapp addtab closetab deck getbrowserfordocument getbrowserforwindow gettabforbrowser gettabforid gettabforwindow loaduri quit selecttab tabs helperapps.jsm home.jsm banner panels homeprovider.jsm homestorage nativewindow ...
...And 3 more matches
PopupKeys - Archive of obsolete content
cursor left/right when a menu is selected, cursor right opens the menu, while a cursor left closes a menu.
...home/end move the highlight to the beginning or the end of the menu, selecting the first or last item.
...if a menuitem is selected, this will close the menu and fire the menuitem's command event.
...And 3 more matches
SQLite Templates - Archive of obsolete content
the query for an sqlite datasource is just an sql select statement, as text inside the query element.
... <listbox datasources="profile:userdata.sqlite" ref="*" querytype="storage"> <template> <query> select name from myfriends </query> <action> <listitem uri="?" label="?name"/> </action> </template> </listbox> the query returns the list of values from the 'name' column in the table 'myfriends'.
... <vbox datasources="profile:userdata.sqlite" ref="*" querytype="storage"> <template> <query> select name, email from myfriends where age >= 30 </query> <action> <hbox uri="?"> <label value="?name"/> <label value="?email"/> </hbox> </action> </template> </vbox> this template displays the results of two columns.
...And 3 more matches
Skinning XUL Files by Hand - Archive of obsolete content
in the very near future, it will be possible to skin xul files dynamically and completely -- by pressing a button, selecting a skin from a menu, or by accepting a skin from over the web.
... note that for any one class of element, there may be several pseudo-classes andattribute selector styles defined.
...in the first definition, the selector "toolbar.nav-bar" is used to define style information for all xul toolbars of the class "nav-bar." unlike an id -- which is also often used as a selector but must be unique -- a class attribute can be used on multiple xul elements you want to pick up the specified style information.
...And 3 more matches
Styling a Tree - Archive of obsolete content
set the property on a row or cell, as in the following example: <treerow properties="makeitblue"> css selectors for the tree the style sheet can take this property and use it to change the appearance of the row for unread messages or labels.
...the following is the syntax that needs to be used: treechildren::-moz-tree-row(makeitblue) { background-color: blue; } this style which has a complex selector is used to style the background color of rows that have the 'makeitblue' property.
...this selector matches some tree rows inside the treechildren element as pseudo-elements.
...And 3 more matches
Trees - Archive of obsolete content
ArchiveMozillaXULTutorialTrees
this element also serves as the item which can be selected by the user.
... the treeitem tag would go around the entire row so that it is selectable as a whole.
... the user can select the treeitems by clicking on them with the mouse, or by highlighting them with the keyboard.
...And 3 more matches
menu - Archive of obsolete content
ArchiveMozillaXULmenu
attributes acceltext, accesskey, allowevents, command, crop, disabled, image, label, menuactive, open, sizetopopup, tabindex, value properties accessibletype, accesskey, command, control, crop, disabled, image, itemcount, label, labelelement, menupopup, open, parentcontainer, selected, tabindex, value methods appenditem, getindexofitem, getitematindex, insertitemat, removeitemat style classes menu-iconic example <menubar id="sample-menubar"> <menu id="file-menu" label="file"> <menupopup id="file-popup"> <menuitem label="new"/> <menuitem label="open"/> <menuitem label="save"/> <menuseparator/> <menuitem label="exit"/> </menupo...
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...a dommenuitemactive event will be sent to the item when the item is hovered over, and a dommenuiteminactive event will be sent to the item when the selection moves away.
...And 3 more matches
menuseparator - Archive of obsolete content
attributes acceltext, accesskey, allowevents, command, crop, disabled, image, label, selected, tabindex, value properties accessibletype, accesskey, command, control, crop, disabled, image, label, labelelement, parentcontainer, selected, tabindex, value examples <menu label="menu"> <menupopup> <menuitem label="item1"/> <menuseparator/> <menuitem label="item2"/> <menuitem label="item3"/> </menupopup> </menu> attributes acceltext type: string text that appears beside the menu label to indicate the shortcut ke...
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
... selected type: boolean indicates whether the element is selected or not.
...And 3 more matches
prefpane - Archive of obsolete content
attributes helpuri, image, label, onpaneload, selected, src properties image, label, preferenceelements, preferences, selected, src examples methods preferenceforelement <prefpane id="panegeneral" label="general" src="chrome://path/to/paneoverlay.xul"/> or <prefpane id="panegeneral" label="general" onpaneload="ongeneralpaneload(event);"> <preferences> <preference id="pref_one" name="extensions.myextension.one" t...
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
... selected type: boolean this attribute will be set to true for the currently selected prefpane.
...And 3 more matches
CSS - Archive of obsolete content
ArchiveWebCSS
ng the zoom behavior that occurs when a user hits the zoom limit during page manipulation.-ms-content-zoom-limitthe -ms-content-zoom-limit css shorthand property is a microsoft extension that specifies values for the -ms-content-zoom-limit-min and -ms-content-zoom-limit-max properties.-ms-content-zoom-limit-maxthe -ms-content-zoom-limit-max css property is a microsoft extension that specifies the selected elements' maximum zoom factor.-ms-content-zoom-limit-minthe -ms-content-zoom-limit-min css property is a microsoft extension that specifies the minimum zoom factor.-ms-content-zoom-snapthe -ms-content-zoom-snap css shorthand property is a microsoft extension that specifies values for the -ms-content-zoom-snap-type and -ms-content-zoom-snap-points properties.-ms-content-zoom-snap-pointsthe -ms-c...
...r of the bottom and right edges of the scroll box and scroll arrows of a scroll bar.-ms-scrollbar-track-colorthe -ms-scrollbar-track-color css property is a microsoft extension that specifies the color of the track element of a scrollbar.-ms-text-autospacethe -ms-text-autospace css property is a microsoft extension that specifies the autospacing and narrow space width adjustment of text.-ms-touch-selectthe -ms-touch-select css property is a microsoft extension that toggles the gripper visual elements that enable touch text selection.-ms-wrap-flowthe -ms-wrap-flow css property is a microsoft extension that specifies how exclusions impact inline content within block-level elements.-ms-wrap-marginthe -ms-wrap-margin css property is a microsoft extension that specifies a margin that offsets the inne...
...this pseudo-element is non-standard, supported only in internet explorer 10, internet explorer 11, and microsoft edge.::-ms-expandthe ::-ms-expand css pseudo-element is a microsoft extension that represents the button of a <select> menu control that opens or closes the drop-down menu.
...And 3 more matches
Mozilla XForms User Interface - Archive of obsolete content
upload provides a means for the user to select a file (see the spec).
... submit invokes the submission of the selected instance data to its target destination, which could be local or remote (see the spec).
... select list control.
...And 3 more matches
Building up a basic demo with PlayCanvas editor - Game development
click diffuse, then select the colored box next to the color label — it will open a color wheel.
... now we can apply the colored material to the shape by clicking and dragging its icon from the bottom part of the screen (the little dot on the left hand side of the material's name — it can be a bit fiddly to select; just persevere) onto the box on the scene.
...click on the root folder in the hierarchy panel (to make sure that the new shape appears in the root, and not as a child of the box) then click on the big add entity (plus) button and select cylinder from the dropdown list — it will add a new cylinder shape to the scene.
...And 3 more matches
Organizing your CSS - Learn web development
avoid overly-specific selectors if you create very specific selectors you will often find that you need to duplicate chunks of your css to apply the same rules to another element.
... for example, you might have something like the below selector, which applies the rule to a <p> with a class of box inside an <article> with a class of main.
... article.main p.box { border: 1px solid #ccc; } if you then wanted to apply the same rules to something outside of main, or to something other than a <p>, you would have to add another selector to these rules or create a whole new ruleset.
...And 3 more matches
Styling tables - Learn web development
this is why we've selected the four different headings with the thead th:nth-child(n) (:nth-child) selector ("select the nth child that is a <th> element in a sequence, inside a <thead> element") and given them set percentage widths.
...add the following css to the bottom of your style.css file: /* zebra striping */ tbody tr:nth-child(odd) { background-color: #ff33cc; } tbody tr:nth-child(even) { background-color: #e495e4; } tbody tr { background-image: url(noise.png); } table { background-color: #ff33cc; } earlier on you saw the :nth-child selector being used to select specific child elements.
... it can also be given a formula as a parameter, so it will select a sequence of elements.
...And 3 more matches
How CSS works - Learn web development
the browser parses the fetched css, and sorts the different rules by their selector types into different "buckets", e.g.
...based on the selectors it finds, it works out which rules should be applied to which nodes in the dom, and attaches style to them as required (this intermediate step is called a render tree).
...when you start working with browser devtools you will be navigating the dom as you select items in order to see which rules apply.
...And 3 more matches
Styling links - Learn web development
the third rule uses the a selector to get rid of the default text underline and focus outline (which varies across browsers anyway), and adds a tiny amount of padding to each link — all of this will become clear later on.
... next, we use the a:link and a:visited selectors to set a couple of color variations on unvisited and visited links, so they are distinct.
...{ } a:active { }</textarea> <h2>output</h2> <div class="output" style="width: 90%;height: 10em;padding: 10px;border: 1px solid #0095dd;"></div> <div class="controls"> <input id="reset" type="button" value="reset" style="margin: 10px 10px 0 0;"> <input id="solution" type="button" value="show solution" style="margin: 10px 0 0 10px;"> </div> </div> var htmlinput = document.queryselector(".html-input"); var cssinput = document.queryselector(".css-input"); var reset = document.getelementbyid("reset"); var htmlcode = htmlinput.value; var csscode = cssinput.value; var output = document.queryselector(".output"); var solution = document.getelementbyid("solution"); var styleelem = document.createelement('style'); var headelem = document.queryselector('head'); headelem.appendchild(st...
...And 3 more matches
Example 3 - Learn web development
change states html content <form class="no-widget"> <select name="myfruit" tabindex="-1"> <option>cherry</option> <option>lemon</option> <option>banana</option> <option>strawberry</option> <option>apple</option> </select> <div class="select" tabindex="0"> <span class="value">cherry</span> <ul class="optlist hidden"> <li class="option">cherry</li> <li class="option">lemon</li> <li class="option">banana</li> <li class="option">strawberry</li> <li class="option">apple</li> </ul> </div> </form> css content .widget select, .no-widget .select { position : absolute; left : -5000em; height : 0; overflow : hidden; } /* ------...
...--------- */ /* required styles */ /* --------------- */ .select { position: relative; display : inline-block; } .select.active, .select:focus { box-shadow: 0 0 3px 1px #227755; outline: none; } .select .optlist { position: absolute; top : 100%; left : 0; } .select .optlist.hidden { max-height: 0; visibility: hidden; } /* ------------ */ /* fancy styles */ /* ------------ */ .select { font-size : 0.625em; /* 10px */ font-family : verdana, arial, sans-serif; -moz-box-sizing : border-box; box-sizing : border-box; padding : 0.1em 2.5em 0.2em 0.5em; /* 1px 25px 2px 5px */ width : 10em; /* 100px */ border : 0.2em solid #000; /* 2px */ border-radius : 0.4em; /* 4px */ box-shadow : 0 0.1em 0.2em rgba(0,0,0,.45); /* 0 1px 2px */ backgrou...
...nd : #f0f0f0; background : -webkit-linear-gradient(90deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); background : linear-gradient(0deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); } .select .value { display : inline-block; width : 100%; overflow : hidden; white-space : nowrap; text-overflow : ellipsis; vertical-align: top; } .select:after { content : "▼"; position: absolute; z-index : 1; height : 100%; width : 2em; /* 20px */ top : 0; right : 0; padding-top : .1em; -moz-box-sizing : border-box; box-sizing : border-box; text-align : center; border-left : .2em solid #000; border-radius: 0 .1em .1em 0; background-color : #000; color : #fff; } .select .optlist { z-index : 2; list-style: none; margin : 0; padding: 0; background: #f0f0f0; ...
...And 3 more matches
Sending forms through JavaScript - Learn web development
let's look at an example: <button>click me!</button> and now the javascript: const btn = document.queryselector('button'); function senddata( data ) { console.log( 'sending data' ); const xhr = new xmlhttprequest(); let urlencodeddata = "", urlencodeddatapairs = [], name; // turn the data object into an array of url-encoded key/value pairs.
...now for the javascript: const btn = document.queryselector('button'); function senddata( data ) { const xhr = new xmlhttprequest(), fd = new formdata(); // push our data into our formdata object for( name in data ) { fd.append( name, data[ name ] ); } // define what happens on successful data submission xhr.addeventlistener( 'load', function( event ) { alert( 'yeah!
... dom : document.getelementbyid( "thefile" ), binary : null }; // use the filereader api to access file content const reader = new filereader(); // because filereader is asynchronous, store its // result when it finishes to read the file reader.addeventlistener( "load", function () { file.binary = reader.result; } ); // at page load, if a file is already selected, read it.
...And 3 more matches
Styling web forms - Learn web development
these include: <input type="color"> date-related controls such as <input type="datetime-local"> <input type="range"> <input type="file"> elements involved in creating dropdown widgets, including <select>, <option>, <optgroup> and <datalist>.
... the real problem with all these controls is that they have a very complex structure, and beyond some basic styling (such as changing the width or margin of the control) you generally don't have the ability to style the controls' internal components (such as the date picker calendar, or the button on the <select> that causes the options list to display) making up those widgets.
... as well as the basic css tools covered above, we've also been provided with several selectors — ui pseudo-classes — that enable styling based on the current state of the ui.
...And 3 more matches
Getting started with HTML - Learn web development
font-family: 'open sans light',helvetica,arial,sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...And 3 more matches
From object to iframe — other embedding technologies - Learn web development
below the video, you'll find a share button — select this to display the sharing options.
... select the embed button and you'll be given some <iframe> code — copy this.
... select the share or embed map option.
...And 3 more matches
Video and audio content - Learn web development
things become slightly more complicated because not only does each browser support a different set of container file formats, they also each support a different selection of codecs.
...see choosing the right container in media container formats (file types) for help selecting the container file format best suited for your needs; similarly, see choosing a video codec in web video codec guide and choosing an audio codec in web audio codec guide for help selecting the first media codecs to use for your content and your target audience.
... refer to our guide to media types and formats for help selecting the best containers and codecs for your needs, as well as to look up the right mime types to specify for each.
...And 3 more matches
Fetching data from the server - Learn web development
in this example, we will load a different verse of the poem (which you may well recognize) via xhr when it's selected in the drop-down menu.
...this stores a reference to the <select> and <pre> elements in constants and defines an onchange event handler function so that when the select's value is changed, its value is passed to an invoked function updatedisplay() as a parameter.
... const versechoose = document.queryselector('select'); const poemdisplay = document.queryselector('pre'); versechoose.onchange = function() { const verse = versechoose.value; updatedisplay(verse); }; let's define our updatedisplay() function.
...And 3 more matches
Arrays - Learn web development
playable code <h2>live output</h2> <div class="output" style="min-height: 150px;"> <ul> </ul> <p></p> </div> <h2>editable code</h2> <p class="a11y-label">press esc to move focus away from the code area (tab inserts a tab character).</p> <textarea id="code" class="playable-code" style="height: 410px;width: 95%"> const list = document.queryselector('.output ul'); const totalbox = document.queryselector('.output p'); let total = 0; list.innerhtml = ''; totalbox.textcontent = ''; // number 1 'underpants:6.99' 'socks:5.99' 't-shirt:14.99' 'trousers:31.99' 'shoes:23.99'; for (let i = 0; i <= 0; i++) { // number 2 // number 3 // number 4 // number 5 let ...
...utionentry = jssolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === 'show solution') { textarea.value = solutionentry; solution.value = 'hide solution'; } else { textarea.value = userentry; solution.value = 'show solution'; } updatecode(); }); const jssolution = 'const list = document.queryselector(\'.output ul\');\nconst totalbox = document.queryselector(\'.output p\');\nlet total = 0;\nlist.innerhtml = \'\';\ntotalbox.textcontent = \'\';\n\nlet products = [\'underpants:6.99\',\n \'socks:5.99\',\n \'t-shirt:14.99\',\n \'trousers:31.99\',\n \'shoes:23.99\'];\n\nfor(let i = 0; i < products.length; i++) {\n let subarray = products[i].split(\':\');\n let name = subarray[0];\n let pric...
...entlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every ...
...And 3 more matches
mozbrowsercaretstatechanged
the mozbrowsercaretstatechanged event is fired when the user selects content in a page loaded in a browser <iframe>.
... details the details property returns an anonymous javascript object with the following properties: rect an object that defines information about the bounding rectangle of the current selection.
...its properties are canselectall: a boolean indicating whether the selectall command is available (true) or not (false.) cancut: a boolean indicating whether the cut command is available (true) or not (false.) cancopy: a boolean indicating whether the copy command is available (true) or not (false.) canpaste: a boolean indicating whether the paste command is available (true) or not (false.) reason a domstring that...
...And 3 more matches
IAccessibleTableCell
.2 inherits from: iunknown last changed in gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) method overview [propget] hresult columnextent([out] long ncolumnsspanned ); [propget] hresult columnheadercells([out, size_is(, ncolumnheadercells,)] iunknown cellaccessibles, [out] long ncolumnheadercells ); [propget] hresult columnindex([out] long columnindex ); [propget] hresult isselected([out] boolean isselected ); [propget] hresult rowcolumnextents([out] long row, [out] long column, [out] long rowextents, [out] long columnextents, [out] boolean isselected ); [propget] hresult rowextent([out] long nrowsspanned ); [propget] hresult rowheadercells([out, size_is(, nrowheadercells,)] iunknown cellaccessibles, [out] long nrowheadercells ); [propget] hresult rowindex([out] lo...
...isselected() returns a boolean value indicating whether this cell is selected.
... [propget] hresult isselected( [out] boolean isselected ); parameters isselected returns true if the specified cell is selected and false otherwise.
...And 3 more matches
inIDOMUtils
y, size_is(acount)] out wstring aprops); nsisupportsarray getcssstylerules(in nsidomelement aelement, [optional] in domstring apseudo); nsidomnode getparentfornode(in nsidomnode anode, in boolean ashowinganonymouscontent); unsigned long getruleline(in nsidomcssstylerule arule); unsigned long getrulecolumn(in nsidomcssstylerule arule); unsigned long getselectorcount(in nsidomcssstylerule arule); astring getselectortext(in nsidomcssstylerule arule, in unsigned long aselectorindex); unsigned long long getspecificity(in nsidomcssstylerule arule, in unsigned long aselectorindex); nsidomfontfacelist getusedfontfaces(in nsidomrange arange); bool haspseudoclasslock(in nsidomelement aelement, in domstring apseudoclass); ...
... boolean isignorablewhitespace(in nsidomcharacterdata adatanode); bool isinheritedproperty(in astring apropertyname); void parsestylesheet(in nsidomcssstylesheet asheet, in domstring ainput); void removepseudoclasslock(in nsidomelement aelement, in domstring apseudoclass); astring rgbtocolorname(in octet ar, in octet ag, in octet ab); bool selectormatcheselement(in nsidomelement aelement, in nsidomcssstylerule arule, in unsigned long aselectorindex, [optional] in domstring apseudo); void setcontentstate(in nsidomelement aelement, in unsigned long long astate); constants constant value description exclude_shorthands (1<<0) include_aliases (1<<1) content state flags the conte...
... selectormatcheselement() checks if a given selector from a style rule matches an element.
...And 3 more matches
nsIClipboard
ichclipboard); obsolete since gecko 1.8 void getdata(in nsitransferable atransferable, in long awhichclipboard); boolean hasdatamatchingflavors([array, size_is(alength)] in string aflavorlist, in unsigned long alength, in long awhichclipboard); void setdata(in nsitransferable atransferable, in nsiclipboardowner anowner, in long awhichclipboard); boolean supportsselectionclipboard(); boolean supportsfindclipboard(); constants most clipboard operations in firefox use kglobalclipboard, which is the one also used by the typical control-c/control-v keyboard shortcuts.
... the kselectionclipboard is peculiar to the x windows system, where it refers to the primary selection, which is the one that simple mouse selection and middle-click paste operations are using.
... constant value description kselectionclipboard 0 clipboard for selection.
...And 3 more matches
nsIMsgDBViewCommandUpdater
the nsimsgdbviewcommandupdater interface controls changes that occur as the selection changes.
...dupdater (for the standalone message window) nsmsgdbviewcommandupdater (for the threadpane message window) nsmsgsearchcommandupdater (for search dialogs) method overview void updatecommandstatus(); void displaymessagechanged(in nsimsgfolder afolder, in astring asubject, in acstring akeywords); void updatenextmessageafterdelete(); methods updatecommandstatus() called when the number of selected items changes.
... void displaymessagechanged(in nsimsgfolder afolder, in astring asubject, in acstring akeywords ); parameters afolder the folder containing selected message.
...And 3 more matches
Storage
teger)"); similarly, the c++ looks like this: rv = mdbconn->executesimplesql(ns_literal_cstring("create temp table table_name (column_name integer)")); ns_ensure_success(rv, rv); results to be returned however, if you need to get results back, you should create the statement with the mozistorageconnection.createstatement() api like this in javascript: var statement = dbconn.createstatement("select * from table_name where column_name = :parameter"); this example uses a named placeholder called "parameter" to be bound later (described in binding parameters).
... similarly, the c++ looks like this: nscomptr<mozistoragestatement> statement; rv = dbconn->createstatement(ns_literal_cstring("select * from table_name where column_name = ?1"), getter_addrefs(statement)); ns_ensure_success(rv, rv); this example uses the numbered placeholder indexed by zero for a parameter to be bound later (described in binding parameters).
...in javascript, there is a useful helper object (mozistoragestatementparams) available () that makes binding parameters much easier: var statement = dbconn.createstatement("select * from table_name where id = :row_id"); statement.params.row_id = 1234; use :boundparametername the same way for numeric and non-numeric columns.
...And 3 more matches
UI Tour - Firefox Developer Tools
pane the contents of the third pane depend on the current state of the debugger and may include the following sections: toolbar watch expressions breakpoints call stack scopes xhr breakpoints event listener breakpoints dom mutation breakpoints source list pane the source list pane lists all the javascript source files loaded into the page, and enables you to select one to debug.
...the name of the selected directory is shown at the top of the source list pane; clicking this name reverts the pane to showing all source items.
... ignore (since firefox 76) ignore files in this directory causes all files within the selected directory to be skipped by the debugger.
...And 3 more matches
Tutorial: Show Allocations Per Call Path - Firefox Developer Tools
visit the url about:config, and set the devtools.chrome.enabled preference to true: setting the 'devtools.chrome.enabled' preference open a developer scratchpad (menu button > developer > scratchpad), and select "browser" from the "environment" menu.
... (this menu will not be present unless you have changed the preference as explained above.) selecting the 'browser' context in the scratchpad enter the following code in the scratchpad: // this simply defines the 'debugger' constructor in this // scratchpad; it doesn't actually start debugging anything.
... var dbg; // start measuring the selected tab's main window's memory // consumption.
...And 3 more matches
Edit fonts - Firefox Developer Tools
select the fonts tab; the last of the tabs shown in the right-hand side of the css pane.
...you can select values using the slider or enter a numeric value directly into the text box.
...you can select values using the slider or enter a numeric value directly into the text box.
...And 3 more matches
Using the CSS Typed Object Model - Web APIs
// get the element const myelement = document.queryselector('a'); // get the <dl> we'll be populating const styleslist = document.queryselector('#regurgitation'); // retrieve all computed styles with computedstylemap() const defaultcomputedstyles = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of defaultcomputedstyles) { // properties const cssproperty ...
...update the javascript on line 2 to select the <p> rather than the <a>.
...d an inhertable property: p { font-weight: bold; } a { --color: red; color: var(--color); } instead of getting all the properties, we create an array of properties of interest and use the stylepropertymapreadonly.get() method to get each of their values: <p> <a href="https://example.com">link</a> </p> <dl id="regurgitation"></dl> // get the element const myelement = document.queryselector('a'); // get the <dl> we'll be populating const styleslist = document.queryselector('#regurgitation'); // retrieve all computed styles with computedstylemap() const allcomputedstyles = myelement.computedstylemap(); // array of properties we're interested in const ofinterest = ['font-weight', 'border-left-color', 'color', '--color']; // iterate through our properties of interest for ( let i ...
...And 3 more matches
Element.matches() - Web APIs
WebAPIElementmatches
the matches() method checks to see if the element would be selected by the provided selectorstring -- in other words -- checks if the element "is" the selector.
... syntax var result = element.matches(selectorstring); parameters selectorstring is a string representing the selector to test.
... exceptions syntax_err the specified selector string is invalid.
...And 3 more matches
HTMLInputElement.webkitdirectory - Web APIs
the htmlinputelement.webkitdirectory is a property that reflects the webkitdirectory html attribute and indicates that the <input> element should let the user select directories instead of files.
... when a directory is selected, the directory and its entire hierarchy of contents are included in the set of selected items.
... the selected file system entries can be obtained using the webkitentries property.
...And 3 more matches
ParentNode.replaceChildren() - Web APIs
this html might look something like this: <h2>party food option list</h2> <main> <div> <label for="no">no thanks!</label> <select id="no" multiple size="10"> <option>apples</option> <option>oranges</option> <option>grapes</option> <option>bananas</option> <option>kiwi fruits</option> <option>chocolate cookies</option> <option>peanut cookies</option> <option>chocolate bars</option> <option>ham sandwiches</option> <option>cheese sandwiches</option> <option>fala...
...fel sandwiches</option> <option>ice cream</option> <option>jelly</option> <option>carrot sticks and houmous</option> <option>margherita pizza</option> <option>pepperoni pizza</option> <option>vegan veggie pizza</option> </select> </div> <div class="buttons"> <button id="to-yes">transfer to "yes" --&gt;</button> <button id="to-no">&lt;-- transfer to "no"</button> </div> <div> <label for="yes">yes please!</label> <select id="yes" multiple size="10"> </select> </div> </main> it would make sense to use some simple css to lay out the two select lists in a line alongside one another, with the control buttons in between them: main { display: flex; } div { margin-right: 20px; } label, button { display: block; } .buttons...
... { display: flex; flex-flow: column; justify-content: center; } select { width: 200px; } what we want to do is transfer any selected options in the "no" list over to the "yes" list when the "yes" button is pressed, and transfer any selected options in the "yes" list over to the "no" list when the "no" button is pressed.
...And 3 more matches
Using the slider role - Accessibility
the slider role is used for markup that allows a user to select a value from within a given range.
...arrow keys should operate as follows (localization for right-to-left languages should reverse the direction of the arrows): key(s) action right and up arrows increase the selected value left and down arrows decrease the selected value page up and page down optionally increase and decrease the value by a set amount (e.g.
... examples example 1: simple numerical range in the example below, a simple slider is used to select a value between 1 and 100.
...And 3 more matches
An overview of accessible web applications and widgets - Accessibility
states describe the current interaction state of an element, informing the assistive technology if it is busy, disabled, selected, or hidden.
...tate of a checkbox or radio button aria-disabled: indicates that an element is visible, but not editable or otherwise operable aria-grabbed: indicates the 'grabbed' state of an object in a drag-and-drop operation (for a full list of aria states, consult the aria list of states and properties.) developers should use aria states to indicate the state of ui widget elements and use css attribute selectors to alter the visual appearance based on the state changes (rather than using script to change a class name on the element).
...attribute-based selector for indicating state div.tooltip[aria-hidden="true"] { display: none; } the javascript to update the aria-hidden property has the form shown in example 2c.
...And 3 more matches
-moz-user-focus - CSS: Cascading Style Sheets
select-after ?
... select-before ?
... select-menu ?
...And 3 more matches
::slotted() - CSS: Cascading Style Sheets
WebCSS::slotted
note also that this selector won't select a text node placed into a slot; it only targets actual elements.
... /* selects any element placed inside a slot */ ::slotted(*) { font-weight: bold; } /* selects any <span> placed inside a slot */ ::slotted(span) { font-weight: bold; } syntax ::slotted( <compound-selector-list> )where <compound-selector-list> = <compound-selector>#where <compound-selector> = [ <type-selector>?
... <subclass-selector>* [ <pseudo-element-selector> <pseudo-class-selector>* ]* ]!where <type-selector> = <wq-name> | <ns-prefix>?
...And 3 more matches
:checked - CSS: Cascading Style Sheets
WebCSS:checked
the :checked css pseudo-class selector represents any radio (<input type="radio">), checkbox (<input type="checkbox">), or option (<option> in a <select>) element that is checked or toggled to an on state.
... /* matches any checked/selected radio, checkbox, or option */ :checked { margin-left: 25px; border: 1px solid blue; } the user can engage this state by checking/selecting an element, or disengage it by unchecking/deselecting the element.
... syntax :checked examples basic example html <div> <input type="radio" name="my-input" id="yes"> <label for="yes">yes</label> <input type="radio" name="my-input" id="no"> <label for="no">no</label> </div> <div> <input type="checkbox" name="my-checkbox" id="opt-in"> <label for="opt-in">check me!</label> </div> <select name="my-select" id="fruit"> <option value="opt1">apples</option> <option value="opt2">grapes</option> <option value="opt3">pears</option> </select> css div, select { margin: 8px; } /* labels for checked inputs */ input:checked + label { color: red; } /* radio element, when checked */ input[type="radio"]:checked { box-shadow: 0 0 0 3px orange; } /* checkbox element, when checked...
...And 3 more matches
:scope - CSS: Cascading Style Sheets
WebCSS:scope
the :scope css pseudo-class represents elements that are a reference point for selectors to match against.
... /* selects a scoped element */ :scope { background-color: lime; } currently, when used in a stylesheet, :scope is the same as :root, since there is not at this time a way to explicitly establish a scoped element.
... when used from a dom api such as queryselector(), queryselectorall(), matches(), or element.closest(), :scope matches the element on which the method was called.
...And 3 more matches
:visited - CSS: Cascading Style Sheets
WebCSS:visited
for privacy reasons, the styles that can be modified using this selector are very limited.
... /* selects any <a> that has been visited */ a:visited { color: green; } styles defined by the :visited pseudo-class will be overridden by any subsequent link-related pseudo-class (:link, :hover, or :active) that has at least equal specificity.
... note: for more information on these limitations and the reasons behind them, see privacy and the :visited selector.
...And 3 more matches
Pseudo-classes - CSS: Cascading Style Sheets
a css pseudo-class is a keyword added to a selector that specifies a special state of the selected element(s).
... syntax selector:pseudo-class { property: value; } like regular classes, you can chain together as many pseudo-classes as you want in a selector.
... html living standard living standard defines when particular selectors match html elements.
...And 3 more matches
Syntax - CSS: Cascading Style Sheets
WebCSSSyntax
each (valid) declaration block is preceded by one or more comma-separated selectors, which are conditions selecting some elements of the page.
... a selector group and an associated declarations block, together, are called a ruleset, or often simply a rule.
... as an element of the page may be matched by several selectors, and therefore by several rules potentially containing a given property several times, with different values, the css standard defines which one has precedence over the other and must be applied: this is called the cascade algorithm.
...And 3 more matches
font-style - CSS: Cascading Style Sheets
values normal selects a font that is classified as normal within a font-family.
... italic selects a font that is classified as italic.
... oblique selects a font that is classified as oblique.
...And 3 more matches
Rich-Text Editing in Mozilla - Developer guides
most commands affect the document's selection (bold, italics, etc), while others insert new elements (adding a link) or affect an entire line (indenting).
...reatetextnode(odoc.innerhtml); odoc.innerhtml = ""; var opre = document.createelement("pre"); odoc.contenteditable = false; opre.id = "sourcetext"; opre.contenteditable = true; opre.appendchild(ocontent); odoc.appendchild(opre); } else { if (document.all) { odoc.innerhtml = odoc.innertext; } else { ocontent = document.createrange(); ocontent.selectnodecontents(odoc.firstchild); odoc.innerhtml = ocontent.tostring(); } odoc.contenteditable = true; } odoc.focus(); } function printdoc() { if (!validatemode()) { return; } var oprntwin = window.open("","_blank","width=450,height=470,left=400,top=100,menubar=yes,toolbar=no,location=no,scrollbars=yes"); oprntwin.document.open(); oprntwin.document.write("<!doctype html><ht...
...ml><head><title>print<\/title><\/head><body onload=\"print();\">" + odoc.innerhtml + "<\/body><\/html>"); oprntwin.document.close(); } </script> <style type="text/css"> .intlink { cursor: pointer; } img.intlink { border: 0; } #toolbar1 select { font-size:10px; } #textbox { width: 540px; height: 200px; border: 1px #000000 solid; padding: 12px; overflow: scroll; } #textbox #sourcetext { padding: 0; margin: 0; min-width: 498px; min-height: 200px; } #editmode label { cursor: pointer; } </style> </head> <body onload="initdoc();"> <form name="compform" method="post" action="sample.php" onsubmit="if(validatemode()){this.mydoc.value=odoc.innerhtml;return true;}return false;"> <input type="hidden" name="mydoc"> <div id="toolbar1"> <select onchange="formatdoc('formatblock',this[this.se...
...And 3 more matches
Making content editable - Developer guides
most commands affect the document's selection by, for example, applying a style to the text (bold, italics, etc), while others insert new elements (like adding a link) or affect an entire line (indenting).
...= document.createelement("pre"); odoc.contenteditable = false; opre.id = "sourcetext"; opre.contenteditable = true; opre.appendchild(ocontent); odoc.appendchild(opre); document.execcommand("defaultparagraphseparator", false, "div"); } else { if (document.all) { odoc.innerhtml = odoc.innertext; } else { ocontent = document.createrange(); ocontent.selectnodecontents(odoc.firstchild); odoc.innerhtml = ocontent.tostring(); } odoc.contenteditable = true; } odoc.focus(); } function printdoc() { if (!validatemode()) { return; } var oprntwin = window.open("","_blank","width=450,height=470,left=400,top=100,menubar=yes,toolbar=no,location=no,scrollbars=yes"); oprntwin.document.open(); oprntwin.document.write("<!doctype html><ht...
...ml><head><title>print<\/title><\/head><body onload=\"print();\">" + odoc.innerhtml + "<\/body><\/html>"); oprntwin.document.close(); } </script> <style type="text/css"> .intlink { cursor: pointer; } img.intlink { border: 0; } #toolbar1 select { font-size:10px; } #textbox { width: 540px; height: 200px; border: 1px #000000 solid; padding: 12px; overflow: scroll; } #textbox #sourcetext { padding: 0; margin: 0; min-width: 498px; min-height: 200px; } #editmode label { cursor: pointer; } </style> </head> <body onload="initdoc();"> <form name="compform" method="post" action="sample.php" onsubmit="if(validatemode()){this.mydoc.value=odoc.innerhtml;return true;}return false;"> <input type="hidden" name="mydoc"> <div id="toolbar1"> <select onchange="formatdoc('formatblock',this[this.se...
...And 3 more matches
disabled - HTML: Hypertext Markup Language
the disabled attribute is supported by <button>, <command>, <fieldset>, <keygen>, <optgroup>, <option>, <select>, <textarea> and <input>.
...if declared on an <optgroup>, the select is still interactive (unless otherwise disabled), but none of the items in the option group are selectable.
...the <option>s are disabled, but the <select> itself is not.
...And 3 more matches
<input type="button"> - HTML: Hypertext Markup Language
WebHTMLElementinputbutton
a simple button we'll begin by creating a simple button with a click event handler that starts our machine (well, it toggles the value of the button and the text content of the following paragraph): <form> <input type="button" value="start machine"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } the script gets a refe...
... <form> <input type="button" value="start machine" accesskey="s"> </form> <p>the machine is stopped.</p> const button = document.queryselector('input'); const paragraph = document.queryselector('p'); button.addeventlistener('click', updatebutton); function updatebutton() { if (button.value === 'start machine') { button.value = 'stop machine'; paragraph.textcontent = 'the machine has started!'; } else { button.value = 'start machine'; paragraph.textcontent = 'the machine is stopped.'; } } note: the problem ...
... hidden code 1 <input type="button" value="enabled"> const button = document.queryselector('input'); button.addeventlistener('click', disablebutton); function disablebutton() { button.disabled = true; button.value = 'disabled'; window.settimeout(function() { button.disabled = false; button.value = 'enabled'; }, 2000); } if the disabled attribute isn't specified, the button inherits its disabled state from its parent element.
...And 3 more matches
<input type="url"> - HTML: Hypertext Markup Language
WebHTMLElementinputurl
value a domstring representing a url, or empty events change and input supported common attributes autocomplete, list, maxlength, minlength, pattern, placeholder, readonly, required and size idl attributes list, value, selectionend, selectiondirection methods select(), setrangetext() and setselectionrange().
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
...if maxlength exceeds size, the input box's contents will scroll as needed to show the current selection or insertion point as the content is manipulated.
...And 3 more matches
<option>: The HTML Option element - HTML: Hypertext Markup Language
WebHTMLElementoption
the html <option> element is used to define an item contained in a <select>, an <optgroup>, or a <datalist> element.
... permitted parents a <select>, an <optgroup> or a <datalist> element.
... selected if present, this boolean attribute indicates that the option is initially selected.
...And 3 more matches
HTTP Index - HTTP
WebHTTPIndex
20 cross-origin resource sharing (cors) ajax, cors, cross-origin resource sharing, fetch, fetch api, http, http access controls, same-origin policy, security, xmlhttprequest, l10n:priority cross-origin resource sharing (cors) is a mechanism that uses additional http headers to tell browsers to give a web application running at one origin, access to selected resources from a different origin.
... 37 feature policy feature policy, feature-policy, http, reference, security, header feature policy allows web developers to selectively enable, disable, and modify the behavior of certain features and apis in the browser.
...using content negotiation, the server then selects one of the proposals, uses it and informs the client of its choice with the content-type response header.
...And 3 more matches
ui/button/toggle - Archive of obsolete content
if you specify multiple icons, firefox will select the best-fitting icon based on the device screen resolution and the place the icon appears.
...a special shortcut allows you to pass the string "window" or "tab" to select the currently active window or tab.
... to get or set window-specific state, this needs to be the window object for which you wish to set a specific state, or the string "window" to select the currently active window.
...And 2 more matches
Adding sidebars - Archive of obsolete content
you can see an example of a tabbox element if you open the firefox preferences window and select the advanced section.
...--> </tabpanel> </tabpanels> </tabbox> the first tab is selected by default, but you can change the default selection by setting the selected attribute to true in the « xul reference « element.
...it only displays one of its child nodes at a time, depending on its selectedindex value.
...And 2 more matches
Tamarin build documentation - Archive of obsolete content
the work for that fix also included some changes to the configure.py default behavior to decouple the --target switch from sdk choice: there is a new switch, --mac-sdk, that selects the 10.4u, 10.5 or 10.6 sdk.
... note: now that bug 478714 has been fixed, the name of the (shell) executable will always be "avm.exe" no matter which build configuration you select.
...note that, whereas before when you selected the aggregate target you got a 'shell' 32-bit executable and a 'shell64' 64-bit executable in the same folder, now because of the fix to bug 478714 you will get an 'avm' executable in two separate folders, /debug and /debug64 respectively.
...And 2 more matches
Anonymous Content - Archive of obsolete content
xpath selectors specified using the includes attribute determine which insertion point a given child should be placed under.
... the insertion point used for a given piece of content is the first encountered with a selector whose node set matches the element when doing a depth-first walk of the content template.
... anonymous content and css selectors and scopes bindings can interleave anonymous elements between the bound element and its explicit children.
...And 2 more matches
Attribute (XUL) - Archive of obsolete content
« xul reference home acceltext accessible accesskey activetitlebarcolor afterselected align allowevents allownegativeassertions alternatingbackground alwaysopenpopup attribute autocheck autocompleteenabled autocompletepopup autocompletesearch autocompletesearchparam autofill autofillaftermatch autoscroll beforeselected buttonaccesskeyaccept buttonaccesskeycancel buttonaccesskeydisclosure buttonaccesskeyextra1 buttonaccesskeyextra2 buttonaccesskeyhelp buttonalign buttondir buttondisabledaccept buttonlabelaccept buttonlabelcancel buttonlabeldisclosure buttonlabelextra1 buttonlabelextra2 buttonlabelhelp buttonorient buttonpack buttons checked checkstate clicktoscroll class closebutton closemenu coalesceduplicatearcs collapse collapsed colo...
...r cols command commandupdater completedefaultindex container containment contentcontextmenu contenttooltip context contextmenu control crop curpos current currentset customindex customizable cycler datasources decimalplaces default defaultbutton defaultset description dir disableautocomplete disableautoselect disableclose disabled disablehistory disablekeynavigation disablesecurity dlgtype dragging editable editortype element empty emptytext deprecated since gecko 2 enablecolumndrag enablehistory equalsize eventnode events expr firstdayofweek firstpage first-tab fixed flags flex focused forcecomplete grippyhidden grippytooltiptext group handlectrltab height helpuri hidden hidechrome hidecolumnpicker hideheader hideseconds hidespin...
...buttons highlightnonmatches homepage href icon id ignoreblurwhilesearching ignorecase ignoreincolumnpicker ignorekeys image inactivetitlebarcolor increment index inputtooltiptext insertafter insertbefore instantapply inverted iscontainer isempty key keycode keytext label lastpage lastselected last-tab left linkedpanel max maxheight maxlength maxpos maxrows maxwidth member menu menuactive min minheight minresultsforpopup minwidth mode modifiers mousethrough movetoclick multiline multiple name negate newlines next noautofocus noautohide noinitialfocus nomatch norestorefocus object observes onbeforeaccept onbookmarkgroup onchange onclick onclosetab oncommand oncommandupdate ondialogaccept ondialogcancel ondialogclosure ondialo...
...And 2 more matches
XUL Events - Archive of obsolete content
attribute: onmouseup select this event is sent to a listbox or tree when an item is selected.
... attribute: onselect unload this event is sent to a window when the window has closed.
...menus can be activated by selecting them with the mouse or by pressing a shortcut key.
...And 2 more matches
List of commands - Archive of obsolete content
list of commands (grouped by type) nsdomwindowcontroller commands (generally legal when there is a selection): cmd_copy - copy a selection to the clipboard cmd_cut - cut a selection into the clipboard cmd_paste - paste a selection from the clipboard cmd_selectall cmd_selectnone cmd_copylink cmd_copyimagelocation cmd_copyimagecontents cmd_scrolltop cmd_scrollbottom cmd_scrollpageup cmd_scrollpagedown cmd_scrolllineup cmd_scrolllinedown cmd_scrollleft cmd_scrollright cmd_selectcharprevious cmd_selectcharnext cmd_wordprevious cmd_wordnext cmd_selectwordprevious cmd_selectwordnext cmd_beginline cmd_endline cmd_selectbeginline cmd_selectendline cmd_selectlineprevi...
...ous cmd_selectlinenext cmd_selectpageprevious cmd_selectpagenext cmd_selectmovetop cmd_selectmovebottom editor commands (legal when the focus is anywhere where you can type text): cmd_paste - paste a selection from the clipboard cmd_pastequote cmd_delete cmd_deletecharbackward cmd_deletecharforward cmd_deletewordbackward cmd_deletewordforward cmd_deletetobeginningofline cmd_deletetoendofline cmd_scrolltop cmd_scrollbottom cmd_movetop cmd_movebottom cmd_selecttop cmd_selectbottom cmd_linenext cmd_lineprevious cmd_selectlinenext cmd_selectlineprevious cmd_charprevious cmd_charnext cmd_selectcharprevious cmd_selectcharnext cmd_beginline cmd_endline cmd_selectbeginline cmd_selectendline cmd_wordprevious cmd_wordnext cmd_selectwordprevious cmd_selectwordnext c...
...md_scrollpageup cmd_scrollpagedown cmd_scrolllineup cmd_scrolllinedown cmd_movepageup cmd_movepagedown cmd_selectpageup cmd_selectpagedown other commands the following list other commands (prefixed by cmd_ or browser:) which have not been categorized here yet (though they are in the alphabetical list below): http://lxr.mozilla.org/seamonkey/sou...baroverlay.xul http://lxr.mozilla.org/seamonkey/sou...t/navigator.js http://lxr.mozilla.org/seamonkey/sou...toroverlay.xul http://lxr.mozilla.org/seamonkey/sou...onaltoolbar.js http://lxr.mozilla.org/seamonkey/sou...rceoverlay.xul http://lxr.mozilla.org/seamonkey/sou...extoverlay.xul http://lxr.mozilla.org/seamonkey/sou...lityoverlay.js http://lxr.mozilla.org/seamonkey/sou...oomoverlay.xul http://lxr.mozilla.org/seamonkey/sou...toro...
...And 2 more matches
OpenClose - Archive of obsolete content
closing menus menus will close automatically once the user has made a selection from the menu.
... when an menu item is selected, it fires a command event so that code may be used to perform an action.
... the user may cancel selecting a command from a menu by pressing the escape key.
...And 2 more matches
Creating a Skin - Archive of obsolete content
we will make the selected tab bold and change the rounding on the tabs.
... tab:first-child { -moz-border-radius: 4px 0px 0px 0px; } tab:last-child { -moz-border-radius: 0px 4px 0px 0px; } tab[selected="true"] { color: #000066; font-weight: bold; text-decoration: underline; } two rules change the normal tab appearance, the first sets the rounding on the first tab and the second sets the rounding on the last tab.
... the last rule only applies to tabs that have their selected attribute set to true.
...And 2 more matches
More Menu Features - Archive of obsolete content
the three dots after open search and save search are the usual way that you indicate to the user that a dialog will open when selecting the command.
...when the user selects the menu, the check state is switched.
...by setting its value to checkbox, the menu item can be checked on and off by selecting the menu item.
...And 2 more matches
The Chrome URL - Archive of obsolete content
this type of reference will automatically select an appropriate file from that right directory.
... for content, a file with the same name of the package and a xul extension is selected.
... in the above example, the file browser.xul is selected.
...And 2 more matches
Using the Editor from XUL - Archive of obsolete content
nstexteditorfocuslistener editor responds to focus and blur events by showing and hiding the caret or selection as appropriate.
... nsautoplaceholderbatch is a utility class that wraps text insertion with calls to turn off selection and layout updating (to avoid flicker), and the maintenance of a placeholder transaction.
...this code first deletes the selection if there is one (e.g.
...And 2 more matches
Using the standard theme - Archive of obsolete content
meaning, some internal default will be applied, which does by no means correspond to the standard theme (the theme currently chosen by the user in the theme selector), or even the default theme delivered with your the base application.
... applying the standard theme in order to use the theme currently chosen by the user of the base application (the so called "global skin"), you have to add the following line to your xul file: <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> this imports the styles found in the <tt>global/skin</tt> chrome directory and will make the standard xul widgets of your application use the selected chosen theme.
...stom.css" type="text/css"?> <tt>@import</tt> chains first, import the global skin in your custom style sheet using the css <tt>@import</tt> rule: @import url("chrome://global/skin/"); you then have to associate your xul file with your custom style sheet only: <?xml-stylesheet href="chrome://myextension/skin/custom.css" type="text/css"?> applying different custom style sheets depending on the selected theme mozilla is able to automatically pick your custom style sheet depending on the theme currently chosen by the user.
...And 2 more matches
prefwindow - Archive of obsolete content
you can also set the lastselected attribute on the prefwindow tag to the id of the pane to start with.
... attributes buttonalign, buttondir, buttonorient, buttonpack, buttons, defaultbutton, lastselected, onbeforeaccept, ondialogaccept, ondialogcancel, ondialogdisclosure, ondialoghelp, onload, onunload, title, type properties buttons, currentpane, defaultbutton, lastselected, preferencepanes, type methods acceptdialog, addpane, canceldialog, centerwindowonscreen, getbutton, opensubdialog, openwindow, showpane examples <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/ski...
... lastselected type: string set this to the id of the last selected pane.
...And 2 more matches
richlistitem - Archive of obsolete content
attributes disabled, searchlabel, selected, tabindex, value properties accessible, control, disabled, label, selected, tabindex, value examples (example needed) attributes disabled type: boolean indicates whether the element is disabled or not.
... selected type: boolean indicates whether the element is selected or not.
...to change the selection, set either the selectedindex or selecteditem property of the containing element.
...And 2 more matches
calICalendarView - Archive of obsolete content
y attribute calidatetime startdate; readonly attribute calidatetime enddate; readonly attribute boolean supportsdisjointdates; readonly attribute boolean hasdisjointdates; void setdatelist(in unsigned long acount, [array,size_is(acount)] in calidatetime adates); void getdatelist(out unsigned long acount, [array,size_is(acount),retval] out calidatetime adates); attribute caliitembase selecteditem; attribute calidatetime selectedday; attributes displaycalendar the displaycalendar is an implementation of the calicalendar interface.
... selecteditem returns a caliitembase corresponding to the currently active item in the view.
... other areas of the code may use this attribute for setting selection, editing purposes, or any other purpose.
...And 2 more matches
Issues Arising From Arbitrary-Element hover - Archive of obsolete content
bare pseudo-classes the second piece of the problem comes when we consider the effects of a "bare" pseudo-class in a selector.
...the most reliable fix is to add the anchor element to the selectors, like this: a:hover {color: red;} a.nav:hover {color: red;} in an attempt to avoid causing problems for legacy documents, browsers based on mozilla 1.0 and later (netscape 7+) include code that causes bare pseudo-classes to be restricted only to links if the document is rendered in "quirks" mode.
... in browsers based on the engine found in mozilla 1.3b and later, this quirk is extended to cover selectors that combine a bare class selector with the :hover pseudo-class (see bug 169078 for details).
...And 2 more matches
Index - MDN Web Docs Glossary: Definitions of Web-related terms
56 css object model (cssom) css, cssom, dom, glossary, web performance the css object model (cssom) is a map of all css selectors and relevant properties for each selector in the form of a tree, with a root node, sibling, descendant, child, and other relationship.
... 343 pseudo-class css, codingscripting, glossary, selector in css, a pseudo-class selector targets elements depending on their state rather than on information from the document tree.
... for example, the selector a:visited applies styles only to links that the user has already followed.
...And 2 more matches
Fundamental CSS comprehension - Learn web development
grab the css resources text file — this contains a set of raw selectors and rulesets that you'll need to study and combine to answer part of this assessment.
... taking care of the selectors and rulesets provided in the css resource file: next up, we'd like you to look at the four selectors, and calculate the specificity for each one.
... now it's time to put the right selector on the right rule set!
...And 2 more matches
Images, media, and form elements - Learn web development
we are using attribute selectors to target the different input types.
... button, input, select, textarea { font-family : inherit; font-size : 100%; } form elements and box-sizing across browsers form elements use different box sizing rules for different widgets.
... for consistency it is a good idea to set margins and padding to 0 on all elements, then add these back in when styling particular controls button, input, select, textarea { box-sizing: border-box; padding: 0; margin: 0; } other useful settings in addition to the rules mentioned above, you should also set overflow: auto on <textarea>s to stop ie showing a scrollbar when there is no need for one: textarea { overflow: auto; } putting it all together into a "reset" as a final step, we can wrap up the various properties discussed above into the following "form reset" to provide a consiste...
...And 2 more matches
Fundamental text and font styling - Learn web development
you can't select and style subsections of text unless you wrap them in an appropriate element (such as a <span> or <strong>), or use a text-specific pseudo-element like ::first-letter (selects the first letter of an element's text), ::first-line (selects the first line of an element's text), or ::selection (selects the text currently highlighted by the cursor.) fonts let's move straight on to look at propertie...
...but it was a rare occasion such as this that he did.</p> you can find the finished example on github (see also the source code.) color the color property sets the color of the foreground content of the selected elements (which is usually the text, but can also include a couple of other things, such as an underline or overline placed on text using the text-decoration property).
...but it was a rare occasion such as this that he did.</p> font families to set a different font on your text, you use the font-family property — this allows you to specify a font (or list of fonts) for the browser to apply to the selected elements.
...And 2 more matches
Example 2 - Learn web development
js html content <form class="no-widget"> <select name="myfruit"> <option>cherry</option> <option>lemon</option> <option>banana</option> <option>strawberry</option> <option>apple</option> </select> <div class="select"> <span class="value">cherry</span> <ul class="optlist hidden"> <li class="option">cherry</li> <li class="option">lemon</li> <li class="option">banana</li> <li class="option">strawberry</li> <li class="option">apple</li> </ul> </div> <form> css content .widget select, .no-widget .select { position : absolute; left : -5000em; height : 0; overflow : hidden; } /* --------------- */ /* required styles */ /* ----...
...----------- */ .select { position: relative; display : inline-block; } .select.active, .select:focus { box-shadow: 0 0 3px 1px #227755; outline: none; } .select .optlist { position: absolute; top : 100%; left : 0; } .select .optlist.hidden { max-height: 0; visibility: hidden; } /* ------------ */ /* fancy styles */ /* ------------ */ .select { font-size : 0.625em; /* 10px */ font-family : verdana, arial, sans-serif; -moz-box-sizing : border-box; box-sizing : border-box; padding : 0.1em 2.5em 0.2em 0.5em; /* 1px 25px 2px 5px */ width : 10em; /* 100px */ border : 0.2em solid #000; /* 2px */ border-radius : 0.4em; /* 4px */ box-shadow : 0 0.1em 0.2em rgba(0,0,0,.45); /* 0 1px 2px */ background : #f0f0f0; background : -webkit-linea...
...r-gradient(90deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); background : linear-gradient(0deg, #e3e3e3, #fcfcfc 50%, #f0f0f0); } .select .value { display : inline-block; width : 100%; overflow : hidden; white-space : nowrap; text-overflow : ellipsis; vertical-align: top; } .select:after { content : "▼"; position: absolute; z-index : 1; height : 100%; width : 2em; /* 20px */ top : 0; right : 0; padding-top : .1em; -moz-box-sizing : border-box; box-sizing : border-box; text-align : center; border-left : .2em solid #000; border-radius: 0 .1em .1em 0; background-color : #000; color : #fff; } .select .optlist { z-index : 2; list-style: none; margin : 0; padding: 0; background: #f0f0f0; border: .2em solid #000; border-top-wid...
...And 2 more matches
Build your own function - Learn web development
finally, add the following code inside the curly braces: const html = document.queryselector('html'); const panel = document.createelement('div'); panel.setattribute('class', 'msgbox'); html.appendchild(panel); const msg = document.createelement('p'); msg.textcontent = 'this is a message box'; panel.appendchild(msg); const closebtn = document.createelement('button'); closebtn.textcontent = 'x'; panel.appendchild(closebtn); closebtn.onclick = function() { panel.parentnode.removech...
... the first line uses a dom api function called document.queryselector() to select the <html> element and store a reference to it in a constant called html, so we can do things to it later on: const html = document.queryselector('html'); the next section uses another dom api function called document.createelement() to create a <div> element and store a reference to it in a constant called panel.
...this is to make it easier to style the element — if you look at the css on the page, you'll see that we are using a .msgbox class selector to style the message box and its contents.
...And 2 more matches
Server-side web frameworks - Learn web development
objective: to understand how web frameworks can simplify development/maintenance of server-side code and to get readers thinking about selecting a framework for their own development.
...the field definitions may also specify their maximum size, default values, selection list options, help text for documentation, label text for forms etc.
... #best/templates/best/index.html <!doctype html> <html lang="en"> <body> {% if youngest_teams %} <ul> {% for team in youngest_teams %} <li>{{ team.team_name }}</li> {% endfor %} </ul> {% else %} <p>no teams are available.</p> {% endif %} </body> </html> how to select a web framework numerous web frameworks exist for almost every programming language you might want to use (we list a few of the more popular frameworks in the following section).
...And 2 more matches
Handling common JavaScript problems - Learn web development
in firefox, the debugger tab looks as follows: on the left, you can select the script you want to debug (in this case we have only one).
... the center panel shows the code in the selected script.
...jquery for example provides its own fully-featured selectors and dom manipuation libraries, to allow css-selector type selecting of elements in javascript and easier dom building.
...And 2 more matches
Setting up your own test automation environment - Learn web development
add this line to the bottom of quick_test.js now: driver.get('http://mdn.github.io/learning-area/tools-testing/cross-browser-testing/accessibility/native-keyboard-accessibility.html'); interacting with the document now we've got a document to test, we need to interact with it in some way, which usually involves first selecting a specific element to test something about.
... you can select ui elements in many ways in webdriver, including by id, class, element name, etc.
... the actual selection is done by the findelement() method, which accepts as a parameter a selection method.
...And 2 more matches
Firefox UI considerations for web developers
how an icon is selected the new tab page chooses icons to use for top sites by trying a series of methods until it obtains an icon to use: a global "top sites" list is checked.
... if tippy top doesn't include the site, firefox looks in its places data store for icons specified in the page's <head> element; if an svg icon is available, that icon is selected.
...otherwise, the smallest image larger than 96 pixels wide is selected.
...And 2 more matches
Localizing with Koala
select firefox (3.6) in application column.
... select en-us (included) in original locale column.
... select x-testing (3.6) in user locale column.
...And 2 more matches
Localizing with Pontoon
next, simply select the project you want to work on and your locale from the dropdown menus.
... project selector (affiliates) switches between projects to localize.
... resource selector (homepage) switches between project resources to localize, like subpages or localization files.
...And 2 more matches
Index
each layer defines its own functions for the open/close/read/write/poll/select (etc.) functions.
... clearing the default provider has the same format: modutil -undefault "nss internal pkcs #11 module" -dbdir -mechanisms md2:md5 enabling and disabling modules and slots modules, and specific slots on modules, can be selectively enabled or disabled using modutil.
...if the cryptographic module does not support the requested algorithm, then the next best fit will be selected (usually the default).
...And 2 more matches
XForms Accessibility
upload provides a means for the user to select a file (see the spec, the docs).
... submit invokes the submission of the selected instance data to its target destination (see the spec, the docs).
... select allows the user to choose one or multiple values from a list of pre-defined values (see the spec, the docs).
...And 2 more matches
nsIAccessible
focus and selection in order to focus an accessible or get focused child accessible use nsiaccessible.takefocus() and nsiaccessible.focusedchild.
... to select an accessible you can use nsiaccessible.setselected(), nsiaccessible.takeselection() and nsiaccessible.extendselection().
... setselected this method adds or remove this accessible to the current selection.
...And 2 more matches
nsIAccessibleStates
state_selected 0x00000002 the object is selected, that is it indicates this object is the child of an object that allows its children to be selected and that this child is one of those children that has been selected.
... state_selectable 0x00200000 the object can be selected.
... state_multiselectable 0x01000000 supports multiple selection.
...And 2 more matches
nsIDOMNSHTMLDocument
inherits from: nsisupports last changed in gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3) method overview void captureevents(in long eventflags); void clear(); boolean execcommand(in domstring commandid, in boolean doshowui, in domstring value); boolean execcommandshowhelp(in domstring commandid); obsolete since gecko 14.0 domstring getselection(); nsidomdocument open(in acstring acontenttype, in boolean areplace); boolean querycommandenabled(in domstring commandid); boolean querycommandindeterm(in domstring commandid); boolean querycommandstate(in domstring commandid); boolean querycommandsupported(in domstring commandid); domstring querycommandtext(in domstring commandid); obsole...
...getselection() domstring getselection(); parameters none.
... return value the text of the current selection, the same as window.getselection.tostring().
...And 2 more matches
nsIMsgWindowCommands
method overview void selectfolder(in acstring folderuri); void selectmessage(in acstring messageuri); void clearmsgpane(); methods selectfolder() this method is called by the backend to change the folder displayed in the message window.
...void selectfolder( in acstring folderuri ); parameters folderuri the uri of the folder to select.
... selectmessage() this method is called by the backend to change the displayed message.
...And 2 more matches
nsINavHistoryResultViewObserver
inherits from: nsisupports last changed in gecko 1.9.0 method overview boolean candrop(in long index, in long orientation); void ondrop(in long row, in long orientation); void ontoggleopenstate(in long index); void oncycleheader(in nsitreecolumn column); void oncyclecell(in long row, in nsitreecolumn column); void onselectionchanged(); void onperformaction(in wstring action); void onperformactiononrow(in wstring action, in long row); void onperformactiononcell(in wstring action, in long row, in nsitreecolumn column); constants constant value description drop_before -1 the drag operation wishes to insert the dragged item before the indicated row.
... oncyclecell() called when a cell in a non-selectable cycling column (such as unread or flagged in thunderbird) is clicked.
... onselectionchanged() called when the selection in the tree changes.
...And 2 more matches
Thunderbird Configuration Files
if you are on mac os x, and on linux do edit > preferences on, select the advanced options panel, click on the general tab, and click on config editor.
...to do add a new preference, open the context menu (right-click) on any existing preference, go to the new menu, and select the type of preference.
...start explorer (just click on the my computer icon on your desktop) and select tools > folder options.
...And 2 more matches
Eyedropper - Firefox Developer Tools
the eyedropper tool enables you to select colors in the current page.
... it works like a magnifying glass over the page, enabling you to select with pixel precision.
... underneath the magnifying glass it shows the color value for the current pixel using whichever scheme you've selected in settings > inspector > default color unit: you can use it in one of two ways: to select a color from the page and copy it to the clipboard to change a color value in the inspector's rules view to a color you've selected from the page copying a color to the clipboard open the eyedropper in one of these two ways: select "eyedropper" under the "web developer" menu open the page inspector tab and click the eyedropper button in its toolbar as you move the mouse around the page you'll see the current color value in the eyedropper change.
...And 2 more matches
CSS Grid Inspector: Examine grid layouts - Firefox Developer Tools
clicking the icon toggles the display of a grid overlay on the page, which appears over the element, laid out like a grid to show the position of its grid lines and tracks: the overlay is still shown when you select other elements, so you can edit related css properties and see how the grid is affected.
... a name label to represent the grid, consisting of a selector identifying the html element that has the grid applied to it.
... a target icon that when clicked immediately selects the html element that this grid entry relates to, inside the html pane.
...And 2 more matches
Sorting algorithms comparison - Firefox Developer Tools
this program compares the performance of three different sorting algorithms: bubble sort selection sort quicksort it consists of the following functions: sortall() top-level function.
... sort() calls each of bubblesort(), selectionsort(), quicksort() in turn and logs the result.
... selectionsort() implements a selection sort, returning the sorted array.
...And 2 more matches
UI Tour - Firefox Developer Tools
at any given time, one recording is selected, and that recording is displayed in the rest of the tool.
... to select a different recording, click its entry in the pane.
... for example, in the screenshot below a long-running paint operation (shown as a green bar in the waterfall overview) corresponds to a drop in the frame rate: zooming in you can use the overview to select a slice of the recording to examine in more detail.
...And 2 more matches
Storage Inspector - Firefox Developer Tools
opening the storage inspector you can open the storage inspector by selecting "storage inspector" from the web developer submenu in the firefox menu panel (or tools menu if you display the menu bar or are on macos), or by pressing its shift + f9 keyboard shortcut.
... table widget the table widget displays a list of all the items corresponding to the selected tree item (be it an origin, or database) are listed.
...you can hide and show columns by context-clicking on the table header and selecting the columns you want to see: search there's a search box at the top of the table widget: this filters the table to show only items which match the search term.
...And 2 more matches
Style Editor - Firefox Developer Tools
from firefox 40 onwards, the style sheet pane also includes a context menu that lets you open the selected style sheet in a new tab.
...this is where the source for the selected style sheet is available for you to read and edit.
... to select these, visit about:config, select the setting devtools.editor.keymap, and assign "vim" or "emacs", or "sublime" to that setting.
...And 2 more matches
AudioContextLatencyCategory - Web APIs
the audiocontextlatencycategory type is an enumerated set of strings which are used to select one of a number of default values for acceptable maximum latency of an audio context.
... by using these strings rather than a numeric value when specifying a latency to a audiocontext, you can allow the user agent to select an appropriate latency for your use case that makes sense on the device on which your content is being used.
... values value description "balanced" the user agent should balance audio output latency and power consumption when selecting a latency value.
...And 2 more matches
DocumentFragment - Web APIs
documentfragment.queryselector() returns the first element node within the documentfragment, in document order, that matches the specified selectors.
... documentfragment.queryselectorall() returns a nodelist of all the element nodes within the documentfragment that match the specified selectors.
... example html <ul id="list"></ul> javascript var list = document.queryselector('#list') var fruits = ['apple', 'orange', 'banana', 'melon'] var fragment = new documentfragment() fruits.foreach(function (fruit) { var li = document.createelement('li') li.innerhtml = fruit fragment.appendchild(li) }) list.appendchild(fragment) result specifications specification status comment domthe definition of 'documentfragment' in that specific...
...And 2 more matches
FileList - Web APIs
WebAPIFileList
an object of this type is returned by the files property of the html <input> element; this lets you access the list of files selected with the <input type="file"> element.
... note: prior to gecko 1.9.2, the input element only supported a single file being selected at a time, meaning that the filelist would contain only one file.
... example this example iterates over all the files selected by the user using an input element: // fileinput is an html input element: <input type="file" id="myfileinput" multiple> var fileinput = document.getelementbyid("myfileinput"); // files is a filelist object (similar to nodelist) var files = fileinput.files; var file; // loop through files for (var i = 0; i < files.length; i++) { // get item file = files.item(i); //or file = ...
...And 2 more matches
RTCPeerConnection.getStats() - Web APIs
syntax promise = rtcpeerconnection.getstats(selector) parameters selector optional a mediastreamtrack for which to gather statistics.
...the contents of the report depend on the selector as well as other details of the connection.
... exceptions this method does not throw exceptions; instead, it rejects the returned promise with one of the following errors: invalidaccesserror there is no rtcrtpsender or rtcrtpreceiver whose track matches the specified selector, or selector matches more than one sender or receiver.
...And 2 more matches
Range.extractContents() - Web APIs
html id attributes are also cloned, which can lead to an invalid document if a partially-selected node is extracted and appended to the document.
... partially selected nodes are cloned to include the parent tags necessary to make the document fragment valid.
... syntax documentfragment = range.extractcontents(); example basic example var range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); var documentfragment = range.extractcontents(); document.body.appendchild(documentfragment); moving items between containers this example lets you move items between two containers.
...And 2 more matches
Generating HTML - Web APIs
<xsl:template match="/"> <html> <head> <title> <xsl:value-of select="/myns:article/myns:title"/> </title> <style type="text/css"> .mybox {margin:10px 155px 0 50px; border: 1px dotted #639ace; padding:0 5px 0 5px;} </style> </head> <body> <p class="mybox"> <span class="title"> <xsl:value-of select="/myns:article/myns:title"/> </span> </br> authors: <br /> <xsl:apply-templates...
... select="/myns:article/myns:authors/myns:author"/> </p> <p class="mybox"> <xsl:apply-templates select="//myns:body"/> </p> </body> </html> </xsl:template> ...
... <xsl:template match="myns:author"> -- <xsl:value-of select="." /> <xsl:if test="@company"> :: <b> <xsl:value-of select="@company" /> </b> </xsl:if> <br /> </xsl:template> <xsl:template match="myns:body"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:template> <xsl:template match="@*|node()"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:templa...
...And 2 more matches
ARIA live regions - Accessibility
when a planet is selected from the dropdown, a region on the page is updated with information about the selected planet.
... html <fieldset> <legend>planet information</legend> <label for="planetsselect">planet:</label> <select id="planetsselect" aria-controls="planetinfo"> <option value="">select a planet&hellip;</option> <option value="mercury">mercury</option> <option value="venus">venus</option> <option value="earth">earth</option> <option value="mars">mars</option> </select> <button id="renderplanetinfobutton">go</button> </fieldset> <div role="region" id="planetinfo" aria-live="polite"> <h2 id="planettitle">no planet selected</h2> <p id="planetdescription">select a planet to view its description</p> </div> <p><small>information courtesy <a href="https://en.wikipedia.org/wiki/solar_system#inner_solar_system">wikipedia</a></small></p> javascript const planets_info = { me...
...in english, mars carries a name of the roman god of war, and is often referred to as the "red planet".' } }; function renderplanetinfo(planet) { const planettitle = document.queryselector('#planettitle'); const planetdescription = document.queryselector('#planetdescription'); if (planet in planets_info) { planettitle.textcontent = planets_info[planet].title; planetdescription.textcontent = planets_info[planet].description; } else { planettitle.textcontent = 'no planet selected'; planetdescription.textcontent = 'select a planet to view its description'; }...
...And 2 more matches
ARIA: row role - Accessibility
a row can contain a number of attributes clarifying the row's role, including aria-colindex, aria-level, aria-rowindex, and aria-selected.
...if the interaction provides for the selection state of individual cells, if left to right and top to botton navigation is provided, or if the user interface allows the rearranging of cell order or otherwise changing individual cell order such as through drag and drop, use grid or treegrid instead.
... aria-selected state only relevant if the row is in an interactive container, such as a grid or treegrid, but not relevant if the row is in a table.
...And 2 more matches
:disabled - CSS: Cascading Style Sheets
WebCSS:disabled
an element is disabled if it can't be activated (selected, clicked on, typed into, etc.) or accept focus.
... /* selects any disabled <input> */ input:disabled { background: #ccc; } syntax :disabled examples this example shows a basic shipping form.
...e="text" placeholder="zip code" disabled> </fieldset> </form> css input[type="text"]:disabled { background: #ccc; } javascript // wait for the page to finish loading document.addeventlistener('domcontentloaded', function () { // attach `change` event listener to checkbox document.getelementbyid('billing-checkbox').onchange = togglebilling; }, false); function togglebilling() { // select the billing text fields var billingitems = document.queryselectorall('#billing input[type="text"]'); // toggle the billing text fields for (var i = 0; i < billingitems.length; i++) { billingitems[i].disabled = !billingitems[i].disabled; } } result specifications specification status comment html living standardthe definition of ':disabled' in that sp...
...And 2 more matches
:first-of-type - CSS: Cascading Style Sheets
/* selects any <p> that is the first element of its type among its siblings */ p:first-of-type { color: red; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
...note that the universal selector (*) is implied when no simple selector is written.
...And 2 more matches
:focus - CSS: Cascading Style Sheets
WebCSS:focus
it is generally triggered when the user clicks or taps on an element or selects it with the keyboard's tab key.
... /* selects any <input> when focused */ input:focus { color: red; } note: this pseudo-class applies only to the focused element itself.
... use :focus-within if you want to select an element that contains a focused element.
...And 2 more matches
:last-of-type - CSS: Cascading Style Sheets
/* selects any <p> that is the last element of its type among its siblings */ p:last-of-type { color: lime; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
...note that the universal selector (*) is implied when no simple selector is written.
...And 2 more matches
Introducing the CSS Cascade - CSS: Cascading Style Sheets
WebCSSCascade
as with @font-face, only the at-rule as a whole is selected via the cascade algorithm.
... origin of css declarations the css cascade algorithm's job is to select css declarations in order to determine the correct values for css properties.
...that means rules whose selector matches the given element and which are part of an appropriate media at-rule.
...And 2 more matches
WebKit CSS extensions - CSS: Cascading Style Sheets
tion -epub-text-emphasis-style -webkit-text-emphasis-style -webkit-text-justify -webkit-text-orientation -webkit-text-size-adjust -webkit-text-underline-position -webkit-transform -webkit-transform-origin -webkit-transform-style -webkit-transition -webkit-transition-delay -webkit-transition-duration -webkit-transition-property -webkit-transition-timing-function u-w -webkit-user-select -epub-word-break -epub-writing-mode supported in non-webkit browsers without a prefix, but not standard the following properties are supported in at least one browser without a prefix, but are not on the standards track.
...order -webkit-perspective -webkit-perspective-origin t -webkit-text-fill-color** -webkit-text-size-adjust -webkit-text-stroke** -webkit-text-stroke-color** -webkit-text-stroke-width** -webkit-transform -webkit-transform-origin -webkit-transition -webkit-transition-delay -webkit-transition-duration -webkit-transition-property -webkit-transition-timing-function u -webkit-user-select *supported with -moz- and -webkit- prefix in firefox, but not supported without a prefix.
... note: if there is an invalid pseudo-class within in a chain or group of selectors, the whole selector list is invalid.
...And 2 more matches
<filter-function> - CSS: Cascading Style Sheets
examples filter function comparison this example provides a simple graphic, along with a select menu to allow you to choose between the different types of filter function, and a slider to allow you to vary the values used inside the filter function.
... html <div></div> <ul> <li> <label for="filter-select">choose a filter function:</label> <select id="filter-select"> <option selected>blur</option> <option>brightness</option> <option>contrast</option> <option>drop-shadow</option> <option>grayscale</option> <option>hue-rotate</option> <option>invert</option> <option>opacity</option> <option>saturate</option> <option>sepia</option> </select> </li> <li> <input type="range"><output></output> </li> <li> <p>current value: <code></code></p> </li> </ul> css div { width: 300px; height: 300px; background: url(https://media.prod.mdn.
...mozit.cloud/attachments/2020/07/29/17350/3b4892b7e820122ac6dd7678891d4507/firefox.png) no-repeat center; } li { display: flex; align-items: center; justify-content: center; margin-bottom: 20px; } input { width: 60% } output { width: 5%; text-align: center; } select { width: 40%; margin-left: 2px; } javascript const selectelem = document.queryselector('select'); const divelem = document.queryselector('div'); const slider = document.queryselector('input'); const output = document.queryselector('output'); const curvalue = document.queryselector('p code'); selectelem.addeventlistener('change', () => { setslider(selectelem.value); setdiv(selectelem.value); }); slider.addeventlistener('input', () => { setdiv(selectelem.value); }); function setslider(filter) { if(filt...
...And 2 more matches
font-family - CSS: Cascading Style Sheets
the font-family css property specifies a prioritized list of one or more font family names and/or generic family names for the selected element.
...the browser will select the first font in the list that is installed or that can be downloaded using a @font-face at-rule.
...this lets the browser select an acceptable fallback font when necessary.
...And 2 more matches
HTML attribute: rel - HTML: Hypertext Markup Language
WebHTMLAttributesrel
values if there are multiple <link rel="icon">s, the browser uses their media attribute, type, and sizes attributes to select the most appropriate icon.
... note: apple's ios does not use this link type, nor the sizes attribute, like others mobile browsers do, to select a webpage icon for web clip or a start-up placeholder.
...this can be used with attribute selectors to style external links in a way that indicates to the user that they will be leaving the current site.
...And 2 more matches
<content>: The Shadow DOM Content Placeholder element (obsolete) - HTML: Hypertext Markup Language
WebHTMLElementcontent
select a comma-separated list of selectors.
... these have the same syntax as css selectors.
... they select the content to insert in place of the <content> element.
...And 2 more matches
<input type="email"> - HTML: Hypertext Markup Language
WebHTMLElementinputemail
value a domstring representing an e-mail address, or empty events change and input supported common attributes autocomplete, list, maxlength, minlength, multiple, name,pattern, placeholder, readonly, required, size, and type idl attributes list and value methods select() value the <input> element's value attribute contains a domstring which is automatically validated as conforming to e-mail syntax.
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
... <input type="email" size="32" minlength="3" maxlength="64"> providing default options as always, you can provide a default value for an email input box by setting its value attribute: <input type="email" value="default@example.com"> offering suggested values taking it a step farther, you can provide a list of default options from which the user can select by specifying the list attribute.
...And 2 more matches
<input type="range"> - HTML: Hypertext Markup Language
WebHTMLElementinputrange
value a domstring containing the string representation of the selected numeric value; use valueasnumber to get the value as a number.
... value the value attribute contains a domstring which contains a string representation of the selected number.
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
...And 2 more matches
Index - HTTP
WebHTTPHeadersIndex
using content negotiation, the server then selects one of the proposals, uses it and informs the client of its choice with the content-type response header.
...using content negotiation, the server then selects one of the proposals, uses it and informs the client of its choice within the content-type response header.
...using content negotiation, the server selects one of the proposals, uses it and informs the client of its choice with the content-encoding response header.
...And 2 more matches
<maction> - MathML
to specify which child elements are addressed by the action, you can make use of the selection attribute.
... toggle: when there is a click on the subexpression, the rendering alternates the display of selected subexpressions.
... therefore each click increments the selection value.
...And 2 more matches
Web audio codec guide - Web media technologies
the specific codec used—and the compression configuration selected—determine how close to the original, uncompressed audio signal the output seems to be when heard by the human ear.
...here we'll provide guidance to help you select an appropriate codec for your use case.
... example: music for streaming for streaming music, you want to select a codec that minimizes bandwidth usage as much as possible while introducing as few artifacts as possible into the audio through compression.
...And 2 more matches
Media container formats (file types) - Web media technologies
audio codecs supported by webm codec browser support chrome edge firefox safari opus yes yes yes yes vorbis yes yes yes yes choosing the right container there are a few factors to consider when selecting the best container or containers to use for your media.
... if for any reason you are only able to provide media in a single format, choose a format that's available on the broadest selection of devices and browsers, such as mp3 (for audio) or mp4 (for video and/or audio).
... container selection advice the tables below offer suggested containers to use in various scenarios.
...And 2 more matches
Web video codec guide - Web media technologies
it's also possible to select a lossless form of encoding, which will result in a much larger encoded file but with perfect reproduction of the original video upon decoding.
...during encoding, a value is selected for bppmaxkb, and then the video cannot exceed this value for each frame.
...it supports several hdr imiplementations, and offers substantial freedom in selecting frame rates, aspect ratios, and frame sizes.
...And 2 more matches
Media - Progressive web apps (PWAs)
there are five special selectors: selector selects e:hover any e element that has the pointer over it e:focus any e element that has keyboard focus e:active the e element that is involved in the current user action e:link any e element that is a hyperlink to a url that the user has not visited recently e:visited any e element that is a hyperlink to a url...
... that the user has visited recently note: the information that can be obtained from the :visited selector is restricted in gecko 2.0.
... see privacy and the : visited selector for more details.
...And 2 more matches
Mobile first - Progressive web apps (PWAs)
so, if you were planning to have a vertical navigation menu on desktop, you might replace this on mobile with a select menu containing the options, or even a single button that when pressed brings the navigation options up in an overlay.
... selectively include javascript libraries according to media query and feature tests (require.js is built in, which is helpful and very easy to use.) html structure for this example app, the html structure is going to be very simple: i am just including a heading, navigation menu and filler text to highlight the fact that articles can get very long on narrow screen devices.
...the reason why it is so useful is that it provides a mechanism to selectively serve both css and javascript.
...And 2 more matches
<xsl:apply-templates> - XSLT: Extensible Stylesheet Language Transformations
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes the <xsl:apply-templates> element selects a set of nodes in the input tree and instructs the processor to apply the proper templates to them.
... syntax <xsl:apply-templates select=expression mode=name> <xsl:with-param> [optional] <xsl:sort> [optional] </xsl:apply-templates> required attributes none.
... optional attributes select uses an xpath expression that specifies the nodes to be processed.
...And 2 more matches
ui/button/action - Archive of obsolete content
if you specify multiple icons, firefox will select the best-fitting icon based on the device screen resolution and the place the icon appears.
...a special shortcut allows you to pass the string "window" or "tab" to select the currently active window or tab.
... to get or set window-specific state, this needs to be the window object for which you wish to set a specific state, or the string "window" to select the currently active window.
... to get or set tab-specific state this needs to be the tab object for which you wish to set a specific state, or the string "tab" to select the currently active tab.
cfx - Archive of obsolete content
this option enables you to select a different host.
... supported options as with cfx run you can use options to control which host application binary version to use, and to select a profile.
...this option enables you to select a different host.
... --manifest-overload add fields to, or override selected fields in, package.json.
jpm - Archive of obsolete content
see selecting a browser version.
... jpm run -b /path/to/firefox/nightly see selecting a browser version.
... jpm test -b /path/to/firefox/nightly see selecting a browser version.
... techniques selecting a browser version by default, jpm run and jpm test runs the release version of firefox.
Session store API - Archive of obsolete content
it's worth noting that this event is sent even if tab loading at startup is deferred until the user selects the tab.
... var ss = components.classes["@mozilla.org/browser/sessionstore;1"] .getservice(components.interfaces.nsisessionstore); var currenttab = gbrowser.selectedtab; var datatoattach = "i want to attach this"; ss.settabvalue(currenttab, "key-name-here", datatoattach); this code sets the value of the key "key-name-here" to datatoattach.
... fetching a saved value you can fetch a value associated with a tab at any time (whether the tab is in the process of being restored or not), using code similar to the following: var ss = components.classes["@mozilla.org/browser/sessionstore;1"] .getservice(components.interfaces.nsisessionstore); var currenttab = gbrowser.selectedtab; var retrieveddata = ss.gettabvalue(currenttab, "key-name-here"); after this code executes, the variable retrieveddata contains the value saved for the key "key-name-here".
... deleting a value associated with a tab to delete a value from a tab, you can use code similar to the following: var ss = components.classes["@mozilla.org/browser/sessionstore;1"] .getservice(components.interfaces.nsisessionstore); var currenttab = gbrowser.selectedtab; ss.deletetabvalue(currenttab, "key-name-here"); remarks the window value save and restore functions work exactly like the tab-based functions by similar names.
Signing an extension - Archive of obsolete content
click the firefox button and select options.
... in the options window, open the advanced panel, then select the encryption tab.
... in the certificate manager, select the your certificates tab.
... select your organization's certificate and click backup.
Inner-browsing extending the browser navigation paradigm - Archive of obsolete content
forms with nested selects in today's web pages it is common to see selects where content is dependent on the selection made on another select.
... for example, imagine a web form where users have to choose their city, by first selecting country then state.
... for example, imagine a web form where users have to choose their city, by first selecting country then state.
... updating the selects without refreshing the page provides a better user experience and bandwidth savings.
Getting Started - Archive of obsolete content
setup download the latest version of mozilla, install it (install the dom inspector as well), and select the classic skin.
...this section defines the normal button in its basic state (there is no mouse over it, it's not disabled, and it's not selected).
...if you have the wrong number here, after you install the skin and select it in the list, it will give you a message saying that it's out of date.
...select them all and zip them up, making sure to include the paths (do not include the \myskin directory inside of the zip, just the files inside of \myskin).
In-Depth - Archive of obsolete content
click file->inspect and select the browser window.
...selected in the tree view will be xul:toolbarbutton.
...when you select an item in the list the bottom portion will display the actual styles that are applied.
...select that one and it lists a bunch of -x-image-region-left type styles in chrome://navigator/skin/.
Repackaging Firefox - Archive of obsolete content
note that this does not change the order of the search engines in the drop-down, only selects the default.
...click the "choose" button to select the xpi file containing your extension; the id and name fields will be filled out automatically.
... the "additional xpi" section lets you select a second extension to bundle into your customized installer.
... the "platforms" section lets you select the platforms for which you wish to generate customized installers.
Simple Storage - Archive of obsolete content
select some text on the page, right-click, and select note.
...jetpack.future.import("menu");jetpack.future.import("selection");jetpack.future.import("storage.simple");// create the persistent notes array if it doesn't already exist.jetpack.storage.simple.notes = jetpack.storage.simple.notes || [];var notes = jetpack.storage.simple.notes;// updates the jetpack menu with the current notes.
... if there's// a selection, add a note menuitem that makes a new note.
...:(jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); updatejetpackmenu(); } });};// initialize the jetpack menu with the current notes.updatejetpackmenu(); see also settings jep 11 ...
Simple Storage - Archive of obsolete content
select some text on the page, right-click, and select note.
...jetpack.future.import("menu"); jetpack.future.import("selection"); jetpack.future.import("storage.simple"); // create the persistent notes array if it doesn't already exist.
... if there's // a selection, add a note menuitem that makes a new note.
...:( jetpack.menu.context.page.beforeshow = function (menu) { menu.reset(); if (jetpack.selection.text) menu.add({ label: "note", command: function () { notes.unshift(jetpack.selection.text); if (notes.length > 20) notes.pop(); updatejetpackmenu(); } }); }; // initialize the jetpack menu with the current notes.
Install Wizards (aka: Stub Installers) - Archive of obsolete content
users download the stub installers, choose which packages to install, choose the destination directory for the installation, and select from various other options.
... subsequently, when users click the "install" button the install wizard downloads and installs only the selected software packages.
...(the stub installer accomplishes this by downloading the xpinstall engine along with the selected software packages.
... it then proceeds to extract the xpinstall engine and feed it the downloaded software packages to install.) the stub installer code includes: the logic to display the install wizard widgets and dialogs the code that reads in the configuration file (config.ini) and dynamically installs from the net or from local xpi modules found next to the installer binary the code that processes user selections the code that calls the xpinstall engine through xpistub the libxpnet code that is statically linked in the stub installers are written in code native to the platform using native widget toolkits including the windows api for windows, the mac toolbox for the mac, and gtk for the unix version.
seltype - Archive of obsolete content
« xul reference home seltype type: one of the values below used to indicate whether multiple selection is allowed.
... single only one row may be selected at a time.
... (default in listbox and richlistbox.) multiple multiple rows may be selected at once.
... (default in tree.) for trees, you can also use the following values: cell individual cells can be selected text rows are selected; however, the selection highlight appears only over the text of the primary column.
moveByOffset - Archive of obsolete content
« xul reference home movebyoffset( offset , isselecting, isselectingrange) return type: no return value if offset is positive, adjusts the focused item forward by that many items.
...if isselecting is true, then the selection is also adjusted.
... if isselectingrange is also true, then the new item is selected in addition to any currently selected items.
... if isselectingrange is false, any existing selection is cleared.
Extensions - Archive of obsolete content
an extension may modify the context menu to show additional items that either appear always, or appear only when certain content is selected.
...for example, the following may be used to insert a command just after the 'select all' command: <popup id="contentareacontextmenu"> <menuitem label="select links" oncommand="thumbnails.selectalllinks();" insertafter="context-selectall"/> </popup> see firefox context menu for a list of the ids of the items found on the firefox context menu.
... istextselected true if text is selected.
... (note: was removed from thunderbird 3 - see bug 463003 for a replacement) iscontentselected true if anything, text or otherwise, is selected.
PopupEvents - Archive of obsolete content
this may happen because the user selected an item from the menu, or it may be because the popup was closed by clicking elsewhere.
...the popuphiding event is fired regardless of how the popup was hidden, whether because the user selected an item from a menu, or if the user clicked outside the popup, or if the user pressed escape to cancel the menu.
...you also cannot cancel the hiding of a menupopup when a user has made a selection from a menu, as it is already too late to do so.
... in this situation the command event has already been sent to the selected menuitem and the operation already carried out.
Property - Archive of obsolete content
« xul reference accessible accessibletype accesskey align allnotifications allowevents alwaysopenpopup amindicator applocale autocheck autofill autofillaftermatch boxobject browsers builder builderview buttons canadvance cangoback cangoforward canrewind checked checkstate child children classname clickselectsall clientheight clientwidth collapsed color columns command commandmanager completedefaultindex container contentdocument contentprincipal contenttitle contentview contentvieweredit contentviewerfile contentwindow contextmenu control controller controllers crop current currentindex currentitem currentnotification currentpage currentpane currentset currenturi customto...
...olbarcount database datasources date dateleadingzero datevalue decimalplaces decimalsymbol defaultbutton defaultvalue description dir disableautocomplete disableautocomplete disableautoselect disabled disablekeynavigation dlgtype docshell documentcharsetinfo editable editingcolumn editingrow editingsession editor editortype emptytext deprecated since gecko 2 enablecolumndrag eventnode firstordinalcolumn firstpermanentchild flex focused focuseditem forcecomplete group handlectrlpageupdown handlectrltab hasuservalue height hidden hideseconds highlightnonmatches homepage hour hourleadingzero id ignoreblurwhilesearching image increment inputfield inverted is24hourclock ispm issearching isw...
...aiting itemcount label labelelement lastpermanentchild lastselected left linkedpanel listboxobject locked markupdocumentviewer max maxheight maxlength maxrows maxwidth menu menuboxobject menupopup min minheight minresultsforpopup minwidth minute minuteleadingzero mode month monthleadingzero name next nomatch notificationshidden object observes onfirstpage onlastpage open ordinal orient pack pagecount pageid pageincrement pageindex pagestep parentcontainer palette persist persistence placeholder pmindicator popup popupboxobject popupopen position predicate preferenceelements preferencepanes preferences priority radiogroup readonly readonly ref resource resultspopup ...
...scrollboxobject scrollincrement scrollheight scrollwidth searchbutton searchcount searchlabel searchparam searchsessions second secondleadingzero securityui selected selectedbrowser selectedcount selectedindex selecteditem selecteditems selectedpanel selectedtab selectionend selectionstart selstyle seltype sessioncount sessionhistory showcommentcolumn showpopup size smoothscroll spinbuttons src state statusbar statustext stringbundle strings style subject suppressonselect tabcontainer tabindex tabs tabscrolling tabpanels tag textlength textvalue timeout title toolbarname toolbarset tooltip tooltiptext top treeboxobject type uri useraction value valuenumber view webbrowser...
Tabboxes - Archive of obsolete content
the currently selected tab element is given an additional selected attribute which is set to true.
... this alters the appearance of the currently selected tab to make it look selected.
...we'll create an options tab (and select it by default) that will contain some options for searching.
... <vbox flex="1"> <tabbox selectedindex="1"> <tabs> <tab label="search"/> <tab label="options"/> </tabs> <tabpanels> <tabpanel id="searchpanel" orient="vertical"> <description> enter your search criteria below and select the find button to begin the search.
Writing Skinnable XUL and CSS - Archive of obsolete content
the descendant selector is forbidden.
... never use the descendant selector without first getting usage of the rule approved.
... i'm usually seeing this rule misused by people who really wanted to use the child selector instead.
... never use an attribute selector rule for the class attribute.
XUL Changes for Firefox 1.5 - Archive of obsolete content
the <richlistbox> supports much of the same api as the <listbox> and single items, created with the <richlistitem> element may be selected.
... <radiogroup> setting the value property on the <radiogroup> element selects the <radio> element in the group with the corresponding value.
...this is used typically on gnome systems where possible values are: accept, cancel, help, open, save, find, clear, yes, no, apply, close, print, add, remove, refresh, go-forward, go-back, properties, select-font, select-color, network.
... <tabbox> the <tabbox> element now supports a selectedindex attribute to specify the tab to be selected by default.
Accessibility/XUL Accessibility Reference - Archive of obsolete content
column see grid columns see grid command see keyboard shortcut tutorial commandset see keyboard shortcut tutorial deck only the currently selected deck layer can be focused.
...menubar <menubar hidden="false"> <menu label="file" accesskey="f"> <menupopup> <menuitem label="new" accesskey="n" key="file-new-key"/> </menupopup> </menu> </menubar> menulist <label value="<!--label text-->" control="comboid" /> <menulist id="comboid"> <menupopup> <menuitem label="<!--option1-->" /> <menuitem label="<!--option2-->" selected="true" /> <menuitem label="<!--option3-->" /> </menupopup> </menulist> menupopup see menulist and menubar popup see popupset popupset be careful regarding keyboard access of popups.
... progressmeter <progressmeter mode="determined" value="10" /> as progress advances, jaws indicates percentage to the user radio see radiogroup radiogroup <label value='<!--radio group-->' control='radioid' /> <radiogroup id='radioid'> <radio selected="true" label='<!--option1-->' /> <radio label='<!--option2-->' /> </radiogroup> row see grid rows see grid stack all elements can be focused, even if not visible due to being hidden under something else statusbar <statusbar> <statusbarpanel label="<!--status bar-->" flex="1"/> </statusbar> read using jaws w...
... </tabpanel> </tabpanels> focusing the tabbox will visually set focus to the selected tab, then you can select different tabs by using the left and right arrow keys.
button - Archive of obsolete content
if the user selects one the buttons, the others in the group are unchecked.
...possible values include: accept, cancel, help, open, save, find, clear, yes, no, apply, close, print, add, remove, refresh, go-forward, go-back, properties, select-font, select-color, network.
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider, nsidomxulbuttonelement ...
iframe - Archive of obsolete content
attributes showcaret, src, type, transparent properties accessibletype, contentdocument, contentwindow, docshell, webnavigation examples <iframe src="table.php" flex="2" id="browsertable" name="table_frame"/> selecting an url from a menu <menulist oncommand="donav(this);"> <menupopup> <menuitem label="mozilla" value="http://mozilla.org" /> <menuitem label="slashdot" value="http://slashdot.org"/> <menuitem label="sourceforge" value="http://sf.net" /> <menuitem label="freshmeat" value="http://freshmeat.net"/> </menupopup> </menulist> <iframe id="myframe" flex="1"/> <script> function don...
...av(obj) { var url = obj.selecteditem.value; // note the firstchild is the menupopup element document.getelementbyid('myframe').setattribute('src', url); } </script> attributes showcaret type: boolean whether or not to cause a typing caret to be visible in the content area.
...this is the preferred value for any browser element in an application, which will use multiple browsers of equal privileges, and is unselected at the moment.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related nsiaccessibleprovider ...
toolbarbutton - Archive of obsolete content
if the user selects one the buttons, the others in the group are unchecked.
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...this occurs when a user selects a menu item or presses a keyboard shortcut attached to the command.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox interfaces ...
treecol - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
... the attribute also controls whether the column picker allows the user to deselect this column.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following class may be used to style the element.
... this class should be used instead of changing the style of the element directly since it will fit more naturally with the user's selected theme.
wizard - Archive of obsolete content
the wizard will rendered in a manner suitable for the user's selected theme and platform.
... pageindex type: integer this property returns the index of the currently selected page.
... you can change the selected page by modifying this property.
..., getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata « xul reference home advance( pageid ) return type: no return value call this method to go to the next page.
XForms Custom Controls - Archive of obsolete content
for example, in the mozilla xforms extension we will render a combobox widget when appearance='minimal' on a select1 control.
...xf|select1[appearance="compact"] { -moz-binding: url('chrome://xforms/content/select-xhtml.xml#xformswidget-select1-compact'); } the mediatype attribute can be used by the form author to align the type of presentation with the type of data that the bound instance node contains.
...select.xml - contains the base bindings for select and select1 xforms controls (except minimal/default select1 that is hosted in select1.xml file) range.xml - contains the base bindings for the range xforms control.
...mages/p-bugz.gif</img> <img label="mozilla">http://www.mozilla.org/images/mozhead-80x64.gif</img> </data> </xf:instance> </xf:model> <style type="text/css"> @namespace xf url(http://www.w3.org/2002/xforms); xf|output[mediatype="image/*"] { -moz-binding: url('#output-image'); } </style> </head> <body> <h1>custom control sample</h1> <xf:select1 ref="curimg"> <xf:label>select image to display: </xf:label> <xf:itemset nodeset="../img"> <xf:label ref="@label"/> <xf:value ref="."/> </xf:itemset> </xf:select1> <xf:output ref="curimg" mediatype="image/*"/> </body> </html> ...
Implementation Status - Archive of obsolete content
4.4.10 xforms-enabled supported 4.4.11 xforms-disabled supported 4.4.12 domactivate supported 4.4.13 domfocusin supported 4.4.14 domfocusout supported 4.4.15 xforms-select xforms-deselect supported 4.4.16 xforms-in-range supported 4.4.17 xforms-out-of-range supported 4.4.18 xforms-scroll-first xforms-scroll-last supported 4.4.19 xforms-submit-done supported ...
... 4.5.7 xforms-version-exception unsupported 4.6 event sequencing supported 4.6.1 for input, secret, textarea, range, or upload controls supported 4.6.2 for output controls supported 4.6.3 for select or select1 controls partial 4.6.4 for trigger controls supported 4.6.5 for submit controls supported 4.6.6 sequence: selection without value change supported 4.6.7 sequence: value change with focus change supported ...
...pported 8.1.5 output supported 8.1.6 upload supported 8.1.7 range partial 316355; 343523; 8.1.8 trigger supported 8.1.9 submit supported 8.1.10 select partial @selection does not work, select inside repeat may not work correctly, select that mixes itemsets with items may show them in the wrong order 282840; 371595; 372127; 8.1.11 select1 partial there are some resize issues, select/deselect/valuechange firing in wrong order.
...container form controls section title status notes bugs 9.1.1 group supported 9.2.1 switch partial @selected not working inside repeats 339937; 9.2.2 case partial 302497; 329143; 9.3 repeat module partial 264329; 273706; 9.3.1 repeat partial we do not support number attribute 302026; 9.3.2 nested repeats supported ...
Correctly Using Titles With External Stylesheets - Archive of obsolete content
in a document that refers to alternate stylesheets, the preferred stylesheet will be used so long as none of the alternate stylesheets are selected by the user.
...once the user selects one of the alternate stylesheets, the preferred stylesheet will no longer be used, although the user can always re-select the preferred stylesheet.
...if any alternate stylesheet is selected, then the preferred stylesheet is dropped in favor of the user-selected alternate stylesheet.
... this is different than persistent stylesheets, which are always applied to a document, whether an alternate stylesheet has been selected or not.
CSS - MDN Web Docs Glossary: Definitions of Web-related terms
the browser applies css style declarations to selected elements to display them properly.
... a css rule is a set of properties associated with a selector.
... here is an example that makes every html paragraph yellow against a black background: /* the selector "p" indicates that all paragraphs in the document will be affected by that rule */ p { /* the "color" property defines the text color, in this case yellow.
...*/ background-color: black } "cascading" refers to the rules that govern how selectors are prioritized to change a page's appearance.
CSS building blocks - Learn web development
this module looks at the cascade and inheritance, all the selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
... css selectors there are a wide variety of css selectors available, allowing for fine-grained precision when selecting elements to style.
...the sub-articles are as follows: type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model everything in css has a box around it, and understanding these boxes is key to being able to create layouts with css, or to align items with other items.
... fundamental css comprehension this assessment tests your understanding of basic syntax, selectors, specificity, box model, and more.
Client-side form validation - Learn web development
first, some html: <form> <p> <fieldset> <legend>do you have a driver's license?<abbr title="this field is mandatory" aria-label="required">*</abbr></legend> <!-- while only one radio button in a same-named group can be selected at a time, and therefore only one radio button in a same-named group having the "required" attribute suffices in making a selection a requirement --> <input type="radio" required name="driver" id="r1" value="yes"><label for="r1">yes</label> <input type="radio" required name="driver" id="r2" value="no"><label for="r2">no</label> </fieldset> </p> <p> ...
...onstraint validation api most browsers support the constraint validation api, which consists of a set of methods and properties available on the following form element dom interfaces: htmlbuttonelement (represents a <button> element) htmlfieldsetelement (represents a <fieldset> element) htmlinputelement (represents an <input> element) htmloutputelement (represents an <output> element) htmlselectelement (represents a <select> element) htmltextareaelement (represents a <textarea> element) the constraint validation api makes the following properties available on the above elements.
...const form = document.getelementsbytagname('form')[0]; const email = document.getelementbyid('mail'); const emailerror = document.queryselector('#mail + span.error'); email.addeventlistener('input', function (event) { // each time the user types something, we check if the // form fields are valid.
...> <span class="error" aria-live="polite"></span> </label> </p> <!-- some legacy browsers need to have the `type` attribute explicitly set to `submit` on the `button`element --> <button type="submit">submit</button> </form> similarly, the css doesn't need to change very much; we've just turned the :invalid css pseudo-class into a real class and avoided using the attribute selector that doesn't work on internet explorer 6.
Using data attributes - Learn web development
const article = document.queryselector('#electric-cars'); article.dataset.columns // "3" article.dataset.indexnumber // "12314" article.dataset.parent // "cars" each property is a string and can be read and written.
...for example to show the parent data on the article you can use generated content in css with the attr() function: article::before { content: attr(data-parent); } you can also use the attribute selectors in css to change styles according to the data: article[data-columns='3'] { width: 400px; } article[data-columns='4'] { width: 600px; } you can see all this working together in this jsbin example.
...using the css selectors and javascript access here this allows you to build some nifty effects without having to write your own display routines.
...number values must be quoted in the selector for the styling to take effect.
Images in HTML - Learn web development
ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time...
...ue="show solution"> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } var textarea = document.getelementbyid('code'); var reset = document.getelementbyid('reset'); var solution = document.getelementbyid('solution'); var output = document.queryselector('.output'); var code = textarea.value; var userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...addeventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { var scrollpos = textarea.scrolltop; var caretpos = textarea.selectionstart; var front = (textarea.value).substring(0, caretpos); var back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every time...
Website security - Learn web development
for example, the following code is intended to list all users with a particular name (username) that has been supplied from an html form: statement = "select * from users where name = '" + username + "';" if the user specifies a real name, the statement will work as intended.
... select * from users where name = 'a';drop table users; select * from userinfo where 't' = 't'; the modified statement creates a valid sql statement that deletes the users table and selects all data from the userinfo table (which reveals the information of every user).
... select * from users where name = 'a\';drop table users; select * from userinfo where \'t\' = \'t'; web frameworks will often take care of the character escaping for you.
...we hope you've enjoyed learning these fundamental concepts, and you're now ready to select a web framework and start programming.
Accessibility Features in Firefox
keyboard support "mozilla firefox is a web-browser with superior keyboard support." alan cantor, cantor access consulting firefox includes keyboard access to all of its amazing features: browse with caret allows users to select arbitrary content with the keyboard and move through content as if inside a read-only editor.
...you can even select web content and copy it to the clipboard.
... view selection source (techies only): when you select some text and right click or press shift+f10, you can "view selection source".
... this will show the html source for only the selected text, which is useful for understanding accessibility problems in some web sites.
Mozilla's Section 508 Compliance
all sidebar functions that come with the browser are available through other means 2) java and in-page plugins cannot be used with the keyboard, so they must not be installed for keyboard-only users additional features for the keyboard: 1) find as you type allows for quick navigation to links and convenient text searching 2) browse with caret (f7 key toggles) allows users to select arbitrary content with the keyboard and move through content as if inside a readonly editor.
... (g) applications shall not override user selected contrast and color selections and other individual display attributes.
...when the windows "high contrast theme" is used classic, and thus the system look and feel, is automatically selected.
... (j) when a product permits a user to adjust color and contrast settings, a variety of color selections capable of producing a range of contrast levels shall be provided.
Application cache implementation overview
processofflinemanifest is an effective implementation of “cache selection algorithm” as described by the html5 spec.
... for purpose of this documentation it's enough to describe the simplest case ; for complete documentation of the selection algorithm refer to the spec or to the code.
...but this time the entry is not selected to load the top level document from.
...this is the same document object that is associated the nsiapplicationcache object during the “cache selection algorithm” in nscontentsink::processofflinemanifest() described in “associating the top level document with offline cache” chapter above.
Chrome registration
this chrome registry is configurable and persistent, and thus a user can install different chrome providers, and select a preferred skin and locale.
...if more than one locale is registered for a package, the chrome registry will select the best-fit locale using the user's preferences.
...if more than one skin is registered for a package, the chrome registry will select the best-fit skin using the user's preferences.
...the "process" flag selects between these two.
Debugging a hang on OS X (Archived)
after about 3-4 seconds, select the hanging application in the “detected hangs” window and click the “interrupt sampling” button.
... if you need to upload the sample to bugzilla, select all the sample text, copy it into your favorite text editor, and save as a plain-text file.
... for a more detailed view of the sample data, make sure the sample you just recorded is selected in the “detected hangs” window and click on the “open…” button.
... select "firefox-bin" or the hung application you want a sample from.
Configuring Build Options
this will also help when troubleshooting because people will want to know which build options you have selected and will assume that you have put them in your mozconfig file.
... choose an application the --enable-application=application flag is used to select an application to build.
...fig file: browser (firefox) ac_add_options --enable-application=browser note: this is the default mail (thunderbird) ac_add_options --enable-application=comm/mail mozilla suite (seamonkey) ac_add_options --enable-application=suite calendar (lightning extension, uses thunderbird) ac_add_options --enable-application=comm/mail ac_add_options --enable-calendar selecting build options the build options you choose depends on what application you are building and what you will be using the build for.
...some extensions are not compatible with all apps, for example: cookie is not compatible with thunderbird typeaheadfind is not compatible with any toolkit app (firefox, thunderbird) unless you know which extensions are compatible with which apps, do not use the --enable-extensions option; the build system will automatically select the proper default set of extensions.
PopupNotifications.jsm
if null, the currently selected <xul:browser>'s notifications will be searched.
...this must not be null; you can, however, simply specify gbrowser.selectedbrowser to associate it with the current tab.
... callback a javascript function to be invoked when the action is selected by the user.
...this is normally specified in css using list-style-image and the .popup-notification-icon[popupid=...] selector.
Mozilla Quirks Mode Behavior
the :hover and :active pseudo-classes will only be applied to links, and only if there is no other pseudo-class in the selector.
... to match other elements, the selector must include a tag name, id, class or attribute.
... prior to gecko 6.0 (firefox 6.0 / thunderbird 6.0 / seamonkey 2.3), there was no class check, so the :hover pseudoclass was not applied to class selectors; for example, .someclass:hover did not work.
... prior to gecko 36, the quirk was also applied if another pseudo-class was used in the same selector, if a pseudo-element was used in the selector, or if it was part of a pseudo-class argument (bug 783213).
Preference reference
changes require an application restart.browser.download.lastdir.savepersitebrowser.download.lastdir.savepersite controls whether the directory preselected in the file picker for saving a file download is being remembered on a per-website (host) base.
...ing_disabled controls whether the application creates screenshots of visited pages which will be shown if the web page is shown in the grid of the "new tab page" (about:newtab) which offers the most often visited pages for fast navigation.browser.search.context.loadinbackgroundbrowser.search.context.loadinbackground controls whether a search from the context menu with "search <search engine> for <selected text>" opening a new tab will give focus to it and load it in the foreground or keep focus on the current tab and open it in the background.browser.urlbar.formatting.enabledthe preference browser.urlbar.formatting.enabled controls whether the domain name including the top level domain is highlighted in the address bar by coloring it black and the other parts grey.browser.urlbar.trimurlsthe pref...
...erence browser.urlbar.trimurls controls whether the protocol http and the trailing slash behind domain name (if the open page is exactly the domain name) are hidden.dom.event.clipboardevents.enableddom.event.clipboardevents.enabled lets websites get notifications if the user copies, pastes, or cuts something from a web page, and it lets them know which part of the page had been selected.
...rigin controls the position and direction from which popup notifications invoked by nsialertsservice are sliding in.ui.spellcheckerunderlineui.spellcheckerunderline holds the colour which is used to underline words not recognized by the spellchecker.ui.spellcheckerunderlinestyleui.spellcheckerunderlinestyle holds the style which is used to underline words not recognized by the spellchecker.ui.textselectbackgroundui.textselectbackground saves the color in which the background of a text selection in the user interface or in content will be styled.ui.textselectforegroundui.textselectforeground saves the color in which the text of a text selection in the user interface or the content will be styled.ui.tooltipdelayui.tooltipdelay stores the delay in milliseconds between the mouse stopping over an ele...
McCoy
simply click the "create" toolbar button or select "create key" from the "keys" menu.
...the simplest way to do this is to select the key then click the install toolbar button.
... if you wish to manually add the public key to the install.rdf you can right click the key, select \"copy public key\" and then add it to the file as an updatekey entry.
...simply select the key you originally added to the add-on's install.rdf, then click the "sign" toolbar button, select your update.rdf file and the data in it will be signed.
Nonblocking IO In NSPR
fundamentally, this constraint is due to the fact that nonblocking i/o and <tt>select()</tt> are only available to sockets on some platforms (e.g., winsock).
... pr_poll() or pr_select()?
... <tt>pr_select()</tt> is deprecated, now declared in <tt>private/pprio.h</tt>.
...the current implementation of <tt>pr_select()</tt> simply calls <tt>pr_poll()</tt>, so it is sure to have worse performance.
PKCS11 FAQ
MozillaProjectsNSSPKCS11FAQ
much of nss's token selection is based on where the key involved is currently stored.
...if an rsa key is being generated, the nss application will present a list of all writable rsa devices asks the user to select which one to use, if a dsa key is being generated, it will present a list of all the writable dsa devices, if an ec key is being generated, it will present a list of all writable ec devices.
...then select your pkcs #11 module, click view/edit, select the token, and click change password.
...normally this dialog does not have any options and just provides information; however, if you have more than one token that can be used in this key generation process (for example, your smartcard and the nss internal pkcs#11 module), you will see a selection of "cards and databases" that can be used to generate your new key info.
Handling Mozilla Security Bugs
also, as with other mozilla module owners, mozilla.org staff will oversee the work of the security module owner and select a new security module owner should that ever be necessary for any reason.
... the mozilla security module owner will work with mozilla.org staff to select one or more people to act as peers to the security module owner in investigating and resolving security vulnerabilities; the peers will share responsibility for overseeing and coordinating any and all activities related to security bugs.
... the mozilla security bug group the mozilla security module owner and peers will form the core of the mozilla security bug group, and will select a number of other people to round out the group's membership.
... expanding the mozilla security bug group as previously described, the mozilla security module owner can select one or more peers to share the core work of coordinating investigation and resolution of mozilla security vulnerabilities, and will work with them to create some agreed-upon ground rules for how this work can be most effectively shared among themselves.
nsIAccessibleHyperLink
inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview nsiaccessible getanchor(in long index); note: renamed from getobject in gecko 1.9 nsiuri geturi(in long index); boolean isselected(); obsolete since gecko 1.9 boolean isvalid(); obsolete since gecko 1.9 attributes attribute type description anchorcount long the number of anchors within this hyperlink.
... selected boolean determines whether the element currently has the focus, for example after returning from the destination page.
... isselected() obsolete since gecko 1.9 (firefox 3) note: has been replaced by the selected attribute.
... boolean isselected(); parameters none.
nsIApplicationUpdateService
it also provides utilities for selecting and downloading update patches.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void adddownloadlistener(in nsirequestobserver listener); astring downloadupdate(in nsiupdate update, in boolean background); void pausedownload(); void removedownloadlistener(in nsirequestobserver listener); nsiupdate selectupdate([array, size_is(updatecount)] in nsiupdate updates, in unsigned long updatecount); attributes attribute type description backgroundchecker nsiupdatechecker the update checker being used for background update checking.
... selectupdate() selects the best update to install from a provided list of available updates.
... nsiupdate selectupdate( [array, size_is(updatecount)] in nsiupdate updates, in unsigned long updatecount ); parameters updates an array of updates that are available to install.
nsIDOMWindow
method overview nsidomcssstyledeclaration getcomputedstyle(in nsidomelement elt, [optional] in domstring pseudoelt); nsiselection getselection(); void scrollby(in long xscrolldif, in long yscrolldif); void scrollbylines(in long numlines); void scrollbypages(in long numpages); void scrollto(in long xscroll, in long yscroll); void sizetocontent(); attributes attribute type description applicationcache nsidomofflineresourcelist get the applic...
... nsidomcssstyledeclaration getcomputedstyle( in nsidomelement elt, in domstring pseudoelt optional ); parameters elt pseudoelt optional return value getselection() returns the nsiselection object indicating what if any content is currently selected in the window.
... nsiselection getselection(); parameters none.
... return value the nsiselection object for the window.
nsIDragService
rables, in nsiscriptableregion aregion, in unsigned long aactiontype ); void invokedragsessionwithimage(in nsidomnode adomnode, in nsisupportsarray atransferablearray, in nsiscriptableregion aregion, in unsigned long aactiontype, in nsidomnode aimage, in long aimagex, in long aimagey, in nsidomdragevent adragevent, in nsidomdatatransfer adatatransfer); void invokedragsessionwithselection(in nsiselection aselection, in nsisupportsarray atransferablearray, in unsigned long aactiontype, in nsidomdragevent adragevent, in nsidomdatatransfer adatatransfer); void startdragsession( ) ; void suppress(); void unsuppress(); constants constant value description dragdrop_action_none 0 no action.
...the document selection is hidden while drawing.
... invokedragsessionwithselection() start a modal drag session using the selection as the drag image.
... void invokedragsessionwithselection( in nsiselection aselection, in nsisupportsarray atransferablearray, in unsigned long aactiontype, in nsidomdragevent adragevent, in nsidomdatatransfer adatatransfer ); parameters aselection the selection that is to be dragged.
XPCOM Interface Reference
dnsiaboutmodulensiabstractworkernsiaccelerometerupdatensiaccessnodensiaccessibilityservicensiaccessiblensiaccessiblecaretmoveeventnsiaccessiblecoordinatetypensiaccessibledocumentnsiaccessibleeditabletextnsiaccessibleeventnsiaccessiblehyperlinknsiaccessiblehypertextnsiaccessibleimagensiaccessibleprovidernsiaccessiblerelationnsiaccessibleretrievalnsiaccessiblerolensiaccessiblescrolltypensiaccessibleselectablensiaccessiblestatechangeeventnsiaccessiblestatesnsiaccessibletablensiaccessibletablecellnsiaccessibletablechangeeventnsiaccessibletextnsiaccessibletextchangeeventnsiaccessibletreecachensiaccessiblevaluensiaccessiblewin32objectnsialertsservicensiannotationobservernsiannotationservicensiappshellnsiappshellservicensiappstartupnsiappstartup_mozilla_2_0nsiapplicationcachensiapplicationcachechanneln...
...mserializernsidomsimplegestureeventnsidomstoragensidomstorage2nsidomstorageeventobsoletensidomstorageitemnsidomstoragelistnsidomstoragemanagernsidomstoragewindownsidomuserdatahandlernsidomwindownsidomwindow2nsidomwindowinternalnsidomwindowutilsnsidomxpathevaluatornsidomxpathexceptionnsidomxpathexpressionnsidomxpathresultnsidomxulcontrolelementnsidomxulelementnsidomxullabeledcontrolelementnsidomxulselectcontrolelementnsidomxulselectcontrolitemelementnsidatasignatureverifiernsidebugnsidebug2nsidevicemotionnsidevicemotiondatansidevicemotionlistenernsidialogcreatornsidialogparamblocknsidictionarynsidirindexnsidirindexlistenernsidirindexparsernsidirectoryenumeratornsidirectoryiteratornsidirectoryservicensidirectoryserviceprovidernsidirectoryserviceprovider2nsidiskcachestreaminternalnsidispatchsupport...
...ratornsirequestnsirequestobservernsiresumablechannelnsirunnablensishentrynsishistorynsishistorylistenernsisockssocketinfonsisslerrorlistenernsisslsocketcontrolnsiscreennsiscreenmanagernsiscripterrornsiscripterror2nsiscriptableionsiscriptableinputstreamnsiscriptableunescapehtmlnsiscriptableunicodeconverternsiscrollablensisearchenginensisearchsubmissionnsisecuritycheckedcomponentnsiseekablestreamnsiselectionnsiselection2nsiselection3nsiselectioncontrollernsiselectionimageservicensiselectionprivatensiserversocketnsiserversocketlistenernsiservicemanagernsisessionstartupnsisessionstorensisimpleenumeratornsismsdatabaseservicensismsrequestmanagernsismsservicensisocketprovidernsisocketproviderservicensisockettransportnsisockettransportservicensisoundnsispeculativeconnectnsistackframensistandardurlnsistr...
...tfilternsithreadinternalnsithreadmanagernsithreadobservernsithreadpoolnsithreadpoollistenernsitimernsitimercallbacknsitoolkitnsitoolkitprofilensitoolkitprofileservicensitraceablechannelnsitransactionnsitransactionlistnsitransactionlistenernsitransactionmanagernsitransferablensitransportnsitransporteventsinknsitransportsecurityinfonsitreeboxobjectnsitreecolumnnsitreecolumnsnsitreecontentviewnsitreeselectionnsitreeviewnsiurinsiurifixupnsiurifixupinfonsiurlnsiurlformatternsiurlparsernsiutf8converterservicensiutf8stringenumeratornsiuuidgeneratornsiupdatensiupdatechecklistenernsiupdatecheckernsiupdateitemnsiupdatemanagernsiupdatepatchnsiupdatepromptnsiupdatetimermanagernsiuploadchannelnsiuploadchannel2nsiurllistmanagercallbacknsiusercertpickernsiuserinfonsivariantnsiversioncomparatornsiweakreferencen...
Address Book examples
in the following examples: selectedab is the uri of an address book to default the dialog to saving the card in.
... new contact dialog window.opendialog("chrome://messenger/content/addressbook/abnewcarddialog.xul", "", "chrome,resizable=no,titlebar,modal,centerscreen", {selectedab:selectedab}); edit contact dialog window.opendialog("chrome://messenger/content/addressbook/abeditcarddialog.xul", "", "chrome,resizable=no,modal,titlebar,centerscreen", {aburi:aburi, card:card}); new list dialog window.opendialog("chrome://messenger/content/addressbook/abmaillistdialog.xul", "", "chrome,resizable=no,titlebar,modal,centerscreen", ...
... {selectedab:selectedab}); edit list dialog window.opendialog("chrome://messenger/content/addressbook/abeditlistdialog.xul", "", "chrome,resizable=no,titlebar,modal,centerscreen", {abcard:abcard, listuri:listuri}); new address book dialog unlike the edit address book dialog, the new address book dialog does not currently have the facility to get the chrome uri based on the address book type.
... window.opendialog(addressbook.propertieschromeuri, "editdirectory", "chrome,modal=yes,resizable=no", {selecteddirectory: addressbook}); how do i set up my own address book?
Using popup notifications
then you can create the popup notification at the appropriate time like this: popupnotifications.show(gbrowser.selectedbrowser, "sample-popup", "this is a sample popup notification.", null, /* anchor id */ { label: "do something", accesskey: "d", callback: function() { alert("doing something awesome!"); } }, null /* secondary action */ ); in this case, we aren't providing any secondary actions; that is, actions...
... style the icon, like this: .popup-notification-icon[popupid="sample-popup"] { list-style-image: url("chrome://popupnotifications/skin/mozlogo.png"); } with this css in place, the result is the look we want: adding secondary options to provide options in the drop-down menu, add an array of notification actions to the call to the show() method, like this: popupnotifications.show(gbrowser.selectedbrowser, "sample-popup", "this is a sample popup notification.", null, /* anchor id */ { label: "do something", accesskey: "d", callback: function() { alert("doing something awesome!"); } }, [ { label: "first secondary option", accesskey: "1", callback: functi...
...on() { alert("first secondary option selected."); } }, { label: "second secondary option", accesskey: "2", callback: function() { alert("second secondary option selected."); } } ] ); when this notification is presented, and the user clicks on the menu button in the panel, the display looks like this: when the user chooses one of your secondary actions from the drop-down menu, the corresponding callback is invoked.
... components.utils.import('resource://gre/modules/popupnotifications.jsm'); var notify = new popupnotifications(gbrowser, document.getelementbyid("notification-popup"), document.getelementbyid("notification-popup-box")); var notification = notify.show( // browser gbrowser.selectedbrowser, // popup id "pdes-popup", // message "hi, there!, i'm gonna show you something today!!", // anchor id null, // main action { label: "click here", accesskey: "d", callback: function() { // you can call your function here } }, // secondary action null, // options { // alternative way to set the popup icon popupiconurl: "chrome://popupnotifications/skin/mozlogo.pn...
DOM Inspector FAQ - Firefox Developer Tools
or, if you do not know anything about the node, you can try to select it by clicking on it.
... scroll the node into view, choose the select-by-click toolbar button, and then click on the element you wish to inspect.
... the edit menu also includes a select element by click menu item.
...from the dom nodes viewer, select the node and bring up the context menu.
Aggregate view - Firefox Developer Tools
on the right-hand side is a pane that just says "select an item to view its retaining paths".
... if you select an item, you'll see the retaining paths panel for that item: call stack the call stack shows you exactly where in your code you are making heap allocations.
... let's get an allocation trace: open the memory tool check "record call stacks" load https://mdn.github.io/performance-scenarios/dom-allocs/alloc.html take a snapshot select "view/aggregate" select "group by/call stack" you should see something like this: this is telling us that 93% of the total heap snapshot was allocated in functions called from "alloc.js", line 35 (our initial createtoolbars() call).
... let's see what the example looks like when we select "inverted call stack": now at the top we can immediately see the createtoolbarbutton() call accounting for 89% of the heap usage in our page.
Network request list - Firefox Developer Tools
you can reset the sort to the default by selecting "reset sorting" from the context menu.
... select block url from the context menu.
... select unblock url.
... block url blocks the selected url for future requests.
Edit Shape Paths in CSS - Firefox Developer Tools
once you have selected your element, you should see the shape icon alongside any valid value, e.g.
... to deactivate the shape path editor click on the icon again, or select another element or a different editor.
... note that the shape path editor does not persist between page reloads — if you reload your page you will need to select the element again.
... understanding the lines drawn by the editor once you have selected a shape on your page, the shape path editor will draw lines to help you understand the path that is being created.
Allocations - Firefox Developer Tools
click this to see the places this function was called from: here you can see that signallater() was called from two places: removeinner() and setselectioninner().
...but signallater() was called from two places: removeinner() and setselectioninner().
...however, removeinner() has 8901 in total count, while setselectioninner() has just 3 in total count.
...if you click this link, the devtools switches to the allocations view, and selects the region of time from the end of the last gc cycle to the start of the one you clicked on.
Settings - Firefox Developer Tools
as of firefox 62, if the option to "select an iframe as the currently targeted document" is checked, the icon will appear in the toolbar while the settings tab is displayed, even if the current page doesn't include any iframes.
... note that in firefox 52 we removed the checkbox to toggle the "select element" button.
... the "select element" button is now always shown.
...select 2, 4, or 8.
AbstractRange - Web APIs
in order to set a range endpoint within the text of an element, be sure to find the text node inside the element: let startelem = document.queryselector("p"); let endelem = startelem.queryselector("span"); let range = document.createrange(); range.setstart(startelem, 0); range.setend(endelem, endelem.childnodes[0].length/2); let contents = range.clonecontents(); document.body.appendchild(contents); this example creates a new range, rng, and sets its starting point to the third child node of the first element whose class is elementclass.
... if you want to create a range that incorporates the contents of the <p> element whose contents are "a <em>very</em> interesting thing happened on the way to the forum...", you can do so like this: let prange = document.createrange(); prange.selectnodecontents(document.queryselector("#entry1 p")); since we wish to select the entire contents of the <p> element, including its descendants, this works perfectly.
... if we wish to instead copy the text "an interesting thing..." from the <section>'s heading (an <h2> element) through the end of the letters "ve" in the <em> within the paragraph below it, the following code would work: let r = document.createrange(); let startnode = document.queryselector("section h2").childnodes[0]; r.setstart(startnode, 11); let endnode = document.queryselector("#entry1 p em").childnodes[0]; r.setend(endnode, 2); let fragment = r.clonecontents(); here an interesting problem arises—we are capturing content from multiple nodes located at different levels of the dom hierarchy, and then only part of one of them.
...the code to do that looks like the following: let paranode = document.queryselector("p"); let paratextnode = paranode.childnodes[1]; let range = document.createrange(); range.setstart(paratextnode, 6); range.setend(paratextnode, paratextnode.length-1); let fragment = range.clonecontents(); document.body.appendchild(fragment); first we get references to the paragraph node itelf as well as to the second child node within the paragraph.
CSSStyleSheet.addRule() - Web APIs
syntax var result = cssstylesheet.addrule(selector, styleblock, index); parameters selector a domstring specifying the selector portion of the css rule.
... styleblock a domstring indicating the style block to apply to elements matching the selector.
... usage notes this method is implemented by browsers by constructing a string using the template literal `${selector}{${styleblock}}`, then passing it into the standard insertrule() method.
... therefore, given existing code such as the following: cssstylesheet.addrule(selector, styles, 0); you can rewrite this to use the more standard insertrule() like this: cssstylesheet.insertrule(`${selector} {${styles}}`, 0); specifications specification status comment css object model (cssom)the definition of 'cssstylesheet.addrule()' in that specification.
DisplayMediaStreamConstraints.video - Web APIs
this value may simply be a boolean, where true specifies that a default selection of input source be made (typically the entire display area of the device in use, spanning every screen in a multiple screen configuration).
... displaysurface a constraindomstring which specifies the types of display surface that may be selected by the user.
... browser the stream contains the contents of a single browser tab selected by the user.
... window the stream contains a single window selected by the user for sharing.
HTMLElement: change event - Web APIs
the change event is fired for <input>, <select>, and <textarea> elements when an alteration to the element's value is committed by the user.
...o interface event event handler property onchange depending on the kind of element being changed and the way the user interacts with the element, the change event fires at a different moment: when the element is :checked (by clicking or using the keyboard) for <input type="radio"> and <input type="checkbox">; when the user commits the change explicitly (e.g., by selecting a value from a <select>'s dropdown with a mouse click, by selecting a date from a date picker for <input type="date">, by selecting a file in the file picker for <input type="file">, etc.); when the element loses focus after its value was changed, but not commited (e.g., after editing the value of <textarea> or <input type="text">).
... examples <select> element html <label>choose an ice cream flavor: <select class="ice-cream" name="ice-cream"> <option value="">select one …</option> <option value="chocolate">chocolate</option> <option value="sardine">sardine</option> <option value="vanilla">vanilla</option> </select> </label> <div class="result"></div> body { display: grid; grid-template-areas: "select result"; } select { grid-area: select; } .result { grid-area: result; } javascript const selectelement = document.queryselector('.ice-cream'); selectelement.addeventlistener('change', (event) => { const result = document.queryselector('.result'); result.textcontent = `you like ${event.target.value}...
... html <input placeholder="enter some text" name="name"/> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.addeventlistener('change', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'change' in that specification.
HTMLElement - Web APIs
htmlelement.inert is a boolean indicating whether the user agent must act as though the given node is absent for the purposes of user interaction events, in-page text searches ("find in page"), and text selection.
... input events beforeinput fired when the value of an <input>, <select>, or <textarea> element is about to be modified.
... input fired when the value of an <input>, <select>, or <textarea> element has been changed.
... change fired when the value of an <input>, <select>, or <textarea> element has been changed and committed by the user.
HTMLInputElement.webkitEntries - Web APIs
the read-only webkitentries property of the htmlinputelement interface contains an array of file system entries (as objects based on filesystementry) representing files and/or directories selected by the user using an <input> element of type file, but only if that selection was made using drag-and-drop: selecting a file in the dialog will leave the property empty (bug 1326031).
... syntax var entries = htmlinputelement.webkitentries; value an array of objects based on filesystementry, each representing one file which is selected in the <input> element.
... example this example shows how to create a file selection <input> element and process the selected files.
... html <input id="files" type="file" multiple> javascript document.getelementbyid("files").addeventlistener("change", function(event) { event.target.webkitentries.foreach(function(entry) { /* do stuff with the entry */ }); }); each time a change event occurs, this code iterates over the selected files, obtaining their filesystementry-based objects and acting on them.
HTMLMediaElement.load() - Web APIs
the htmlmediaelement method load() resets the media element to its initial state and begins the process of selecting a media source and loading the media in preparation for playback to begin at the beginning.
... usage notes calling load() aborts all ongoing operations involving this media element, then begins the process of selecting and loading an appropriate media resource given the options specified in the <audio> or <video> element and its src attribute or child <source> element(s).
... once media has been selected and loading is ready to begin, the loadstart event is delivered.
... var mediaelem = document.queryselector("video"); mediaelem.load(); specifications specification status comment html living standardthe definition of 'htmlmediaelement.load()' in that specification.
HTML Drag and Drop API - Web APIs
the user may select draggable elements with a mouse, drag those elements to a droppable element, and drop them by releasing the mouse button.
...a typical drag operation begins when a user selects a draggable element, drags the element to a droppable element, and then releases the dragged element.
... each drag event type has an associated global event handler: event on event handler fires when… drag ondrag …a dragged item (element or text selection) is dragged.
...(see specifying drop targets.) dragexit ondragexit …an element is no longer the drag operation's immediate selection target.
MediaTrackSettings - Web APIs
this value is specific to the source of the track's data and is not usable for setting constraints; it can, however, be used for initially selecting media when calling mediadevices.getusermedia().
...this value is specific to the source of the track's data and is not usable for setting constraints; it can, however, be used for initially selecting media when calling mediadevices.getusermedia().
... browser the stream contains the contents of a single browser tab selected by the user.
... window the stream contains a single window selected by the user for sharing.
NodeList - Web APIs
WebAPINodeList
nodelist objects are collections of nodes, usually returned by properties such as node.childnodes and methods such as document.queryselectorall().
...the ubiquitous document.queryselectorall() method returns a static nodelist.
... for...of loops will loop over nodelist objects correctly: const list = document.queryselectorall('input[type=checkbox]'); for (let checkbox of list) { checkbox.checked = true; } recent browsers also support iterator methods (foreach()) as well as entries(), values(), and keys().
... there is also an internet explorer-compatible way to use array.prototype.foreach for iteration: const list = document.queryselectorall('input[type=checkbox]'); array.prototype.foreach.call(list, function (checkbox) { checkbox.checked = true; }); specifications specification status comment domthe definition of 'nodelist' in that specification.
ParentNode - Web APIs
see locating dom elements using selectors to learn how to use css selectors to find nodes or elements of interest.
... parentnode.queryselector() returns the first element with the current element as root that matches the specified group of selectors.
... parentnode.queryselectorall() returns a nodelist representing a list of elements with the current element as root that matches the specified group of selectors.
...added the parentnode.children property, and the parentnode.queryselector(), parentnode.queryselectorall(), parentnode.append(), and parentnode.prepend() methods.
PaymentRequest.shippingOption - Web APIs
the shippingoption read-only attribute of the paymentrequest interface returns either the id of a selected shipping option, null (if no shipping option was set to be selected) or a shipping option selected by the user.
... it is initially null by when no "selected" shipping options are provided.
...if requestshipping was false (or missing), shippingoption returns null, even the developer provides a selected a shipping option.
... syntax // returns the id of the selected paymentshippingoption var shippingoption = request.shippingoption; example in the example below, the paymentrequest.onshippingoptionchange and the paymentrequest.onshippingaoptionchange events are dispatched.
RTCIceCandidatePairStats - Web APIs
non-standard properties selected optional a firefox-specific boolean value which is true if the candidate pair described by this object is the one currently in use.
... the spec-compliant way to determine the selected candidate pair is to look for a stats object of type transport, which is an rtctransportstats object.
... that object's selectedcandidatepairid property indicates whether or not the specified transport is the one being used.
... usage notes the currently-active ice candidate pair—if any—can be obtained by calling the rtcicetransport method getselectedcandidatepair(), which returns an rtcicecandidatepair object, or null if there isn't a pair selected.
SpeechSynthesis - Web APIs
after defining some necessary variables, we retrieve a list of the voices available using speechsynthesis.getvoices() and populate a select menu with them so the user can choose what voice they want.
... inside the inputform.onsubmit handler, we stop the form submitting with preventdefault(), create a new speechsynthesisutterance instance containing the text from the text <input>, set the utterance's voice to the voice selected in the <select> element, and start the utterance speaking via the speechsynthesis.speak() method.
... var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('.txt'); var voiceselect = document.queryselector('select'); var pitch = document.queryselector('#pitch'); var pitchvalue = document.queryselector('.pitch-value'); var rate = document.queryselector('#rate'); var ratevalue = document.queryselector('.rate-value'); var voices = []; function populatevoicelist() { voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voic...
...es[i].name); voiceselect.appendchild(option); } } populatevoicelist(); if (speechsynthesis.onvoiceschanged !== undefined) { speechsynthesis.onvoiceschanged = populatevoicelist; } inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.pitch = pitch.value; utterthis.rate = rate.value; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesis' in that specification.
SubtleCrypto.encrypt() - Web APIs
function getmessageencoding() { const messagebox = document.queryselector(".rsa-oaep #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(publickey) { let encoded = getmessageencoding(); return window.crypto.subtle.encrypt( { name: "rsa-oaep" }, publickey, encoded ); } aes-ctr this code fetches the contents of a text box, encodes it for encryption, and encry...
... function getmessageencoding() { const messagebox = document.queryselector(".aes-ctr #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // counter will be needed for decryption counter = window.crypto.getrandomvalues(new uint8array(16)); return window.crypto.subtle.encrypt( { name: "aes-ctr", counter, length: 64 }, key, encoded ); } let iv = new uint8array(16); let key = new uint8array(16); let data = new uint8array(12345); //crypto functions are wrapped in promises so we have to use await and make sure the function that //contains this code is an async function ...
... function getmessageencoding() { const messagebox = document.queryselector(".aes-cbc #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // iv will be needed for decryption iv = window.crypto.getrandomvalues(new uint8array(16)); return window.crypto.subtle.encrypt( { name: "aes-cbc", iv }, key, encoded ); } ...
... function getmessageencoding() { const messagebox = document.queryselector(".aes-gcm #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } function encryptmessage(key) { let encoded = getmessageencoding(); // iv will be needed for decryption iv = window.crypto.getrandomvalues(new uint8array(12)); return window.crypto.subtle.encrypt( { name: "aes-gcm", iv: iv }, key, encoded ); } specifications specification status comment web cryptography apithe definition of 'subtlecrypto.encrypt()' in that specification.
SubtleCrypto.sign() - Web APIs
WebAPISubtleCryptosign
*/ function getmessageencoding() { const messagebox = document.queryselector(".rsassa-pkcs1 #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( "rsassa-pkcs1-v1_5", privatekey, encoded ); rsa-pss this code fetches the contents of a text box, encodes it for signing, and signs it with a private key.
...*/ function getmessageencoding() { const messagebox = document.queryselector(".rsa-pss #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( { name: "rsa-pss", saltlength: 32, }, privatekey, encoded ); ecdsa this code fetches the contents of a text box, encodes it for signing, and signs it with a private key.
...*/ function getmessageencoding() { const messagebox = document.queryselector(".ecdsa #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( { name: "ecdsa", hash: {name: "sha-384"}, }, privatekey, encoded ); hmac this code fetches the contents of a text box, encodes it for signing, and signs it with a secret key.
...*/ function getmessageencoding() { const messagebox = document.queryselector(".hmac #message"); let message = messagebox.value; let enc = new textencoder(); return enc.encode(message); } let encoded = getmessageencoding(); let signature = await window.crypto.subtle.sign( "hmac", key, encoded ); specifications specification status comment web cryptography apithe definition of 'subtlecrypto.sign()' in that specification.
VideoTrack - Web APIs
the most common use for accessing a videotrack object is to toggle its selected property in order to make it the active video track for its <video> element.
... properties selected a boolean value which controls whether or not the video track is active.
... usage notes to get a videotrack for a given media element, use the element's videotracks property, which returns a videotracklist object from which you can get the individual tracks contained in the media: var el = document.queryselector("video"); var tracks = el.videotracks; you can then access the media's individual tracks using either array syntax or functions such as foreach().
... for (var i = 0; i < tracks.length; i++) { if (tracks[i].language === userlanguage) { tracks[i].selected = true; break; } }); the language is in standard (rfc 5646) format.
Hello vertex attributes - Web APIs
="fragment-shader"> #version 100 precision mediump float; void main() { gl_fragcolor = vec4(0.18, 0.54, 0.34, 1.0); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.queryselector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.queryselector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.queryselector("p").innerhtml = "shader program did not link successfully.
... " + "error log: " + linkerrlog; return; } initializeattributes(); gl.useprogram(program); gl.drawarrays(gl.points, 0, 1); document.queryselector("canvas").addeventlistener("click", function (evt) { var clickxrelativtocanvas = evt.pagex - evt.target.offsetleft; var clickxinwebglcoords = 2.0 * (clickxrelativtocanvas- gl.drawingbufferwidth/2) / gl.drawingbufferwidth; gl.bufferdata(gl.array_buffer, new float32array([clickxinwebglcoords]), gl.static_draw); gl.drawarrays(gl.points, 0, 1); }, false); } var buffer; function initializeattributes() { gl.enablevertexattribarray(0); buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, new float32array([0.0]), gl...
....static_draw); gl.vertexattribpointer(0, 1, gl.float, false, 0, 0); } window.addeventlistener("beforeunload", cleanup, true); function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.drawingbufferwidth, gl.drawingbufferheight); gl.clearcolor(0.0, 0.0, ...
Signaling and video calling - Web APIs
this is done in hopes of identifying even better options than the one initially selected.
...you should, of course, select a mechanism for exchanging signaling information that is appropriate for your application.
... function handleuserlistmsg(msg) { var i; var listelem = document.queryselector(".userlistbox"); while (listelem.firstchild) { listelem.removechild(listelem.firstchild); } msg.users.foreach(function(username) { var item = document.createelement("li"); item.appendchild(document.createtextnode(username)); item.addeventlistener("click", invite, false); listelem.appendchild(item); }); } after getting a reference to the <ul> which contains the li...
... note: we could restrict the set of permitted media inputs to a specific device or set of devices by calling navigator.mediadevices.enumeratedevices() to get a list of devices, filtering the resulting list based on our desired criteria, then using the selected devices' deviceid values in the deviceid field of the the mediaconstraints object passed into getusermedia().
Using the Web Audio API - Web APIs
lucky for us there's a method that allows us to do just that — audiocontext.createmediaelementsource: // get the audio element const audioelement = document.queryselector('audio'); // pass it into the audio context const track = audiocontext.createmediaelementsource(audioelement); note: the <audio> element above is represented in the dom by an object of type htmlmediaelement, which comes with its own set of functionality.
... // select our play button const playbutton = document.queryselector('button'); playbutton.addeventlistener('click', function() { // check if context is in suspended state (autoplay policy) if (audiocontext.state === 'suspended') { audiocontext.resume(); } // play or pause track depending on state if (this.dataset.playing === 'false') { audioelement.play(); thi...
... so let's grab this input's value and update the gain value when the input node has its value changed by the user: const volumecontrol = document.queryselector('#volume'); volumecontrol.addeventlistener('input', function() { gainnode.gain.value = this.value; }, false); note: the values of node objects (e.g.
...again let's use a range type input to vary this parameter: <input type="range" id="panner" min="-1" max="1" value="0" step="0.01"> we use the values from that input to adjust our panner values in the same way as we did before: const pannercontrol = document.queryselector('#panner'); pannercontrol.addeventlistener('input', function() { panner.pan.value = this.value; }, false); let's adjust our audio graph again, to connect all the nodes together: track.connect(gainnode).connect(panner).connect(audiocontext.destination); the only thing left to do is give the app a try: check out the final demo here on codepen.
Window.getComputedStyle() - Web APIs
throws typeerror if the passed object is not an element or the pseudoelt is not a valid pseudo-element selector or is ::part() or ::slotted().
... note: valid pseudo-element selector refers to syntactic validity, e.g.
... html <p>hello</p> css p { width: 400px; margin: 0 auto; padding: 20px; font: 2rem/2 sans-serif; text-align: center; background: purple; color: white; } javascript let para = document.queryselector('p'); let compstyles = window.getcomputedstyle(para); para.textcontent = 'my computed font-size is ' + compstyles.getpropertyvalue('font-size') + ',\nand my computed line-height is ' + compstyles.getpropertyvalue('line-height') + '.'; result description the returned object is the same cssstyledeclaration type as the object returned from the element's style property.
... <style> h3::after { content: ' rocks!'; } </style> <h3>generated content</h3> <script> var h3 = document.queryselector('h3'); var result = getcomputedstyle(h3, ':after').content; console.log('the generated content is: ', result); // returns ' rocks!' </script> notes the returned cssstyledeclaration object contains active values for css property longhand names.
Window.speechSynthesis - Web APIs
after defining some necessary variables, we retrieve a list of the voices available using speechsynthesis.getvoices() and populate a select menu with them so the user can choose what voice they want.
... inside the inputform.onsubmit handler, we stop the form submitting with preventdefault(), create a new speechsynthesisutterance instance containing the text from the text <input>, set the utterance's voice to the voice selected in the <select> element, and start the utterance speaking via the speechsynthesis.speak() method.
... var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); function populatevoicelist() { voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } } populatevoicelist(); if (speechsynthesis.onvoiceschanged !== undefined) { speechsynthesis.onvoiceschanged = populatevoicelist; } inputform.onsubmit = function(...
...event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesis' in that specification.
XRInputSourceEvent() - Web APIs
event types select sent to an xrsession when the sending input source has fully completed a primary action.
... selectend sent to an xrsession when an ongoing primary action ends, or when an input source with an ongoing primary action has been disconnected from the system.
... selectstart sent to an xrsession when an input source begins its primary action, indicating that the user has begun a command-like input, such as pressing a trigger or button, issuing a spoken command, tapping on a touchpad, or the like.
... xrsession.addeventlistener("select", event => { let targetraypose = event.frame.getpose(event.inputsource.targetrayspace, myrefspace); if (targetraypose) { let hit = myhittest(targetraypose.transform); if (hit) { /* handle the hit */ } } }); specifications specification status comment webxr device apithe definition of 'xrinputsourceevent' in that specification.
XRInputSourceEvent - Web APIs
event types select sent to an xrsession when the sending input source has fully completed a primary action.
... selectend sent to an xrsession when an ongoing primary action ends, or when an input source with an ongoing primary action has been disconnected from the system.
... selectstart sent to an xrsession when an input source begins its primary action, indicating that the user has begun a command-like input, such as pressing a trigger or button, issuing a spoken command, tapping on a touchpad, or the like.
... xrsession.addeventlistener("select", event => { let targetraypose = event.frame.getpose(event.inputsource.targetrayspace, myrefspace); if (targetraypose) { let hit = myhittest(targetraypose.transform); if (hit) { /* handle the hit */ } } }); specifications specification status comment webxr device apithe definition of 'xrinputsourceevent' in that specification.
:default - CSS: Cascading Style Sheets
WebCSS:default
the :default css pseudo-class selects form elements that are the default in a group of related elements.
... what this selector matches is defined in html standard §4.16.3 pseudo-classes — it may match the <button>, <input type="checkbox">, <input type="radio">, and <option> elements: a default option element is the first one with the selected attribute, or the first enabled option in dom order.
... multiple <select>s can have more than one selected option, so all will match :default.
... selectors level 4the definition of ':default' in that specification.
:empty - CSS: Cascading Style Sheets
WebCSS:empty
note: in selectors level 4 the :empty pseudo-class was changed to act like :-moz-only-whitespace, but no browser currently supports this yet.
... /* selects any <div> that contains no content */ div:empty { background: lime; } syntax :empty examples html <div class="box"><!-- i will be lime.
...| the paciello group hidden content for better a11y | go make things mdn understanding wcag, guideline 2.4 explanations understanding success criterion 2.4.4 | w3c understanding wcag 2.0 specifications specification status comment selectors level 4the definition of 'the :empty pseudo-class' in that specification.
... selectors level 3the definition of 'the :empty pseudo-class' in that specification.
:enabled - CSS: Cascading Style Sheets
WebCSS:enabled
an element is enabled if it can be activated (selected, clicked on, typed into, etc.) or accept focus.
... /* selects any enabled <input> */ input:enabled { color: blue; } syntax :enabled examples the following example makes the color of text and button <input>s green when enabled, and gray when disabled.
... selectors level 4the definition of ':enabled' in that specification.
... selectors level 3the definition of ':enabled' in that specification.
:first-child - CSS: Cascading Style Sheets
/* selects any <p> that is the first element among its siblings */ p:first-child { color: lime; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
... syntax :first-child examples basic example html <div> <p>this text is selected!</p> <p>this text isn't selected.</p> </div> <div> <h2>this text isn't selected: it's not a `p`.</h2> <p>this text isn't selected.</p> </div> css p:first-child { color: lime; background-color: black; padding: 5px; } result styling a list html <ul> <li>item 1</li> <li>item 2</li> <li>item 3 <ul> <li>item 3.1</li> <li>item 3.2</li> <li>item 3.3</li> </ul> </li> </ul> css ul li { color: blue; } ul li:first-child { color: red; font-weight: bold; } result specifications specification status comment selectors level 4the definition of ':first-child' in that specification.
... selectors level 3the definition of ':first-child' in that specification.
:focus-visible - CSS: Cascading Style Sheets
(many browsers show a “focus ring” by default in this case.) this selector is useful to provide a different focus indicator based on the user’s input modality (mouse vs.
... syntax :focus-visible examples basic example in this example, the :focus-visible selector uses the ua's behavior to determine when to match.
...r> <input class="focus-only" value=":focus only"><br> <button class="focus-only">:focus only</button><br> <input class="focus-visible-only" value=":focus-visible only"><br> <button class="focus-visible-only">:focus-visible only</button> input, button { margin: 10px; } .focus-only:focus { outline: 2px solid black; } .focus-visible-only:focus-visible { outline: 4px dashed darkorange; } selectively showing the focus indicator a custom control, such as a custom element button, can use :focus-visible to selectively apply a focus indicator only on keyboard-focus.
... specifications specification status comment selectors level 4the definition of ':focus-visible' in that specification.
:last-child - CSS: Cascading Style Sheets
/* selects any <p> that is the last element among its siblings */ p:last-child { color: lime; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
... syntax :last-child examples basic example html <div> <p>this text isn't selected.</p> <p>this text is selected!</p> </div> <div> <p>this text isn't selected.</p> <h2>this text isn't selected: it's not a `p`.</h2> </div> css p:last-child { color: lime; background-color: black; padding: 5px; } result styling a list html <ul> <li>item 1</li> <li>item 2</li> <li>item 3 <ul> <li>item 3.1</li> <li>item 3.2</li> <li>item 3.3</li> </ul> </li> </ul> css ul li { color: blue; } ul li:last-child { border: 1px solid red; color: red; } result specifications specification status comment selectors level 4the definition of ':last-child' in that specification.
... selectors level 3the definition of ':last-child' in that specification.
:link - CSS: Cascading Style Sheets
WebCSS:link
/* selects any <a> that has not been visited yet */ a:link { color: red; } styles defined by the :link pseudo-class will be overridden by any subsequent link-related pseudo-class (:active, :hover, or :visited) that has at least equal specificity.
... note: use :any-link to select an element independent of whether it has been visited or not.
... living standard selectors level 4the definition of ':link' in that specification.
... selectors level 3the definition of ':link' in that specification.
:only-child - CSS: Cascading Style Sheets
/* selects each <p>, but only if it is the */ /* only child of its parent */ p:only-child { background-color: lime; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
... element.</li> </ul> </li> <li>second <ul> <li>this list has three elements.</li> <li>this list has three elements.</li> <li>this list has three elements.</li> </ul> </li> </ol> css li li { list-style-type: disc; } li:only-child { color: red; list-style-type: square; } result specifications specification status comment selectors level 4the definition of ':only-child' in that specification.
... selectors level 3the definition of ':only-child' in that specification.
:only-of-type - CSS: Cascading Style Sheets
/* selects each <p>, but only if it is the */ /* only <p> element inside its parent */ p:only-of-type { background-color: lime; } note: as originally defined, the selected element had to have a parent.
... beginning with selectors level 4, this is no longer required.
... <i>i am the only `i` child.</i> <em>i am `em` #1.</em> <em>i am `em` #2.</em> </div> </main> css main :only-of-type { color: red; } result specifications specification status comment selectors level 4the definition of ':only-of-type' in that specification.
... selectors level 3the definition of ':only-of-type' in that specification.
:optional - CSS: Cascading Style Sheets
WebCSS:optional
the :optional css pseudo-class represents any <input>, <select>, or <textarea> element that does not have the required attribute set on it.
... /* selects any optional <input> */ input:optional { border: 1px dashed black; } this pseudo-class is useful for styling fields that are not required to submit a form.
... note: the :required pseudo-class selects required form fields.
... selectors level 4the definition of ':optional' in that specification.
:required - CSS: Cascading Style Sheets
WebCSS:required
the :required css pseudo-class represents any <input>, <select>, or <textarea> element that has the required attribute set on it.
... /* selects any required <input> */ input:required { border: 1px dashed red; } this pseudo-class is useful for highlighting fields that must have valid data before a form can be submitted.
... note: the :optional pseudo-class selects optional form fields.
... selectors level 4the definition of ':required' in that specification.
@namespace - CSS: Cascading Style Sheets
syntax /* default namespace */ @namespace url(xml-namespace-url); @namespace "xml-namespace-url"; /* prefixed namespace */ @namespace prefix url(xml-namespace-url); @namespace prefix "xml-namespace-url"; description the defined namespaces can be used to restrict the universal, type, and attribute selectors to only select elements within that namespace.
...when a default namespace is defined, all universal and type selectors (but not attribute selectors, see note below) apply only to elements in that namespace.
...when a universal, type, or attribute selector is prefixed with a namespace prefix, then that selector only matches if the namespace and name of the element or attribute matches.
...to match this behaviour, the default namespace in css does not apply to attribute selectors.
Adjacent sibling combinator - CSS: Cascading Style Sheets
the adjacent sibling combinator (+) separates two selectors and matches the second element only if it immediately follows the first element, and both are children of the same parent element.
... /* paragraphs that come immediately after any image */ img + p { font-weight: bold; } syntax former_element + target_element { style properties } examples css li:first-of-type + li { color: red; } html <ul> <li>one</li> <li>two!</li> <li>three</li> </ul> result specifications specification status comment selectors level 4the definition of 'next-sibling combinator' in that specification.
... selectors level 3the definition of 'adjacent sibling combinator' in that specification.
... recommendation css level 2 (revision 1)the definition of 'adjacent sibling selectors' in that specification.
Mozilla CSS extensions - CSS: Cascading Style Sheets
d version still accepted] -moz-transform-style [prefixed version still accepted] -moz-transition [prefixed version still accepted] -moz-transition-delay [prefixed version still accepted] -moz-transition-duration [prefixed version still accepted] -moz-transition-property [prefixed version still accepted] -moz-transition-timing-function [prefixed version still accepted] -moz-user-select values global values -moz-initial -moz-appearance button button-arrow-down button-arrow-next button-arrow-previous button-arrow-up button-bevel checkbox checkbox-container checkbox-label checkmenuitem dialog groupbox listbox menuarrow menucheckbox menuimage menuitem menuitemtext menulist menulist-button menulist-text menulist-textfield menupopup menuradio ...
...highlight -moz-cellhighlighttext -moz-field -moz-fieldtext -moz-dialog -moz-dialogtext -moz-dragtargetzone -moz-mac-accentdarkestshadow -moz-mac-accentdarkshadow -moz-mac-accentface -moz-mac-accentlightesthighlight -moz-mac-accentlightshadow -moz-mac-accentregularhighlight -moz-mac-accentregularshadow -moz-mac-chrome-active -moz-mac-chrome-inactive -moz-mac-focusring -moz-mac-menuselect -moz-mac-menushadow -moz-mac-menutextselect -moz-menuhover -moz-menuhovertext -moz-win-communicationstext -moz-win-mediatext -moz-nativehyperlinktext display -moz-box -moz-inline-block -moz-inline-box -moz-inline-gridobsolete since gecko 62 -moz-inline-stackobsolete since gecko 62 -moz-inline-table -moz-gridobsolete since gecko 62 -moz-grid-groupobsolete since gecko 6...
...z-persian -moz-simp-chinese-formal -moz-simp-chinese-informal -moz-tamil -moz-telugu -moz-thai -moz-trad-chinese-formal -moz-trad-chinese-informal -moz-urdu overflow -moz-scrollbars-none -moz-scrollbars-horizontal -moz-scrollbars-vertical -moz-hidden-unscrollable text-align -moz-center -moz-left -moz-right text-decoration -moz-anchor-decoration -moz-user-select -moz-all -moz-none width, min-width, and max-width -moz-min-content -moz-fit-content -moz-max-content -moz-available pseudo-elements and pseudo-classes a – d ::-moz-anonymous-block eg@:- bug 331432 ::-moz-anonymous-positioned-block :-moz-any :-moz-any-link [matches :link and :visited] :-moz-broken ::-moz-canvas ::-moz-color-swatch ::-moz-cell-content :-mo...
...s :-moz-only-whitespace ::-moz-page ::-moz-page-sequence ::-moz-pagebreak ::-moz-pagecontent :-moz-placeholderobsolete since gecko 51 ::-moz-placeholderdeprecated since gecko 51 ::-moz-progress-bar ::-moz-range-progress ::-moz-range-thumb ::-moz-range-track :-moz-read-only :-moz-read-write s ::-moz-scrolled-canvas ::-moz-scrolled-content ::-moz-scrolled-page-sequence ::-moz-selectiondeprecated since gecko 62 :-moz-submit-invalid :-moz-suppressed ::-moz-svg-foreign-content t ::-moz-table ::-moz-table-cell ::-moz-table-column ::-moz-table-column-group ::-moz-table-outer ::-moz-table-row ::-moz-table-row-group :-moz-tree-cell :-moz-tree-cell-text :-moz-tree-cell-text(hover) :-moz-tree-checkbox :-moz-tree-column :-moz-tree-drop-feedback :-moz-tree-image ...
Pseudo-elements - CSS: Cascading Style Sheets
a css pseudo-element is a keyword added to a selector that lets you style a specific part of the selected element(s).
... syntax selector::pseudo-element { property: value; } you can use only one pseudo-element in a selector.
... it must appear after the simple selectors in the statement.
... index of standard pseudo-elements ::after (:after) ::backdrop ::before (:before) ::cue ::cue-region ::first-letter (:first-letter) ::first-line (:first-line) ::grammar-error ::marker ::part() ::placeholder ::selection ::slotted() ::spelling-error browser lowest version support of internet explorer 8.0 :pseudo-element 9.0 :pseudo-element ::pseudo-element firefox (gecko) 1.0 (1.0) :pseudo-element 1.0 (1.5) :pseudo-element ::pseudo-element opera 4.0 :pseudo-element 7.0 :pseudo-element ::pseudo-element ...
Scaling of SVG backgrounds - CSS: Cascading Style Sheets
since there's no intrinsic ratio or height provided, auto selects the height of the background area as the height for the rendered image.
... background: url(100px-wide-no-height-or-ratio.svg); background-size: auto 125px; in this case, the width is specified as auto in the css, so the 100px width specified in the svg is selected, per rule 3.
... the height is set at 125px in the css, so that is selected per rule 1.
... source: no specified dimensions with intrinsic ratio if no dimensions are specified in the svg, the specified dimension in the css is applied, then the intrinsic ratio is used to select the other dimension, per rule 2.
cursor - CSS: Cascading Style Sheets
WebCSScursor
selection cell the table cell or set of cells can be selected.
... crosshair cross cursor, often used to indicate selection in a bitmap.
... text the text can be selected.
... vertical-text the vertical text can be selected.
<easing-function> - CSS: Cascading Style Sheets
examples easing function comparison this example creates an animation that can be started and stopped again using the provided button, and a select menu that can be used to switch its easing function between the available keywords, plus a couple of cubic-bezier() and steps() options.
... html <div> <div></div> </div> <ul> <li> <button class="animation-button">start animation</button> </li> <li> <label for="easing-select">choose an easing function:</label> <select id="easing-select"> <option selected>linear</option> <option>ease</option> <option>ease-in</option> <option>ease-in-out</option> <option>ease-out</option> <option>cubic-bezier(0.1, -0.6, 0.2, 0)</option> <option>cubic-bezier(0, 1.1, 0.8, 4)</option> <option>steps(5, end)</option> <option>steps(3, start)</option> <option>steps(4)</option> </select> </li> </ul> css body > div { position: relative; height: 100px; } div > div { position: absolute; w...
... background-color: blue; background-image: radial-gradient(circle at 10px 10px, rgba(25,255,255,0.8),rgba(25,255,255,0.4)); border-radius: 50%; top: 25px; animation: 1.5s infinite alternate; } @keyframes move-right { from { left: 10%; } to { left: 90%; } } li { display: flex; align-items: center; justify-content: center; margin-bottom: 20px; } javascript const selectelem = document.queryselector('select'); const startbtn = document.queryselector('button'); const divelem = document.queryselector('div > div'); startbtn.addeventlistener('click', () => { if(startbtn.textcontent === 'start animation') { divelem.style.animationname = 'move-right'; startbtn.textcontent = 'stop animation'; divelem.style.animationtimingfunction = selectelem.value; } e...
...lse { divelem.style.animationname = 'unset'; startbtn.textcontent = 'start animation'; } }); selectelem.addeventlistener('change', () => { divelem.style.animationtimingfunction = selectelem.value; }); result cubic-bezier() function examples these cubic bézier curves are valid for use in css: /* the canonical bézier curve with four <number> in the [0,1] range.
font-stretch - CSS: Cascading Style Sheets
the font-stretch css property selects a normal, condensed, or expanded face from a font.
... you can use font-stretch to select a condensed or expanded face from such fonts.
... font face selection the face selected for a given value of font-stretch depends on the faces supported by the font in question.
...all values of font-stretch less than 100% select the condensed face, while all other values select the normal face.
place-items - CSS: Cascading Style Sheets
nt: center; } #item1 { background-color: #8cffa0; min-height: 30px; } #item2 { background-color: #a0c8ff; min-height: 50px; } #item3 { background-color: #ffa08c; min-height: 40px; } #item4 { background-color: #ffff8c; min-height: 60px; } #item5 { background-color: #ff8cff; min-height: 70px; } #item6 { background-color: #8cffff; min-height: 50px; font-size: 30px; } select { font-size: 16px; } .row { margin-top: 10px; } html <div id="container" class="flex"> <div id="item1">1</div> <div id="item2">2</div> <div id="item3">3</div> <div id="item4">4</div> <div id="item5">5</div> <div id="item6">6</div> </div> <div class="row"> <label for="display">display: </label> <select id="display"> <option value="flex">flex</option> <option value="...
...grid">grid</option> </select> </div> <div class="row"> <label for="values">place-items: </label> <select id="values"> <option value="start">start</option> <option value="center">center</option> <option value="end">end</option> <option value="left">left</option> <option value="right">right</option> <option value="auto center">auto center</option> <option value="normal start">normal start</option> <option value="center normal">center normal</option> <option value="start auto">start auto</option> <option value="end normal">end normal</option> <option value="self-start auto">self-start auto</option> <option value="self-end normal">self-end normal</option> <option value="flex-start auto">flex-start auto</option> <option value="flex-end no...
...rmal">flex-end normal</option> <option value="left auto">left auto</option> <option value="right normal">right normal</option> <option value="baseline normal">baseline normal</option> <option value="first baseline auto">first baseline auto</option> <option value="last baseline normal">last baseline normal</option> <option value="stretch auto">stretch auto</option> </select> </div> javascript var values = document.getelementbyid('values'); var display = document.getelementbyid('display'); var container = document.getelementbyid('container'); values.addeventlistener('change', function (evt) { container.style.placeitems = evt.target.value; }); display.addeventlistener('change', function (evt) { container.classname = evt.target.value; }); css #container { hei...
...ght:200px; width: 240px; place-items: center; /* you can change this value by selecting another option in the list */ background-color: #8c8c8c; } .flex { display: flex; flex-wrap: wrap; } .grid { display: grid; grid-template-columns: repeat(auto-fill, 50px); } result specifications specification status comment css box alignment module level 3the definition of 'place-items' in that specification.
<transform-function> - CSS: Cascading Style Sheets
examples transform function comparison the following example provides a 3d cube created from dom elements and transforms, and a select menu allowing you to choose different transform functions to transform the cube with, so you can compare the effects of the different types.
... html <main> <section id="example-element"> <div class="face front">1</div> <div class="face back">2</div> <div class="face right">3</div> <div class="face left">4</div> <div class="face top">5</div> <div class="face bottom">6</div> </section> <div class="select-form"> <label>select a transform function</label> <select> <option selected>choose a function</option> <option>rotate(360deg)</option> <option>rotatex(360deg)</option> <option>rotatey(360deg)</option> <option>rotatez(360deg)</option> <option>rotate3d(1, 1, 1, 90deg)</option> <option>scale(1.5)</option> <option>scalex(1.5)</option> <opt...
...option> <option>translate(100px, 100px)</option> <option>translatex(100px)</option> <option>translatey(100px)</option> <option>translatez(100px)</option> <option>translate3d(50px, 50px, 50px)</option> <option>perspective(200px)</option> <option>matrix(1, 2, -1, 1, 80, 80)</option> <option>matrix3d(1,0,0,0,0,1,3,0,0,0,1,0,50,100,0,1.1)</option> </select> </div> </main> css main { width: 400px; height: 200px; padding: 50px; background-image: linear-gradient(135deg, white, cyan, white); } #example-element { width: 100px; height: 100px; transform-style: preserve-3d; transition: transform 1.5s; transform: rotate3d(1, 1, 1, 30deg); } .face { display: flex; align-items: center; justify-content: center; width: 100%; he...
...tatey(180deg) translatez(50px); } .right { background: rgba(210,0,0,.7); transform: rotatey(90deg) translatez(50px); } .left { background: rgba(0,0,210,.7); transform: rotatey(-90deg) translatez(50px); } .top { background: rgba(210,210,0,.7); transform: rotatex(90deg) translatez(50px); } .bottom { background: rgba(210,0,210,.7); transform: rotatex(-90deg) translatez(50px); } .select-form { margin-top: 50px; } javascript const selectelem = document.queryselector('select'); const example = document.queryselector('#example-element'); selectelem.addeventlistener('change', () => { if(selectelem.value === 'choose a function') { return; } else { example.style.transform = `rotate3d(1, 1, 1, 30deg) ${selectelem.value}`; settimeout(function() { example.style...
transition-delay - CSS: Cascading Style Sheets
ht background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:0.5s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:0.5s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:1s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:1s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...height background-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:2s; -webkit-transition-timing-function: linear; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:2s; transition-timing-function: linear; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-delay: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...kground-color font-size left top color; -webkit-transition-duration:2s; -webkit-transition-delay:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top color; transition-duration:2s; transition-delay:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-delay' in that specification.
transition-duration - CSS: Cascading Style Sheets
ound-color font-size left top transform -webkit-transform color; -webkit-transition-duration:0.5s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transformv color; transition-duration:0.5s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 1s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top -webkit-transform transform color; -webkit-transition-duration:1s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:1s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 2s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top transform -webkit-transform color; -webkit-transition-duration:2s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:2s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); transition-duration: 4s <div class="parent"> <div class="box">lorem</div> </div> .parent { width: 250px; height:125px;} .box { width: 100px; height: 100px; ...
...ackground-color font-size left top transform -webkit-transform color; -webkit-transition-duration:4s; -webkit-transition-timing-function: ease-in-out; transition-property: width height background-color font-size left top transform -webkit-transform color; transition-duration:4s; transition-timing-function: ease-in-out; } function updatetransition() { var el = document.queryselector("div.box"); if (el) { el.classname = "box1"; } else { el = document.queryselector("div.box1"); el.classname = "box"; } return el; } var intervalid = window.setinterval(updatetransition, 7000); specifications specification status comment css transitionsthe definition of 'transition-duration' in that specification.
<img>: The Image Embed element - HTML: Hypertext Markup Language
WebHTMLElementimg
user agents use the current source size to select one of the sources supplied by the srcset attribute, when those sources are described using width (w) descriptors.
... the selected source size affects the intrinsic size of the image (the image’s display size if no css styling is applied).
... the user agent selects any of the available sources at its discretion.
... this provides them with significant leeway to tailor their selection based on things like user preferences or bandwidth conditions.
<input type="number"> - HTML: Hypertext Markup Language
WebHTMLElementinputnumber
events change and input supported common attributes autocomplete, list, placeholder, readonly idl attributes list, value, valueasnumber methods select(), stepup(), stepdown() value any floating-point number, or empty.
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
...xample, to adjust the width of the input to be only as wide as is needed to enter a three-digit number, we can change our html to include an id and to shorten our placeholder since the field will be too narrow for the text we have been using so far: <input type="number" placeholder="x10" step="10" min="0" max="100" id="number"> then we add some css to narrow the width of the element with the id selector #number: #number { width: 3em; } the result looks like this: offering suggested values you can provide a list of default options from which the user can select by specifying the list attribute, which contains as its value the id of a <datalist>, which in turn contains one <option> element per suggested value.
... div { margin-bottom: 10px; position: relative; } input[type="number"] { width: 100px; } input + span { padding-right: 30px; } input:invalid+span:after { position: absolute; content: '✖'; padding-left: 5px; } input:valid+span:after { position: absolute; content: '✓'; padding-left: 5px; } and finally, the javascript: let metersinputgroup = document.queryselector('.metersinputgroup'); let feetinputgroup = document.queryselector('.feetinputgroup'); let metersinput = document.queryselector('#meters'); let feetinput = document.queryselector('#feet'); let inchesinput = document.queryselector('#inches'); let switchbtn = document.queryselector('input[type="button"]'); switchbtn.addeventlistener('click', function() { if(switchbtn.getattribute('class') === '...
<input type="password"> - HTML: Hypertext Markup Language
WebHTMLElementinputpassword
value a domstring representing a password, or empty events change and input supported common attributes autocomplete, inputmode, maxlength, minlength, pattern, placeholder, readonly, required, and size idl attributes selectionstart, selectionend, selectiondirection, and value methods select(), setrangetext(), and setselectionrange() value the value attribute contains a domstring whose value is the current contents of the text editing control being used to enter the password.
... use of a pattern is strongly recommended for password inputs, in order to help ensure that valid passwords using a wide assortment of character classes are selected and used by your users.
... <label for="pin">pin:</label> <input id="pin" type="password" inputmode="numeric" minlength="4" maxlength="8" size="8"> selecting text as with other textual entry controls, you can use the select() method to select all the text in the password field.
... html <label for="userpassword">password: </label> <input id="userpassword" type="password" size="12"> <button id="selectall">select all</button> javascript document.getelementbyid("selectall").onclick = function() { document.getelementbyid("userpassword").select(); } result you can also use selectionstart and selectionend to get (or set) what range of characters in the control are currently selected, and selectiondirection to know which direction selection occurred in (or will be extended in, depending on your platform; see its documentation for an explanation).
<optgroup> - HTML: Hypertext Markup Language
WebHTMLElementoptgroup
the html <optgroup> element creates a grouping of options within a <select> element.
... permitted parents a <select> element.
... disabled if this boolean attribute is set, none of the items in this option group is selectable.
... examples <select> <optgroup label="group 1"> <option>option 1.1</option> </optgroup> <optgroup label="group 2"> <option>option 2.1</option> <option>option 2.2</option> </optgroup> <optgroup label="group 3" disabled> <option>option 3.1</option> <option>option 3.2</option> <option>option 3.3</option> </optgroup> </select> result specifications specification status comment html living standardthe definition of '<optgroup>' in that specificat...
<picture>: The Picture element - HTML: Hypertext Markup Language
WebHTMLElementpicture
if no matches are found—or the browser doesn't support the <picture> element—the url of the <img> element's src attribute is selected.
... the selected image is then presented in the space occupied by the <img> element.
... to decide which url to load, the user agent examines each <source>'s srcset, media, and type attributes to select a compatible image that best matches the current layout and capabilities of the display device.
... examples these examples demonstrate how different attributes of the <source> element change the selection of the image inside <picture>.
HTML elements reference - HTML: Hypertext Markup Language
WebHTMLElement
<optgroup> the html <optgroup> element creates a grouping of options within a <select> element.
... <option> the html <option> element is used to define an item contained in a <select>, an <optgroup>, or a <datalist> element.
... <select> the html <select> element represents a control that provides a menu of options <textarea> the html <textarea> element represents a multi-line plain-text editing control, useful when you want to allow users to enter a sizeable amount of free-form text, for example a comment on a review or feedback form.
... interactive elements html offers a selection of elements which help to create interactive user interface objects.
Global attributes - HTML: Hypertext Markup Language
agover, ondragstart, ondrop, ondurationchange, onemptied, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onsort, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting.
...classes allows css and javascript to select and access specific elements via the class selectors or functions like the method document.getelementsbyclassname().
...part names allows css to select and style specific elements in a shadow tree via the ::part pseudo-element.
... tabindex is only supported on <a>, <area>, <button>, <object>, <select>, and <textarea>.
Content negotiation - HTTP
the experimental accept-ch lists configuration data that can be used by the server to select an appropriate response.
...in other words, only entry pages of a site should select the proper language using this header.
... the user-agent header though there are legitimate uses of this header for selecting content, it is considered bad practice to rely on it to define what features are supported by the user agent.
...a cache, in order to work with server-driven content negotiation, needs to know which criteria was used by the server to select the transmitted content.
Loops and iteration - JavaScript
example in the example below, the function contains a for statement that counts the number of selected options in a scrolling list (a <select> element that allows multiple selections).
...it checks that i is less than the number of options in the <select> element, performs the succeeding if statement, and increments i by after each pass through the loop.
... <form name="selectform"> <p> <label for="musictypes">choose some music types, then click the button below:</label> <select id="musictypes" name="musictypes" multiple="multiple"> <option selected="selected">r&b</option> <option>jazz</option> <option>blues</option> <option>new age</option> <option>classical</option> <option>opera</option> </select> </p> <p><input id="btn" type="button" value="how many are selected?" /></p> </form> <script> function howmany(selectobject) { let numberselected = 0; for (let i = 0; i < selectobject.options.length; i++) { if (selectobject.options[i].selected) { numberselected++; } } return numberselected; } let btn = document.getelementbyid('btn'); btn.addeventlistener('click', function() {...
... alert('number of options selected: ' + howmany(document.selectform.musictypes)); }); </script> do...while statement the do...while statement repeats until a specified condition evaluates to false.
Codecs used by WebRTC - Web media technologies
licensing terms before choosing a video codec, make sure you're aware of any licensing requirements around the codec you select; you can find information about possible licensing concerns in our main guide to video codecs used on the web.
...if you select avc, make sure you're; aware of any potential fees you may need to pay; that said, the patent holders have generally said that most typical web site developers shouldn't need to worry about paying the license fees, which are typically focused more on the developers of the encoding and decoding software.
... keep in mind that choosing a codec that isn't on the list of mandatory codecs likely runs the risk of selecting a codec which isn't supported by a browser your users might prefer.
... security implications there are interesting potential security issues that come come up while selecting and configuring codecs.
current - XPath
<xsl:value-of select="current()"/> <xsl:value-of select="."/> in an inner expression (e.g.
... <xsl:value-of select="current()"/> <xsl:value-of select="foo/bar[current() = x]"/> <xsl:variable name="current" select="current()"/> <xsl:value-of select="foo/bar[$current = x]"/> and the next code is also semantically equivalent to the latter two, since the .
... <xsl:variable name="current" select="."/> <xsl:value-of select="foo/bar[$current = x]"/> but the .
...thus in <xsl:value-of select="foo/bar[.
Index - XSLT: Extensible Stylesheet Language Transformations
WebXSLTIndex
21 <xsl:apply-templates> element, reference, xslt, apply-templates the <xsl:apply-templates> element selects a set of nodes in the input tree and instructs the processor to apply the proper templates to them.
... 27 <xsl:copy-of> element, reference, xslt, copy-of the <xsl:copy-of> element makes a deep copy (including descendant nodes) of whatever the select attribute specifies to the output document.
... 32 <xsl:for-each> element, reference, xslt, for, for-each the <xsl:for-each> element selects a set of nodes and processes each of them in the same way.
... 45 <xsl:sort> element, reference, xslt, sort the <xsl:sort> element defines a sort key for nodes selected by <xsl:apply-templates> or <xsl:for-each> and determines the order in which they are processed.
simple-prefs - Archive of obsolete content
{ "type": "color", "name": "highlightcolor", "value": "#6a5acd", "title": "highlight color" } file displayed as a "browse" button that opens a file picker and stores the full path and name of the file selected.
... { "type": "file", "name": "myfile", "title": "select a file" } directory displayed as a "browse" button that opens a directory picker and stores the full path and name of the directory selected.
... { "type": "directory", "name": "mydirectory", "title": "select a directory" } menulist displayed as a drop-down list.
ui/frame - Archive of obsolete content
for example, this html document defines a <select> element and a couple of <span> elements, and includes a css file to style the content and a javascript script to implement behavior: <!doctype html> <html> <head> <link href="city-info.css" rel="stylesheet"></link> </head> <body> <select name="city" id="city-selector"></select> <span id="time" class="info-element"></span> <span id="weather" class="info-element"></span> ...
...message("ping", "*"); if the frame script has received a message from the add-on already, it can use the origin property of the event object passed to the message hander: // listen for messages from the add-on, and send a reply window.addeventlistener("message", function(event) { event.source.postmessage("pong", event.origin) }, false); this frame script listens to change events on the "city-selector" <select> element, and sends a message to the add-on containing the value for the newly selected element.
... // city-info.js var cityselector = window.document.getelementbyid("city-selector"); cityselector.addeventlistener("change", citychanged); function citychanged() { window.parent.postmessage(cityselector.value, "*"); } to listen for these messages in the main add-on code, you can assign a listener to the frame's message event.
Storing annotations - Archive of obsolete content
nhtml = $('#template .annotation-details').clone(); annotationhtml.find('.url').text(storedannotation.url) .attr('href', storedannotation.url); annotationhtml.find('.url').bind('click', function(event) { event.stoppropagation(); event.preventdefault(); self.postmessage(storedannotation.url); }); annotationhtml.find('.selection-text') .text(storedannotation.anchortext); annotationhtml.find('.annotation-text') .text(storedannotation.annotationtext); annotationlist.append(annotationhtml); }); }); it builds the dom for the panel from the array of annotations it is given.
...list html and css here's the html for the annotation list: <html> <head> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>saved annotations</title> <link rel="stylesheet" type="text/css" href="annotation-list.css" /> </head> <body> <div id="annotation-list"> </div> <div id="template"> <div class="annotation-details"> <a class="url"></a> <div class="selection-text"></div> <div class="annotation-text"></div> </div> </div> </body> </html> here's the corresponding css: #annotation-list .annotation-details { padding: 10px; margin: 10px; border: solid 3px #eee; background-color: white; } #annotation-list .url, .selection-text, .annotation-text { padding: 5px; margin: 5px; } #annotation-list .selection-text,#annotation-li...
... this means that its widget will not appear on any private windows and its selector and matcher content scripts won't run, so the user won't be able to enter any annotations in private windows.
Tree - Archive of obsolete content
treeview.rowcount; i++) { if (treeview.iscontainer(i) && !treeview.iscontaineropen(i)) treeview.toggleopenstate(i); } to collapse all tree nodes just change the condition: var treeview = tree.treeboxobject.view; for (var i = 0; i < treeview.rowcount; i++) { if (treeview.iscontainer(i) && treeview.iscontaineropen(i)) treeview.toggleopenstate(i); } getting the text from the selected row assuming the given <tree>: <tree id="my-tree" seltype="single" onselect="ontreeselected()"> use the following javascript: function ontreeselected(){ var tree = document.getelementbyid("my-tree"); var cellindex = 0; var celltext = tree.view.getcelltext(tree.currentindex, tree.columns.getcolumnat(cellindex)); alert(celltext); } getting the tree item from the focused row ...
... assuming <tree id="my-tree">, you can use the following to get the tree item: var view = document.getelementbyid("my-tree").view; var sel = view.selection.currentindex; //returns -1 if the tree is not focused var treeitem = view.getitematindex(sel); note that the current index may be unselected (for example, a multi-select tree).
...use the following javascript: function ontreeclicked(event){ var tree = document.getelementbyid("my-tree"); var tbo = tree.treeboxobject; // get the row, col and child element at the point var row = { }, col = { }, child = { }; tbo.getcellat(event.clientx, event.clienty, row, col, child); var celltext = tree.view.getcelltext(row.value, col.value); alert(celltext); } getting the selected indices of a multiselect tree var start = {}, end = {}, numranges = tree.view.selection.getrangecount(), selectedindices = []; for (var t = 0; t < numranges; t++){ tree.view.selection.getrangeat(t, start, end); for (var v = start.value; v <= end.value; v++) selectedindices.push(v); } other resources xul: tree documentation xul tutorial: tree selection ...
Appendix: What you should know about open-source software licenses - Archive of obsolete content
caveats on license selection be aware of the following points whether you’re modifying existing source code or selecting a license for the first time.
... you cannot rewrite an existing license if you select any existing oss license and rewrite any part of it on your own, you should not use the same license name as the original.
...it has the following characteristics: gives creators flexibility when selecting and applying terms; terms of use stated in easy-to-understand language; licensing conditions conform with current copyright laws; also has an rdf schema for attaching metadata.
Adding Toolbars and Toolbar Buttons - Archive of obsolete content
windows: /* the second and third selectors at the bottom are necessary to prevent conflicts with installed themes.
... */ toolbarbutton.xulschoolhello-toolbarbutton, window:not([active="true"]) toolbarbutton.xulschoolhello-toolbarbutton, toolbar[iconsize="small"] toolbarbutton.xulschoolhello-toolbarbutton { list-style-image: url("chrome://xulschoolhello-os/skin/toolbar.png"); } #xulschoolhello-hello-world-button { -moz-image-region: rect(0px, 16px, 16px, 0px); } mac os x: /* the second and third selectors at the bottom are necessary to prevent conflicts with installed themes.
... */ toolbarbutton.xulschoolhello-toolbarbutton, window:not([active="true"]) toolbarbutton.xulschoolhello-toolbarbutton, toolbar[iconsize="small"] toolbarbutton.xulschoolhello-toolbarbutton { list-style-image: url("chrome://xulschoolhello-os/skin/toolbar.png"); } #xulschoolhello-hello-world-button { -moz-image-region: rect(0px, 16px, 16px, 0px); } linux: /* the second and third selectors at the bottom are necessary to prevent conflicts with installed themes.
Setting up an extension development environment - Archive of obsolete content
as we are specifically defining the user profile dev, if you don't have the dev profile already created, the profile selection window opens, where you can create it.
...on the "advanced" page, select the "general" tab then click the "config editor" button.
...for example, rather than having content myextension jar:chrome/myextension.jar!/content/ use content myextension chrome/content/ preventing the first launch extension selector requires gecko 8.0(firefox 8.0 / thunderbird 8.0 / seamonkey 2.5) starting in firefox 8, on the first launch of a new version of firefox, it presents user interface letting users select which third party add-ons to keep.
Supporting search suggestions in search plugins - Archive of obsolete content
once the list has been retrieved, it's displayed in a popup box that appears under the search bar, which lets the user select a suggested search term.
...this enhancement request - the handling of a selected suggestion, namely calling of a full specified url as proposed in the opensearch standard - is tracked in bug 386591.
...in addition, the method you use to select suggestions is entirely up to you.
Bookmark Keywords - Archive of obsolete content
to file this bookmark open the "bookmarks" menu in the browser and select "add bookmark," or by of use the keyboard equivalent (e.g., <tt>cmd-d</tt> on macintosh).
...to open the bookmark manager go to "bookmarks" menu and select the "manage bookmarks" option.
... changing the properties to alter the properties of the bookmark, highlight the bookmark and select the "properties..." button at the top of the bookmark manager.
Finding the code to modify - Archive of obsolete content
when you select a node in the tree, a red border flashes for several seconds around the visual representation of that node in the browser window.
... scroll down the tree to the statusbar node and select it.
...click the plus sign next to the statusbar node in the dom inspector and select each statusbarpanel node in turn.
slideBar - Archive of obsolete content
when a slidebar feature is selected its contents will be revealed from behind the current webpage.
...jetpack.future.import("slidebar"); methods append(iconurihtmlhtml/xmlurluriwidthintpersistboolautoreloadboolonclickfunctiononselectfunctiononreadyfunction)this is a list of options to specify modifications to your slidebar instance.
... iconhref oficon to show in the slidebaruri htmlhtml content for the featurehtml/xml urlurl to load content for the featureuri widthwidth of the content area and the selected slide sizeint persistdefault slide behavior when being selectedbool autoreloadautomatically reload content on selectbool onclickcallback when the icon is clickedfunction onselectcallback when the feature is selectedfunction onreadycallback when featured is loadedfunction an example: jetpack.slidebar.append({ url: "http://mozilla.com", width: 150, onclick: function(slide){ slide.icon.src = "chrome://branding/content/icon48.png"; }}); ...
Using Breakpoints in Venkman - Archive of obsolete content
this advanced feature and other options you can see for the associated script are available from the future breakpoint properties dialog, which you can access by right-clicking a breakpoint and selecting properties.
... once you've created a script that will be executed when the associated breakpoint is hit, you can select a number of different options from the future breakpoint properties dialog that determine how venkman will deal with the output of the associated script.
... to enable meta comments in a script, select "scan for meta comments" from the context menu of the file in the loaded scripts view.
XML in Mozilla - Archive of obsolete content
lastly, there is a pref you might want to try (especially useful with fixptr) that will select the link target when you traverse it.
...add this line: pref("layout.selectanchor", true); dom load and save methods document.load() is a part of an old version of the w3c dom level 3 load & save module.
... see also e4x xquery code snippets for queryselector - useful techniques for navigating dom using css selectors on xml dom documents (firefox 3.5 only) identifying xml elements and documents parsing and serializing xml ...
color - Archive of obsolete content
« xul reference home color type: color string the currently selected color.
... this is modified when the user selects a color.
... you can assign a string of the form #rrggbb to this property to change the selected color.
Building accessible custom components in XUL - Archive of obsolete content
; border-left: 1px solid black; margin: 0; padding: 3px; } grid.spreadsheet description { color: black; background-color: white; margin: 0px; padding: 2px; border-left: thin solid; border-bottom: thin solid; font-family: monospace; font-size: 12pt; text-align: center; font-weight: bold; } </code> you can see the results by installing stage-1.xpi, restarting firefox, and selecting accjax from the tools menu.
...when the user presses enter, we replace the currently focused xul label element with a xul textbox element, copy the initial value over to the textbox element, and call its focus and select methods to set focus to the textbox and select the entire value.
..."http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"; const x2_ns ="http://www.w3.org/tr/xhtml2" function start_edit(label) { var value = label.value; settimeout(function(){ var textbox = document.createelementns(xul_ns, "textbox"); label.parentnode.replacechild(textbox, label); textbox.value = value; textbox.origvalue = value; textbox.flex = 1; textbox.focus(); textbox.select(); textbox.addeventlistener("blur", editable_cell_blur, true); textbox.addeventlistener("keypress", editable_cell_keypress, true); }, 0); } function done_edit(textbox, keepvalue) { var value = textbox.value; var label = document.createelementns(xul_ns, "label"); label.setattributens(x2_ns, "role", "wairole:gridcell"); textbox.parentnode.replacechild(label, textbox); if ...
Introduction to XUL - Archive of obsolete content
interface xulelement : element { nodelist getelementsbyattribute(in domstring name, in domstring value); }; getelementsbyattribute functions as does its namesake in xuldocument, though this version returns only those elements which match the criteria and are descendants (in css selector terminology) of the given element.
...the menu bar has a menu, file, with a single menu item that dumps "hello world!" to the debug console when selected.
...this handler fires when the menu is selected by the user, and it dumps the text "hello world!" to the debug console.
checkAdjacentElement - Archive of obsolete content
« xul reference home checkadjacentelement( dir ) return type: no return value deselects the currently selected radio button in the group and selects the one adjacent to it.
... if the argument dir is true, the next radio button is selected.
... if it is false, the previous radio button is selected.
Methods - Archive of obsolete content
« xul reference home acceptdialog additemtoselection addpane addprogresslistener addsession addtab addtabsprogresslistener advance advanceselectedtab appendcustomtoolbar appendgroup appenditem appendnotification blur cancel canceldialog centerwindowonscreen checkadjacentelement clearresults clearselection click close collapsetoolbar contains decrease decreasepage docommand ensureelementisvisible ensureindexisvisible ensureselectedelementisvisible expandtoolbar extra1 extra2 focus getbrowseratindex getbrowserfordocument getbrowserfortab getbrowserindexfordocument getbutton getdefaultsession geteditor getelementsbyattribute getelementsbyattributens getformattedstring gethtmleditor getindexoffirstv...
...isiblerow getindexofitem getitematindex getnextitem getnotificationbox getnotificationwithvalue getnumberofvisiblerows getpagebyid getpreviousitem getresultat getresultcount getresultvalueat getrowcount getsearchat getselecteditem getsession getsessionbyname getsessionresultat getsessionstatusat getsessionvalueat getstring goback gobackgroup godown goforward goforwardgroup gohome goto gotoindex goup hidepopup increase increasepage insertitem insertitemat invertselection loadgroup loadonetab loadtabs loaduri loaduriwithflags makeeditable movebyoffset moveto movetoalertposition onsearchcomplete ontextentered ontextreverted openpopup openpopupatscreen opensubdialog openwindow preferenceforelement...
... reload reloadalltabs reloadtab reloadwithflags removeallitems removeallnotifications removealltabsbut removecurrentnotification removecurrenttab removeitemat removeitemfromselection removenotification removeprogresslistener removesession removetab removetabsprogresslistener removetransientnotifications replacegroup reset rewind scrollbyindex scrollbypixels scrolltoindex select selectall selectitem selectitemrange selecttabatindex setselectionrange showpane showpopup sizeto startediting stop stopediting swapdocshells syncsessions timedselect toggleitemselection related dom element methods dom:element.addeventlistener dom:element.appendchild dom:element.comparedocumentposition dom:element.dispatchevent dom:e...
MenuButtons - Archive of obsolete content
for instance, in the following example, pressing the 'view' button will open a menu which allows the user to select from a set of radio menuitems.
... presumably, when one is selected, the application view would be changed accordingly.
... <button type="menu" label="view"> <menupopup> <menuitem label="icons" type="radio" name="view"/> <menuitem label="list" type="radio" name="view"/> <menuitem label="details" type="radio" name="view"/> </menupopup> </button> note that when the menu is closed, the button doesn't indicate which view is selected.
Special per-platform menu considerations - Archive of obsolete content
menu_mac_hide_app selecting this item will hide the application.
... menu_mac_hide_others selecting this item will hide all other applications except this one.
... menu_mac_show_all selecting this item will show the windows for all applications.
color - Archive of obsolete content
ArchiveMozillaXULPropertycolor
« xul reference color type: color string the currently selected color.
... this is modified when the user selects a color.
... you can assign a string of the form #rrggbb to this property to change the selected color.
currentIndex - Archive of obsolete content
you cannot rely on this property to change or determine a tree selection, except for trees with seltype="single".
... (all trees have seltype="multiple" by default.) to reliably change or determine a selection, instead use the nsitreeselection interface methods available via tree.view.selection.
...<script language ="javascript"> function treerowclicked(){ var tree = document.getelementbyid("my-tree"); var selection = tree.view.selection; var celltext = tree.view.getcelltext(tree.currentindex, tree.columns.getcolumnat(0)); alert(celltext); } </script> <tree id="my-tree" seltype="single" onselect="treerowclicked()"> <treecols> <treecol label="title" flex="1"/><treecol label="url" flex="1"/> </treecols> <treechildren> <treeitem> <treerow> <treecell label="joe@somewhere.com"/> <treecell label="top secret plans"/> </treerow> </treeitem> <treeitem> <treerow> <treecell label="mel@whereever.com"/> <treecell label="let's do lunch"/> </treerow...
Template and Tree Listeners - Archive of obsolete content
var somelistener = { item: null, willrebuild : function(builder) { this.item = builder.getresourceatindex(builder.root.currentindex); }, didrebuild : function(builder) { if (this.item) { var idx = builder.getindexofresource(this.item) if (idx != -1) builder.root.view.selection.select(idx); } } }; tree.builder.addlistener(somelistener); this example is very simple and just saves and restores the selected index after a rebuild.
... since the content goes away during a rebuild, the selection is lost, so it is restored here during the didrebuild method.
...if you try an example using the code above, you will notice that the first tree will maintain the selection when the rebuild button is pressed, whereas in the second tree does not.
Adding Event Handlers to XBL-defined Elements - Archive of obsolete content
(see focus and selection) handling mouse events for mouse events, you can use the button attribute to have the handler only trap events that occur from a certain button.
...for simplicity, the entire text is cut and not just the selected text.
...if we were creating a real implementation of these clipboard keyboard shortcuts, we would probably use the real clipboard interface and handle the current selection as well.
Adding Style Sheets - Archive of obsolete content
you can use selectors to select the element that you wish to have styled.
... (the selector is the part before the curly brace in a style rule).
... the following list summarizes some of the selectors available: button matches all button tags.
Numeric Controls - Archive of obsolete content
scales a scale element may also be used to select from a range of values.
...the type attribute may be used to select the other two.
...this type has three fields for entering the year, month and date, as well as a dropdown button for displaying a popup calendar grid for selecting a day.
RDF Datasources - Archive of obsolete content
http://home.netscape.com/nc-rdf#page page name referrer http://home.netscape.com/nc-rdf#referrer referrer of the page url http://home.netscape.com/nc-rdf#url url of the page visit count http://home.netscape.com/nc-rdf#visitcount number of page visits a typical history list will display a tree with a selection of these fields.
... possible files roots nc:filesroot top level of the filesystem (usually the list of drives) a file url by using a file url for the ref attribute, you can select a specific directory to be returned.
...mals the zoo has" type="menu" datasources="animals.rdf" ref="http://www.some-fictitious-zoo.com/mammals"> <template> <rule animals:specimens="0"></rule> <rule> <menupopup> <menuitem uri="rdf:*" label="rdf:http://www.some-fictitious-zoo.com/rdf#name"/> </menupopup> </rule> </template> </button> </window> in this case only the mammals are desired, so we select the uri of the mammals list.
Stacks and Decks - Archive of obsolete content
the displayed page of the deck can be changed by setting an selectedindex attribute on the deck element.
... example 3 : source view <deck selectedindex="2"> <description value="this is the first page"/> <button label="this is the second page"/> <box> <description value="this is the third page"/> <button label="this is also the third page"/> </box> </deck> three pages exist here, the default being the third one.
... you can switch pages by using a script to modify the selectedindex attribute.
Tree View Details - Archive of obsolete content
first, the simple functions: { treebox: null, selection: null, get rowcount() { return this.visibledata.length; }, settree: function(treebox) { this.treebox = treebox; }, getcelltext: function(idx, column) { return this.visibledata[idx][0]; }, iscontainer: function(idx) { return this.visibledata[idx][1]; }, iscontaineropen: function(idx) { return this.visibledata[idx][2]; }, iscontainerempty: func...
...s> <treecol id="element" label="element" primary="true" flex="1"/> </treecols> <treechildren/> </tree> <script> <![cdata[ var treeview = { childdata : { solids: ["silver", "gold", "lead"], liquids: ["mercury"], gases: ["helium", "nitrogen"] }, visibledata : [ ["solids", true, false], ["liquids", true, false], ["gases", true, false] ], treebox: null, selection: null, get rowcount() { return this.visibledata.length; }, settree: function(treebox) { this.treebox = treebox; }, getcelltext: function(idx, column) { return this.visibledata[idx][0]; }, iscontainer: function(idx) { return this.visibledata[idx][1]; }, iscontaineropen: function(idx) { return this.visibledata[idx][2]; }, iscontainerempty: fun...
... (var i = 0; i < toinsert.length; i++) { this.visibledata.splice(idx + i + 1, 0, [toinsert[i], false]); } this.treebox.rowcountchanged(idx + 1, toinsert.length); } this.treebox.invalidaterow(idx); }, getimagesrc: function(idx, column) {}, getprogressmode : function(idx,column) {}, getcellvalue: function(idx, column) {}, cycleheader: function(col, elem) {}, selectionchanged: function() {}, cyclecell: function(idx, column) {}, performaction: function(action) {}, performactiononcell: function(action, index, column) {}, getrowproperties: function(idx, prop) {}, getcellproperties: function(idx, column, prop) {}, getcolumnproperties: function(column, element, prop) {}, }; function init() { document.getelementbyid("elementlist").view = treeview; }...
XUL Questions and Answers - Archive of obsolete content
possible values include: accept, cancel, help, open, save, find, clear, yes, no, apply, close, print, add, remove, refresh, go-forward, go-back, properties, select-font, select-color, network.
...an example of this is: var tree = document.getelementbyid('treeid'); selectedtreeitem = tree.view.getitematindex(tree.currentindex); selectedtreeitem.firstchild.setattribute('style', 'background: #ff0000'); what is an example of tab browser in xul?
...the best you can do is a cascading menu along the lines of the move/copy menus, but then of course you lose the ability to easily select from the list.
checkbox - Archive of obsolete content
the user can switch the state of the check box by selecting it with the mouse.
...for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider, nsidomxulcheckboxelement ...
command - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...this occurs when a user selects a menu item or presses a keyboard shortcut attached to the command.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related xul:list of commands ...
commandset - Archive of obsolete content
for example, since the cut command is only valid when something is selected, a command updater might be used when the select event occurs.
... select: occurs when the selected text changed.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
editor - Archive of obsolete content
you might also set the src attribute based on what the user selects from a file dialog.
...ument.getelementbyid("myeditor"); editor.contentdocument.designmode = 'on'; } </script> <editor id="myeditor" editortype="html" src="about:blank" flex="1" type="content-primary"/> once editable, the document can have special formatting and other html pieces added to it using the document.execcommand method: var editor = document.getelementbyid("myeditor"); // toggle bold for the current selection editor.contentdocument.execcommand("bold", false, null); see the midas overview for more command strings.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
scale - Archive of obsolete content
ArchiveMozillaXULscale
« xul reference home [ examples | attributes | properties | methods | related ] a scale (sometimes referred to as a "slider") allows the user to select a value from a range.
... a bar displayed either horizontally or vertically allows the user to select a value by dragging a thumb on the bar.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata decrease() return type: no return value decreases the value of the scale or number box by the increment.
<statusbarpanel> - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
... these classes should be used instead of changing the style of the element directly since they will fit more naturally with the user's selected theme.
Common Firefox theme issues and solutions - Archive of obsolete content
in order to work around this issue, you need to either rename any of the following files that are in your chrome://browser/skin/ folder and fix any references to those files, or copy them to the folder chrome://browser/skin/lion/: keyhole-circle.png toolbar.png toolbarbutton-dropmarker.png tabbrowser/alltabs-box-bkgnd-icon.png tabview/tabview.png places/toolbar.png linux linux select box fields are showing both drop arrow and spinner arrows on linux: the styling of drop down select box fields may show both a drop arrow and up/down spinner arrows.
... text only toolbar buttons not aligned properly when text only toolbar buttons are selected in customize toolbars, text labels in toolbar buttons may not align properly.
... ruleset ignored due to bad selector.
Create Your Own Firefox Background Theme - Archive of obsolete content
pick a category and tags — select a category and enter some tags that best describe your theme.
... select a license for your theme — decide on a copyright license for your work.
... select text and tab colors — you can choose the tab ("background") color and foreground text color that work best with your header image.
Using Firebug and jQuery (Screencast) - Archive of obsolete content
click the video link to begin (14:39 minutes long, 59mb): http://developer.mozilla.org/presentations/screencasts/jresig-digg-firebug-jquery.mp4 download: right-click this link and select save as...
... related links: firebug firefox extension jquery javascript library jquery selector documentation digg learning jquery: jquerify bookmarklet if you wish to use greasemonkey instead of a bookmarklet, then by all means, please do so.
... more tips: here are some more jquery selectors that you can use on a digg post: $("li.c-bury > div").remove(); - remove all buried comments, but none of the direct replies.
::-ms-value - Archive of obsolete content
the ::-ms-value css pseudo-element is a microsoft extension that applies rules to the value of a text or password <input> control or the content of a <select> control.
... allowable properties only the following css properties can be used in a rule with ::-ms-value in its selector.
...n-left margin-right margin-top -ms-background-position-x -ms-background-position-y -ms-high-contrast-adjust opacity outline-color outline-style outline-width padding-bottom padding-left padding-right padding-top transform transform-origin visibility width syntax ::-ms-value example input::-ms-value { color: lime; font-style: italic; } to disable the default styling: select::-ms-value { background-color: transparent; color: inherit; } specifications not part of any specification.
XForms Upload Element - Archive of obsolete content
introduction provides a means for the user to select a file (see the spec) from the file system.
... a filter can be specified to limit the types of files that the user can select from.
... representations the xforms upload element is represented by visually combining three widgets: a text field that shows the uri of the selected file, a button to open the file picker dialog which allows the user to select a file, and a button to clear the text field and the reference to the file from the bound node (xhtml only).
Audio for Web games - Game development
let's create our audio context: // for cross browser compatibility const audiocontext = window.audiocontext || window.webkitaudiocontext; const audioctx = new audiocontext(); now let's select all the <li> elements; later we can harness these elements to give us access to the track file path and each individual play button.
... const trackels = document.queryselectorall('li'); we want to make sure each file has loaded and been decoded into a buffer before we use it, so let's create an async function to allow us to do this: async function getfile(filepath) { const response = await fetch(filepath); const arraybuffer = await response.arraybuffer(); const audiobuffer = await audioctx.decodeaudiodata(arraybuffer); return audiobuffer; } we can then use the await operator when calling this function, which ensures that we can run subsequent code when it has finished executing.
...{ tracksource.start(); offset = audioctx.currenttime; } else { tracksource.start(0, audioctx.currenttime - offset); } return tracksource; } finally, let's loop over our <li> elements, grab the correct file for each one and then allow playback by hiding the "loading" text and displaying the play button: trackels.foreach((el, i) => { // get children const anchor = el.queryselector('a'); const loadtext = el.queryselector('p'); const playbutton = el.queryselector('button'); // load file loadfile(anchor.href).then((track) => { // set loading to false el.dataset.loading = 'false'; // hide loading text loadtext.style.display = 'none'; // show button playbutton.style.display = 'inline-block'; // allow play on click playbutton.addeve...
Test your skills: CSS and JavaScript accessibility - Learn web development
we'd like you to assume that the existing ruleset with the a selector is supplied by some cms, and that you can't change it — instead, you need to create new rules to make the links look and behave like links, and for the user to be able to tell where they are in the list.
...select new values for the color and font-size that fix the problem.
...explain what tools or methods you used to select the new values and test the code.
Practical positioning examples - Learn web development
first, add the following rule at the bottom of your css to remove the default padding-left and margin-top from the unordered list: .info-box ul { padding-left: 0; margin-top: 0; } note: we are using descendant selectors with .info-box at the start of the chain throughout this example — this is so that we can insert this feature into a page with other content already on it, without fear of interfering with the styles applied to other parts of the page.
...put the following block of code, exactly as written in between your opening and closing <script> tags (you'll find these below the html content): var tabs = document.queryselectorall('.info-box li a'); var panels = document.queryselectorall('.info-box article'); for(i = 0; i < tabs.length; i++) { var tab = tabs[i]; settabhandler(tab, i); } function settabhandler(tab, tabpos) { tab.onclick = function() { for(i = 0; i < tabs.length; i++) { tabs[i].classname = ''; } tab.classname = 'active'; for(i = 0; i < panels.length; i++) { panels[i...
... setting the checked state there is one final bit of css to add — put the following at the bottom of your css: input[type=checkbox]:checked + aside { right: 0px; } the selector is pretty complex here — we are selecting the <aside> element adjacent to the <input> element, but only when it is checked (note the use of the :checked pseudo-class to achieve this).
What is CSS? - Learn web development
for example "i want the main heading on my page to be shown as large red text." the following code shows a very simple css rule that would achieve the styling described above: h1 { color: red; font-size: 5em; } the rule opens with a selector .
... this selects the html element that we are going to style.
...each pair specifies a property of the element(s) we are selecting, then a value that we'd like to give the property.
The HTML5 input types - Learn web development
to actually display the current value, and update it as it changed, you must use javascript, but this is relatively easy to do: const price = document.queryselector('#price'); const output = document.queryselector('.price-output'); output.textcontent = price.value; price.addeventlistener('input', function() { output.textcontent = price.value; }); here we store references to the range input and the output in two variables.
...for good user experience, it is important to provide a calendar selection ui, enabling users to select dates without necessating context switching to a native calendar application or potentially entering them in differing formats that are hard to parse.
...here's a live example that falls back to <select> elements in non-supporting browsers: let's look at the different available types in brief.
How to structure a web form - Learn web development
for example, clicking on the "i like cherry" label text in the example below will toggle the selected state of the taste_cherry checkbox: <form> <p> <input type="checkbox" id="taste_1" name="taste_cherry" value="cherry"> <label for="taste_1">i like cherry</label> </p> <p> <input type="checkbox" id="taste_2" name="taste_banana" value="banana"> <label for="taste_2">i like banana</label> </p> </form> note: you can find this example in checkbox-label.html (see it live als...
...the first is a drop-down menu (<select>) for selecting credit card type.
... enter the following below the previous section: <section> <h2>payment information</h2> <p> <label for="card"> <span>card type:</span> </label> <select id="card" name="usercard"> <option value="visa">visa</option> <option value="mc">mastercard</option> <option value="amex">american express</option> </select> </p> <p> <label for="number"> <span>card number:</span> <strong><abbr title="required">*</abbr></strong> </label> <input type="tel" id="number" name="cardnumber"> </...
Introduction to web APIs - Learn web development
indow.audiocontext || window.webkitaudiocontext; const audioctx = new audiocontext(); next, we create constants that store references to our <audio>, <button>, and <input> elements, and use the audiocontext.createmediaelementsource() method to create a mediaelementaudiosourcenode representing the source of our audio — the <audio> element will be played from: const audioelement = document.queryselector('audio'); const playbtn = document.queryselector('button'); const volumeslider = document.queryselector('.volume'); const audiosource = audioctx.createmediaelementsource(audioelement); next up we include a couple of event handlers that serve to toggle between play and pause when the button is pressed and reset the display back to the beginning when the song has finished playing: // play/paus...
... the document object model (dom) api also has a simple entry point — its features tend to be found hanging off the document object, or an instance of an html element that you want to affect in some way, for example: const em = document.createelement('em'); // create a new em element const para = document.queryselector('p'); // reference an existing p element em.textcontent = 'hello there!'; // give em some text content para.appendchild(em); // embed em inside para the canvas api also relies on getting a context object to use to manipulate things, although in this case, it's a graphical context rather than an audio context.
... its context object is created by getting a reference to the <canvas> element you want to draw on, and then calling its htmlcanvaselement.getcontext() method: const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); anything that we want to do to the canvas is then achieved by calling properties and methods of the context object (which is an instance of canvasrenderingcontext2d), for example: ball.prototype.draw = function() { ctx.beginpath(); ctx.fillstyle = this.color; ctx.arc(this.x, this.y, this.size, 0, 2 * math.pi); ctx.fill(); }; note: you can see this code in action in our bouncing balls demo (see it running live also).
What went wrong? Troubleshooting JavaScript - Learn web development
the earliest instance you'll find in the javascript is on line 48: const loworhi = document.queryselector('loworhi'); at this point we are trying to make the variable contain a reference to an element in the document's html.
...line 48 is using a document.queryselector() method to get a reference to an element by selecting it with a css selector.
... looking further up our file, we can find the paragraph in question: <p class="loworhi"></p> so we need a class selector here, which begins with a dot (.), but the selector being passed into the queryselector() method in line 48 has no dot.
Getting started with Svelte - Learn web development
this works by adding a class to selected elements, which is based on a hash of the component styles.
... note: you can override this behavior and apply styles to a selector globally using the :global(...) modifier (see the svelte <style> docs for more information).
...you'll also be able to see all your saved repls by clicking on your github username profile and selecting your saved apps.
Introduction to automated testing - Learn web development
ager ui, or, on a command line, by navigating to the location you want and running the following command: mkdir node-test to make this directory an npm project, you just need to go inside your test directory and initialize it, with the following: cd node-test npm init this second command will ask you many questions to find out the information required to set up the project; you can just select the defaults for now.
... to start off with manual testing you need to select the "real time testing" tab from the left navigation menu.
... choose the browser/os combination you want to test by selecting the combination in the grid.
Strategies for carrying out testing - Learn web development
for example, you can find out what browsers and operating systems your users are using by selecting audience > technology > browser & os from the left hand menu.
... some larger companies have device labs that stock a very large selection of different devices, enabling developers to hunt down bugs on very specific browser/device combinations.
... select and activate the question mark button using the keyboard on your desktop computer a few times.
Introducing a complete toolchain - Learn web development
you can download the entire project as a zip file by selecting clone or download > download zip.
... run the following terminal command in the root of your project folder: npm install --save-dev eslint-plugin-react there’s a complete list of eslint rules that you can tweak and configure to your heart's content and many companies and teams have published their own eslint configurations, which can sometimes be useful either to get inspiration or to simply select one that you feel suits your own standards.
...css nesting allows us to nest css selectors and properties inside one another thus creating more specific selector scope.
Embedding API for Accessibility
setboolpref("browser.display.use_focus_colors", usefocuscolors); setcharpref("browser.display.focus_background_color", colorstring); setcharpref("browser.display.focus_text_color", colorstring); setcharpref("browser.display.focus_ring_width", numpixels); /* 0-4 */ moz 0.9.2 text selection appearance setcharpref("browser.selection.background_color", colorstring); setcharpref("browser.selection.foreground_color", colorstring); setcharpref("browser.selection.border", cssborderstylestring); /* is a selection border hard to implement?
... it's a w3c uaag requirement */ setboolpref("browser.selection.use_system_colors", usesystemcolors); no content waiting alerts setcharpref("alert.audio.mail_waiting", pathtosoundfile); setcharpref("alert.audio.background_image_waiting", pathtosoundfile); setcharpref("alert.audio.popup_waiting", pathtosoundfile); setcharpref("alert.audio.applet_waiting", pathtosoundfile); setcharpref("alert.audio.script_waiting", pathtosoundfile); setcharpref("alert.audio.redirect_waiting", pathtosoundfile); setcharpref("alert.audio.refresh_waiting", pathtosoundfile); ...
... accepting special content on an instance basis after being notified of special content, the user needs to be able to select specific unloaded content for loading.
Lightweight themes
pick a category and tags — select a category and enter some tags that best describe your theme.
... select a license for your theme — decide on a copyright license for your work.
... select text and tab colors — you can choose the tab ("background") color and foreground text color that work best with your header image.
mozbrowsercontextmenu
contextmenuitemselected an anonymous function that fires when a menu item is selected.
...this is passed to the contextmenuitemselected() function, to indicate which item has been selected.
... example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsercontextmenu", function(event) { console.log("asking for menu:" + json.stringify(event.details)); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozbrowserusernameandpasswordrequired ...
Interfacing with the Add-on Repository
this example will use the latter, in order to randomly select a recommended add-on and offer to install it.
... for example: searchsucceeded: function(addons, addoncount, totalresults) { var num = math.floor(math.random() * addoncount); this.shownotification("would you like to try the " + addons[num].name + " addon?", "install", addons[num].install); }, this routine randomly selects one of the returned add-ons, then calls the previously mentioned shownotification() routine, passing in as parameters a prompt including the name of the returned add-on, a label for the button to show in the notification ("install"), and the addoninstall object that can be used with the add-on manager api to install the add-on.
... installing the add-on the shownotification() routine displays a notification box offering to install the recommended add-on, if one was found, or reports an error if the search failed: shownotification: function(prompt, button, installobj) { this.install = installobj; var box = popupnotifications.show(gbrowser.selectedbrowser, "sample-popup", prompt, null, /* anchor id */ { label: button, accesskey: "i", callback: function() { if (popupnotifications.install) { popupnotifications.install.install(); } else { popupnotifications.remove(box); } } }, null /* secondary action */ ); } the code here starts by stash...
Application Translation with Mercurial
save this comparison as project so you can easily relaunch this comparision without selecting the directories again.
... now we copy the two missing lines from the english file and insert them in the localized file: <!-- localization note (privatebrowsingpage.howtostart4): please leave &newprivatewindow.label; intact in the translation --> <!entity privatebrowsingpage.howtostart4 "to start private browsing, you can also select &newprivatewindow.label; from the menu."> the first line is a comment providing information on the localization of the text in the following line.
... select the exported patch file with the file picker.
L10n testing with xcode
select the client project in the left pane and choose editor > import localizations from the toolbar and select your localized xliff file.
... in the edit scheme screen, select run from the left pane and then navigate to the options tab.
... select your language from the application language menu and click close.
Localizing with Mozilla Translator
you can save your work in progress and reopen it to continue working by selecting view fuzzy from the edit menu.
...files hanging directly from the platform neutral platform can't be part of a partial glossary (because they are not components), and platform neutral itself can't be selected either, since it is not a component, but a platform.
...to migrate the existing translation in the old product, you need to export partial glossaries from the old product, selecting the ''link'' origin (see the previous section) and importing them into the ''link'' target.
Mozilla Style System Documentation
for the css stylesheets, this process corresponds to css selector matching.
... the output of css selector matching as defined by the css specification is an ordered list of rules, where the order determines which declarations override other declarations.
...in mozilla, nscssdeclaration objects correspond to css declaration-blocks.) due to the high similarity of these lists between elements in the content tree, mozilla stores the output of the selector matching process in a lexicographic tree, the rule tree.
browser.download.lastDir.savePerSite
browser.download.lastdir.savepersite controls whether the directory preselected in the file picker for saving a file download is being remembered on a per-website (host) base.
... type:boolean default value:true exists by default: no application support:firefox 11.0 status: active; last updated 2012-02-15 introduction: pushed to nightly on 2011-12-11 bugs: bug 702748 values true (default) the last used directory for the website (host) serving the file for download will be preselected in the file picker.
... false the last used directory for any download (stored in browser.download.lastdir) will be the preselected directory in the file picker.
Patches and pushes
now that you've made your productization selections, you may be interested in learning the technical aspects behind productization by creating a productization patch.
...note that if your team selects a local version of an already default plugin (e.g., wikipedia), the xml filename should include the locale code (e.g., wikipedia-es).
... in the attachment details, select the ?
NSS 3.37 release notes
nss allows servers now to register alpn handling callbacks to select a protocol.
...this alternative implementation is selected at build time by defining the seed_only_dev_urandom symbol.
... (the classic implementation for rng seeding on the linux/unix platform, which may use additional sources for the default seeding, is still available and will be used if seed_only_dev_urandom is undefined.) with nss 3.37, this alternative implementation for linux/unix can be selected in "make" builds by defining the environment variable nss_seed_only_dev_urandom.
NSS Tools certutil
the certificate database tool will prompt you to select a particular usage for the certificate's key.
...the certificate database tool will prompt you to select the certificate constraint extension.
...the certificate database tool will prompt you to select the authority keyid extension.
Scripting Java
system.out.println(o.f(a[i])); } } when we compile and execute the program, it produces the output f(object) f(object) f(object) however, if we write a similar script var o = new packages.overload(); var a = [ 3, "hi", packages.overload ]; for (var i = 0; i != a.length; ++i) print(o.f(a[i])); and execute it, we get the output f(int) f(string) f(object) because rhino selects an overloaded method at runtime, it calls the more specific type that matches the argument.
... meanwhile java selects the overloaded method purely on the type of the argument at compile time.
... although this has the benefit of selecting a method that may be a better match for each call, it does have an impact on performance since more work is done at each call.
Hacking Tips
optionally, a condition on the ins->id() of the lir instruction can be added to select precisely the instruction you are looking for.
... using ionmonkey spew (js shell) ionmonkey spew is extremely verbose (not as much as the infer spew), but you can filter it to focus on the list of compiled scripts or channels, ionmonkey spew channels can be selected with the ionflags environment variable, and compilation spew can be filtered with ionfilter.
...it is a watchpoint on // the whole word, which will trigger whenever the word changes and the // selected bit is set after the change.
Places utilities for JavaScript
if set, the folder picker would be hidden unless ashowpicker is set to true, in which case the dialog only uses the folder identifier from the insertion point as the initially selected item in the folder picker.
...if set, the folder picker would be hidden unless ashowpicker is set to true, in which case the dialog only uses the folder identifier from the insertion point as the initially selected item in the folder picker.
...if set, the folder picker would be hidden unless ashowpicker is set to true, in which case the dialog only uses the folder identifier from the insertion point as the initially selected item in the folder picker.
Building the WebLock UI
grouping radio elements together creates the toggling ui by requiring that one or another of the elements be selected, but not both.
... the xul that defines the radiogroup in the web lock manager dialog is this: <radiogroup> <radio label="lock"/> <radio label="unlock" selected="true"/> </radiogroup> since the weblock component always starts up in the unlocked position, you can add the selected="true" attribute and value on the unlock radio button and reset it dynamically as the user takes action.
...when the user selects a different language pack, all of the english that's been externalized in these files is dynamically replaced with the new choice.
mozIStorageFunction
let stmt = dbconn.createstatement("select square(value) from some_table"); try { while (stmt.executestep()) { // handle the results } } finally { stmt.reset(); } in earlier versions of gecko, however, you'll need to actually create an object containing the onfunctioncall method.
...let stmt = dbconn.createstatement("select square(value) from some_table"); try { while (stmt.executestep()) { // handle the results } } finally { stmt.reset(); } c++ // first, create our class that will represent our function.
...nscomptr<mozistoragestatement> stmt; rv = dbconn->createstatement(ns_literal_cstring( "select square(value) from some_table"), getter_addrefs(stmt) ); ns_ensure_success(rv, rv); prbool hasmore; while (ns_succeeded(stmt->executestep(&hasmore)) && hasmore) { // handle the results } see also storage introduction and how-to article mozistorageconnection database connection to a specific file or in-memory data storage mozistoragestatement create and execute sql statements on a sqlit...
nsIAccessibleTableCell
1.0 66 introduced gecko 1.9.2 inherits from: nsisupports last changed in gecko 1.9.2 (firefox 3.6 / thunderbird 3.1 / fennec 1.0) method overview boolean isselected(); attributes attribute type description columnextent long return the number of columns occupied by this cell.
... methods isselected() boolean isselected(); parameters none.
... return value a boolean value indicating whether this cell is selected.
nsIMsgDBHdr
for instance, msghdrforcurrentmessage() will return the currently selected message's header.
...for the currently selected message, thunderbird provides a utility function: setmsghdrpropertyandreload(aproperty, avalue); which duplicates this functionality without requiring you to grab the current header.
...thunderbird provides a utility function which performs this for the currently selected message: markcurrentmessageasread().
nsIUpdate
toolkit/mozapps/update/nsiupdateservice.idlscriptable an interface that describes an object representing an available update to the current application - this update may have several available patches from which one must be selected to download and install, for example we might select a binary difference patch first and attempt to apply that, then if the application process fails fall back to downloading a complete file-replace patch.
... selectedpatch nsiupdatepatch the currently selected patch for this update.
... state astring the state of the selected patch: "downloading" the update is being downloaded.
XPCOM Interface Reference by grouping
drophandler nsidragservice nsidragsession html nsiaccessibilityservice nsiaccessiblecoordinatetype nsiaccessibledocument nsiaccessibleeditabletext nsiaccessibleevent nsiaccessiblehyperlink nsiaccessiblehypertext nsiaccessibleimage nsiaccessibleprovider nsiaccessibleretrieval nsiaccessiblerole nsiaccessiblescrolltype nsiaccessibleselectable nsiaccessiblestates nsiaccessibletable nsiaccessibletext nsiaccessibletreecache nsiaccessiblevalue nsiaccessnode nsisyncmessagesender script nsiscriptableunescapehtml nsiscriptableunicodeconverter nsiscripterror nsiscripterror2 stylesheet nsistylesheetservice url nsiuri nsiurl util nsidomserializer ...
...idomxpathresult xslt nsixsltexception nsixsltprocessor download nsidownload nsidownloadmanager nsidownloadprogresslistener element internal nsiworker nsiworkerglobalscope nsiworkermessageevent nsiworkermessageport nsiworkerscope tree nsitreeboxobject nsitreecolumn nsitreecolumns nsitreecontentview nsitreeselection nsitreeview xform nsixformsmodelelement nsixformsnsinstanceelement nsixformsnsmodelelement xmlhttprequest nsixmlhttprequesteventtarget favicon nsifavicondatacallback nsifaviconservice frame nsichromeframemessagemanager nsiframeloader nsiframeloaderowner nsiframemessagelistener nsiframemessagemanager interface ...
... dom nsiwebbrowser nsiwebbrowserpersist cache nsicache nsicachedeviceinfo nsicacheentrydescriptor nsicacheentryinfo nsicachelistener nsicachemetadatavisitor nsicacheservice nsicachesession nsicachevisitor nsicachingchannel nsiselectionimageservice chrome nsisearchengine nsisearchsubmission nsiwebbrowserchrome nsiwindowcreator nsiwindowmediator nsiwindowwatcher clipboard nsiclipboard nsiclipboardcommands nsiclipboarddragdrophooklist nsiclipboarddragdrophooks nsiclipboardhelper nsiclipboardown...
Performance
for example, explain select * from moz_history; the results are hard to understand, but you should be able to see whether it is using indices.
...for example sqlite> explain query plan select * from moz_historyvisit v join moz_history h on v.page_id = h.id where v.visit_date > 1000000000; 0|0|table moz_historyvisit as v with index moz_historyvisit_dateindex 1|1|table moz_history as h using primary key this tells us that it will first look up in moz_historyvisit using an index, and will then look up in moz_history using the primary key.
...sqlite> explain query plan select * from moz_historyvisit where session = 12; 0|0|table moz_historyvisit in this example, you can see that it is not using an index, so this query would be slow.
Troubleshooting XPCOM components registration
in dependency walker, open the options menu and select configure module search order....
...and select the directory firefox.exe (or equivalent) is in.
...open the profile menu and select start profiling....
Add to iPhoto
since a lot of this stuff is repetitive, we'll only look at selected parts of the code to get an idea how things work.
... = ctypes.open("/system/library/frameworks/corefoundation.framework/corefoundation"); // declaring all the apis goes here } shutting down core foundation while the core foundation system framework itself doesn't need to be shut down, we do need to close the library we opened using the js-ctypes api; that's where the shutdown() method comes in: shutdown: function() { this.lib.close(); } select api declarations let's take a look at a few of the key apis we declare for core foundation, to see how it's done.
... dest.createunique(dest.normal_file_type, 0600); var wbp = components.classes['@mozilla.org/embedding/browser/nswebbrowserpersist;1'] .createinstance(components.interfaces.nsiwebbrowserpersist); var ios = components.classes['@mozilla.org/network/io-service;1'] .getservice(components.interfaces.nsiioservice); var uri = ios.newuri(src, document.characterset, gbrowser.selectedbrowser.contentdocument.documenturiobject); wbp.persistflags &= ~components.interfaces.nsiwebbrowserpersist.persist_flags_no_conversion; // don't save gzipped wbp.saveuri(uri, null, null, null, null, dest); return dest.path; } this is pretty straightforward, typical mozilla code.
DOM Inspector internals - Firefox Developer Tools
one panel reacts to changes to the inspected document, and the other panel reacts to changes to the selection in the first panel.
...the preference menuitems in the view menu that affect only the dom nodes viewer ("blink selected element", et cetera) are added by that viewer's popup overlay (resources/content/viewers/dom/popupoverlay.xul).
... the same is true for the find menuitems and the "select element by click" menuitem in the edit menu, since no other viewers besides the dom nodes viewer support these features.
Browser Console - Firefox Developer Tools
opening the browser console you can open the browser console in one of two ways: from the menu: select "browser console" from the web developer submenu in the firefox menu (or tools menu if you display the menu bar or are on macos).
...this example here makes it so that when you mouse over the "clear" button it will clear the browser console: components.utils.import("resource://devtools/shared/loader.jsm"); var hudservice = devtools.require("devtools/client/webconsole/hudservice"); var hud = hudservice.getbrowserconsole(); var clearbtn = hud.chromewindow.document.queryselector('.webconsole-clear-console-button'); clearbtn.addeventlistener('mouseover', function() { hud.jsterm.clearoutput(true); }, false); bonus features available for add-on sdk add-ons, the console api is available automatically.
...try running this code in the browser console's command line (remember that to send multiple lines to the browser console, use shift+enter): var newtabbrowser = gbrowser.getbrowserfortab(gbrowser.selectedtab); newtabbrowser.addeventlistener("load", function() { newtabbrowser.contentdocument.body.innerhtml = "<h1>this page has been eaten</h1>"; }, true); newtabbrowser.contentdocument.location.href = "https://mozilla.org/"; it adds a listener to the currently selected tab's load event that will eat the new page, then loads a new page.
Browser Toolbox - Firefox Developer Tools
for example, here's what the frame selection popup lists when there are two browser windows open, one with one content tab, and one with two: debugging popups it's hard to debug popups, because the browser hides them as soon as you click outside them.
...click the toolbox menu and select disable popup auto-hide.
...you can use the inspector's node picker to select that panel, and examine and modify its content: you can use the same technique to debug popups created by add-ons.
Dominators view - Firefox Developer Tools
dominators ui to see the dominators view for a snapshot, select "dominators" in the "view" drop-down list.
...then take a snapshot, then select "call stack" in the "label by" drop-down.
... to see the retaining paths for a node, you have to select the node in the dominators tree panel: here, we've selected an object, and can see a single path back to a gc root.
Inspecting web sockets - Firefox Developer Tools
choose the reponse tab to inspect web socket frames sent and received through the selected connection.
... there are also predefined filters, available in the tool bar of the response pane, grouped into a selection list.
... expanding each message selecting a message in the list shows a preview of the data being sent in that message, at the bottom of the response pane.
Network Monitor - Firefox Developer Tools
select "network" from the web developer menu, (which is a submenu of the tools menu on os x and linux).
... click the wrench icon (), which is in the main toolbar or under the hamburger menu (), then select "network".
...once the tool is monitoring network requests, the display looks like this: when it is actively monitoring activity, the network monitor records network requests any time the toolbox is open, even if the network monitor itself is not selected.
Waterfall - Firefox Developer Tools
when a marker is selected you'll see more information about it in a sidebar on the right.
...th.sqrt(candidate); ++c) { if (candidate % c === 0) { // not prime isprime = false; break; } } if (isprime) { primes.push(candidate); } } console.timeend("calculating..."); return primes; } the waterfall's output will look something like this: the marker is labeled with the argument you passed to console.time(), and when you select the marker, you can see the program stack in the right-hand sidebar.
...r("click", handleclick, false); function handleclick() { console.time("timer"); runtimer(1000).then(timerfinished); } function timerfinished() { console.timeend("timer"); console.log("ready!"); } function runtimer(t) { return new promise(function(resolve) { settimeout(resolve, t); }); } the waterfall will display a marker for the period between time() and timeend(), and if you select it, you'll see the async stack in the sidebar: timestamp markers timestamps enable you to mark an instant in the recording.
Cookies - Firefox Developer Tools
when you select an origin inside the cookies storage type from the storage tree, all the cookies present for that origin will be listed in a table.
... delete <cookie name>.<domain> - deletes the selected cookie delete all from <domain> - deletes all cookies from the selected domain.
...for example, if you select "delete all from test8.example.com" only cookies from that domain will be deleted.
IndexedDB - Firefox Developer Tools
when you select an origin inside the indexed db storage type in the storage tree of the storage inspector, a table lists the details of all the databases present for that origin.
... when an indexeddb database is selected in the storage tree, details about all the object stores are listed in the table.
... when an object store is selected in the storage tree, all the items in that object store are listed in the table.
Rich output - Firefox Developer Tools
in particular, it: provides extra information for certain types enables detailed examination of the object's properties provides richer information for dom elements, and enables you to select them in the inspector type-specific rich output the web console provides rich output for many object types, including the following: object array date promise regexp window document element event examining object properties when an object is logged to the console it has a right-pointing triangle next to it, indicating that it can be expanded.
... export output to the clipboard once you have output in the console window, you can save it to the clipboard by right-clicking on the output and selecting export visible messages to clipboard: this will copy all of the output to the clipboard.
...table", datecreated: 1552404533790 } ​ length: 4 ​ <prototype>: array [] debugger eval code:1:9 undefined highlighting and inspecting dom nodes if you hover the mouse over any dom element in the console output, it's highlighted on the page: in the screenshot above you'll also see a blue "target" icon next to the node in the console output: click it to switch to the inspector with that node selected.
Split console - Firefox Developer Tools
while you're in another tool in the toolbox, just press esc or select the "show split console" command in the toolbar menu.
... you can close the split console by pressing esc again, or by selecting the "hide split console" menu command.
... as usual, $0 works as a shorthand for the element currently selected in the inspector: when you use the split console with the debugger, the console's scope is the currently executing stack frame.
Web Console remoting - Firefox Developer Tools
protocol packets look as follows: { "to": "root", "type": "listtabs" } { "from": "root", "consoleactor": "conn0.console9", "selected": 2, "tabs": [ { "actor": "conn0.tab2", "consoleactor": "conn0.console7", "title": "", "url": "https://tbpl.mozilla.org/?tree=fx-team" }, // ...
... javascript evaluation the evaluatejs request and response packets the web console client provides the evaluatejs(requestid, string, onresponse) method which sends the following packet: { "to": "conn0.console9", "type": "evaluatejs", "text": "document", "bindobjectactor": null, "frameactor": null, "url": null, "selectednodeactor": null, } the bindobjectactor property is an optional objectactor id that points to a debugger.object.
... the selectednodeactor property is an optional nodeactor id, which is used to indicate which node is currently selected in the inspector, if any.
Firefox Developer Tools
the core tools you can open the firefox developer tools from the menu by selecting tools > web developer > toggle tools or use the keyboard shortcut ctrl + shift + i or f12 on windows and linux, or cmd + opt + i on macos.
...click it to display a list of the iframes on the current page and select the one with which you want to work.
... eyedropper select a color from the page.
AudioContextOptions - Web APIs
constants standard values for latencyhint the latencyhint property can be number specifying a preferred maximum latency in seconds or a string from the audiocontextlatencycategory enumerated string, which selects a standard value for a given type of audio usage: value description "balanced" the user agent should balance audio output latency and power consumption when selecting a latency value.
...the user agent should select the lowest possible latency that doesn't cause glitches in the audio.
... "playback" the user agent should select a latency that will maximize playback time by minimizing power consumption at the expense of latency.
CSSStyleDeclaration.setProperty() - Web APIs
we then loop through the different rules contained inside the stylesheet, which are contained in the array found at stylesheet.cssrules; for each one, we check whether its cssstylerule.selectortext property is equal to the selector .box p, which indicates it is the one we want.
...height: 30px; line-height: 30px; } .box { display: flex; justify-content: center; align-items: center; height: calc(100% - 70px); } .box p { width: 50%; text-align: center; font-weight: bold; font-size: 40px; height: 150px; line-height: 150px; background: red; border: 5px solid purple; color: white; transition: all 1s; } javascript const borderbtn = document.queryselector('.border'); const bgcolorbtn = document.queryselector('.bgcolor'); const colorbtn = document.queryselector('.color'); const box = document.queryselector('.box'); function random(min,max) { const num = math.floor(math.random()*(max-min)) + min; return num; } function randomcolor() { return 'rgb(' + random(0,255) + ', ' + random(0,255) + ', ' + random(0,255) + ')'; } const stylesheet = ...
...document.stylesheets[1]; let boxpararule; for(let i = 0; i < stylesheet.cssrules.length; i++) { if(stylesheet.cssrules[i].selectortext === '.box p') { boxpararule = stylesheet.cssrules[i]; } } function setrandomborder() { const newborder = random(1, 50) + 'px solid ' + randomcolor(); boxpararule.style.setproperty('border', newborder); } function setrandombgcolor() { const newbgcolor = randomcolor(); boxpararule.style.setproperty('background-color', newbgcolor); } function setrandomcolor() { const newcolor = randomcolor(); boxpararule.style.setproperty('color', newcolor); } borderbtn.addeventlistener('click', setrandomborder); bgcolorbtn.addeventlistener('click', setrandombgcolor); colorbtn.addeventlistener('click', setrandomcolor); result specifications spe...
Basic animations - Web APIs
tible" content="ie=edge"> <title>nokia 1100:snake..member berries</title> </head> <body> <div class="keypress hide"> <div class="up" onclick="emit(38)">&#8593;</div> <div class="right" onclick="emit(39)">&#8594;</div> <div class="left" onclick="emit(37)">&#8592;</div> <div class="down" onclick="emit(40)">&#8595;</div> </div> <div class="banner" id="selector"> <div> time :<span id="time">0</span> </div> <div>lousygames ©</div> <div> score :<span id="score">0</span> </div> <div class="touch off" onclick="touch(this)">touch</div> </div> <canvas id="main"></canvas> </body> <style> body { margin: 0; overflow: hidden; background: #000 } ...
....banner { text-align: center; color: #fff; background: #3f51b5; line-height: 29px; position: fixed; left: 0; top: 0; right: 0; font-family: monospace; height: 30px; opacity: .4; display: flex; transition: .5s } .banner:hover { opacity: 1 } div#selector>div { flex-basis: 30% } @keyframes diss { from { opacity: 1 } to { opacity: 0 } } .keypress>div { border: dashed 3px #fff; height: 48%; width: 48%; display: flex; align-content: center; justify-content: center; align-self: center; align-items: center; font-size: -webk...
...it-xxx-large; font-weight: 900; color: #fff; transition: .5s; opacity: .1; border-radius: 7px } .keypress { position: fixed; width: 100vw; height: 100vh; top: 0; left: 0; display: flex; flex-wrap: wrap; justify-content: space-around; opacity: 1; user-select: none } .keypress>div:hover { opacity: 1 } .touch { background: #8bc34a } .off { background: #f44336 } .hide { opacity: 0 } </style> </html> javascript function tmz() { var e = new date(t), i = new date, n = math.abs(i.getminutes() - e.getminutes()), o = math.abs(i.getseconds() - e.getseconds()); ...
Constraint validation API - Web APIs
concepts and usage certain html form controls, such as <input>, <select> and <textarea>, can restrict the format of allowable values, using attributes like required and pattern to set basic constraints.
... extensions to other interfaces the constraint validation api extends the interfaces for the form-associated elements listed below with a number of new properties and methods (elements that can have a form attribute that indicates their form owner): htmlbuttonelement htmlfieldsetelement htmlinputelement htmlobjectelement htmloutputelement htmlselectelement htmltextareaelement properties validity a read-only property that returns a validitystate object, whose properties represent validation errors for the value of that element.
... if you wanted to instead display custom error messages, you could use javascript like the following: const nameinput = document.queryselector('input'); const form = document.queryselector('form'); nameinput.addeventlistener('input', () => { nameinput.setcustomvalidity(''); nameinput.checkvalidity(); }); nameinput.addeventlistener('invalid', () => { if(nameinput.value === '') { nameinput.setcustomvalidity('enter your username!'); } else { nameinput.setcustomvalidity('usernames can only contain upper and lowercase let...
Document: dragenter event - Web APIs
the dragenter event is fired when a dragged element or text selection enters a valid drop target.
... the target object is the immediate user selection (the element directly indicated by the user as the drop target), or the <body> element.
... bubbles yes cancelable yes default action reject immediate user selection as potential target element.
Document.getElementsByClassName() - Web APIs
ist of matching elements, *not* the element itself console.log(test); //htmlcollection[1] var testtarget = parentdom.getelementsbyclassname("test")[0]; // the first element, as we wanted console.log(testtarget); //<p class="test">hello world 2</p> </script> </body> </html> multiple classes example document.getelementsbyclassname works very similarly to document.queryselector and document.queryselectorall.
... only elements with all of the classnames specified are selected.
... html <span class="orange fruit">orange fruit</span> <span class="orange juice">orange juice</span> <span class="apple juice">apple juice</span> <span class="foo bar">something random</span> <textarea id="resultarea" style="width:98%;height:7em"></textarea> javascript // getelementsbyclassname only selects elements that have both given classes var allorangejuicebyclass = document.getelementsbyclassname('orange juice'); var result = "document.getelementsbyclassname('orange juice')"; for (var i=0, len=allorangejuicebyclass.length|0; i<len; i=i+1|0) { result += "\n " + allorangejuicebyclass[i].textcontent; } // queryselector only selects full complete matches var allorangejuicequery = document.queryselectorall('.orange.juice'); result += "\n\ndocument.queryselectorall('.orange.juice')"; ...
EcdsaParams - Web APIs
this should be one of the following: sha-256: selects the sha-256 algorithm.
... sha-384: selects the sha-384 algorithm.
... sha-512: selects the sha-512 algorithm.
Element: cut event - Web APIs
WebAPIElementcut event
bubbles yes cancelable yes interface clipboardevent event handler property oncut the event's default action is to copy the current selection (if any) to the system clipboard and remove it from the document.
...so an event handler which wants to emulate the default action for "cut" while modifying the clipboard must also manually remove the selection from the document.
... examples live example html <div class="source" contenteditable="true">try cutting text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const source = document.queryselector('div.source'); source.addeventlistener('cut', (event) => { const selection = document.getselection(); event.clipboarddata.setdata('text/plain', selection.tostring().touppercase()); selection.deletefromdocument(); event.preventdefault(); }); result specifications specification status clipboard api and events working draft ...
File.webkitRelativePath - Web APIs
the file.webkitrelativepath is a read-only property that contains a usvstring which specifies the file's path relative to the directory selected by the user in an <input> element with its webkitdirectory attribute set.
... syntax relativepath = file.webkitrelativepath value a usvstring containing the path of the file relative to the ancestor directory the user selected.
...when the change event occurs, a list of all files contained within the selected directory hierarchies is generated and displayed.
FileReader: abort event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onabort examples live example html <div class="example"> <div class="file-select"> <label for="avatar">choose a profile picture:</label> <input type="file" id="avatar" name="avatar" accept="image/png, image/jpeg"> </div> <img src="" class="preview" height="200" alt="image preview..."> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents"></textarea> </div> </div> css img.preview { margin: 1rem 0; } .event-log...
...-contents { width: 18rem; height: 5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.queryselector('input[type="file"]'); const preview = document.queryselector('img.preview'); const eventlog = document.queryselector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { ...
...eview.src = reader.result; } } function addlisteners(reader) { reader.addeventlistener('loadstart', handleevent); reader.addeventlistener('load', handleevent); reader.addeventlistener('loadend', handleevent); reader.addeventlistener('progress', handleevent); reader.addeventlistener('error', handleevent); reader.addeventlistener('abort', handleevent); } function handleselected(e) { eventlog.textcontent = ''; const selectedfile = fileinput.files[0]; if (selectedfile) { addlisteners(reader); reader.readasdataurl(selectedfile); } reader.abort(); } fileinput.addeventlistener('change', handleselected); result specifications specification status file api working draft ...
FileReader: load event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onload examples live example html <div class="example"> <div class="file-select"> <label for="avatar">choose a profile picture:</label> <input type="file" id="avatar" name="avatar" accept="image/png, image/jpeg"> </div> <img src="" class="preview" height="200" alt="image preview..."> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents"></textarea> </div> </div> css img.preview { margin: 1rem 0; } .event-log-contents { width: 18rem; height: 5rem; border...
...: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.queryselector('input[type="file"]'); const preview = document.queryselector('img.preview'); const eventlog = document.queryselector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } function add...
...listeners(reader) { reader.addeventlistener('loadstart', handleevent); reader.addeventlistener('load', handleevent); reader.addeventlistener('loadend', handleevent); reader.addeventlistener('progress', handleevent); reader.addeventlistener('error', handleevent); reader.addeventlistener('abort', handleevent); } function handleselected(e) { eventlog.textcontent = ''; const selectedfile = fileinput.files[0]; if (selectedfile) { addlisteners(reader); reader.readasdataurl(selectedfile); } } fileinput.addeventlistener('change', handleselected); result specifications specification status file api working draft ...
FileReader: loadend event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onloadend examples live example html <div class="example"> <div class="file-select"> <label for="avatar">choose a profile picture:</label> <input type="file" id="avatar" name="avatar" accept="image/png, image/jpeg"> </div> <img src="" class="preview" height="200" alt="image preview..."> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents"></textarea> </div> </div> css img.preview { margin: 1rem 0; } .event-log-contents { width: 18rem; hei...
...ght: 5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.queryselector('input[type="file"]'); const preview = document.queryselector('img.preview'); const eventlog = document.queryselector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; ...
... } } function addlisteners(reader) { reader.addeventlistener('loadstart', handleevent); reader.addeventlistener('load', handleevent); reader.addeventlistener('loadend', handleevent); reader.addeventlistener('progress', handleevent); reader.addeventlistener('error', handleevent); reader.addeventlistener('abort', handleevent); } function handleselected(e) { eventlog.textcontent = ''; const selectedfile = fileinput.files[0]; if (selectedfile) { addlisteners(reader); reader.readasdataurl(selectedfile); } } fileinput.addeventlistener('change', handleselected); result specifications specification status file api working draft ...
FileReader: loadstart event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onloadstart examples live example html <div class="example"> <div class="file-select"> <label for="avatar">choose a profile picture:</label> <input type="file" id="avatar" name="avatar" accept="image/png, image/jpeg"> </div> <img src="" class="preview" height="200" alt="image preview..."> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents"></textarea> </div> </div> css img.preview { margin: 1rem 0; } .event-log-contents { width: 18rem; height: 5rem; ...
... border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.queryselector('input[type="file"]'); const preview = document.queryselector('img.preview'); const eventlog = document.queryselector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } func...
...tion addlisteners(reader) { reader.addeventlistener('loadstart', handleevent); reader.addeventlistener('load', handleevent); reader.addeventlistener('loadend', handleevent); reader.addeventlistener('progress', handleevent); reader.addeventlistener('error', handleevent); reader.addeventlistener('abort', handleevent); } function handleselected(e) { eventlog.textcontent = ''; const selectedfile = fileinput.files[0]; if (selectedfile) { addlisteners(reader); reader.readasdataurl(selectedfile); } } fileinput.addeventlistener('change', handleselected); result specifications specification status file api working draft ...
FileReader: progress event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onprogress examples live example html <div class="example"> <div class="file-select"> <label for="avatar">choose a profile picture:</label> <input type="file" id="avatar" name="avatar" accept="image/png, image/jpeg"> </div> <img src="" class="preview" height="200" alt="image preview..."> <div class="event-log"> <label>event log:</label> <textarea readonly class="event-log-contents"></textarea> </div> </div> css img.preview { margin: 1rem 0; } .event-log-contents { width: 18rem; height: 5re...
...m; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "select log" "preview log"; } .file-select { grid-area: select; } .preview { grid-area: preview; } .event-log { grid-area: log; } .event-log>label { display: block; } .event-log-contents { resize: none; } js const fileinput = document.queryselector('input[type="file"]'); const preview = document.queryselector('img.preview'); const eventlog = document.queryselector('.event-log-contents'); const reader = new filereader(); function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}: ${event.loaded} bytes transferred\n`; if (event.type === "load") { preview.src = reader.result; } } f...
...unction addlisteners(reader) { reader.addeventlistener('loadstart', handleevent); reader.addeventlistener('load', handleevent); reader.addeventlistener('loadend', handleevent); reader.addeventlistener('progress', handleevent); reader.addeventlistener('error', handleevent); reader.addeventlistener('abort', handleevent); } function handleselected(e) { eventlog.textcontent = ''; const selectedfile = fileinput.files[0]; if (selectedfile) { addlisteners(reader); reader.readasdataurl(selectedfile); } } fileinput.addeventlistener('change', handleselected); result specifications specification status file api working draft ...
File and Directory Entries API - Web APIs
only for accessing files which are selected by the user in a file <input> element (see htmlinputelement as well) or when a file or directory is provided to the web site or app using drag and drop.
... the htmlinputelement.webkitentries property lets you access the filesystemfileentry objects for the currently selected files, but only if they are dragged-and-dropped onto the file chooser (bug 1326031).
... if htmlinputelement.webkitdirectory is true, the <input> element is instead a directory picker, and you get filesystemdirectoryentry objects for each selected directory.
Using FormData Objects - Web APIs
var formdata = new formdata(someformelement); for example: var formelement = document.queryselector("form"); var request = new xmlhttprequest(); request.open("post", "submitform.php"); request.send(new formdata(formelement)); you can also append additional data to the formdata object between retrieving it from a form and sending it, like this: var formelement = document.queryselector("form"); var formdata = new formdata(formelement); var request = new xmlhttprequest(); request.open("post",...
... <input type="text" name="filelabel" size="12" maxlength="32" /><br /> <label>file to stash:</label> <input type="file" name="file" required /> <input type="submit" value="stash the file!" /> </form> <div></div> then you can send it using code like the following: var form = document.forms.nameditem("fileinfo"); form.addeventlistener('submit', function(ev) { var ooutput = document.queryselector("div"), odata = new formdata(form); odata.append("customfield", "this is some extra data"); var oreq = new xmlhttprequest(); oreq.open("post", "stash.php", true); oreq.onload = function(oevent) { if (oreq.status == 200) { ooutput.innerhtml = "uploaded!"; } else { ooutput.innerhtml = "error " + oreq.status + " occurred when trying to upload your file.<br \/>";...
... typically this is used as shown in our simple formdata event demo — in the javascript we reference a form: const formelem = document.queryselector('form'); in our submit event handler we use preventdefault to stop the default form submission, then invoke a formdata constructor to trigger the formdata event: formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); when the formdata event fire...
HTMLElement: input event - Web APIs
the input event fires when the value of an <input>, <select>, or <textarea> element has been changed.
...this is unlike the change event, which only fires when the value is committed, such as by pressing the enter key, selecting a value from a list of options, and the like.
... html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('values'); input.addeventlistener('input', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status html living standardthe definition of 'input event' in that specification.
HTMLImageElement.sizes - Web APIs
this provides the ability to automatically select among different images—even images of different orientations or aspect ratios—as the document state changes to match different media conditions.
...the browser takes all of this information and selects an image and width that best meets the specified values.
... let image = document.queryselector("article img"); let break40 = document.getelementbyid("break40"); let break50 = document.getelementbyid("break50"); break40.addeventlistener("click", event => image.sizes = image.sizes.replace(/50em,/, "40em,")); break50.addeventlistener("click", event => image.sizes = image.sizes.replace(/40em,/, "50em,")); result this result may be viewed in its own window here.
HTMLImageElement.src - Web APIs
syntax htmlimageelement.src = newsource; let src = htmlimageelement.src; value when providing only a single image, rather than a set of images from which the browser selects the best match for the viewport size and display pixel density, the src attribute is a usvstring specifying the url of the desired image.
... html result specifying a fallback for viewport-based selection when using viewport-bases selection of an image from a srcset by also specifying the sizes property, the src property serves as the fallback to be used on browsers that don't support viewport-based selection.
... browsers that do support viewport-based selection will ignore src in this situation.
HTMLMediaElement - Web APIs
htmlmediaelement.controlslist read only returns a domtokenlist that helps the user agent select what controls to show on the media element whenever the user agent shows its own set of controls.
... htmlmediaelement.load() resets the media to the beginning and selects the best available source from the sources provided using the src attribute or the <source> element.
...this works similarly to load() except that instead of running the normal resource selection algorithm, the source is simply set to the other element's currentsrc.
ImageCapture.getPhotoSettings() - Web APIs
the user agent selects the closest width value to this setting if it only supports discrete heights.
...the user agent selects the closest width value to this setting if it only supports discrete widths.
... const input = document.queryselector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings...
ImageCapture.takePhoto() - Web APIs
the user agent selects the closest height value to this setting if it only supports discrete heights.
...the user agent selects the closest width value to this setting if it only supports discrete widths.
... var takephotobutton = document.queryselector('button#takephoto'); var canvas = document.queryselector('canvas'); takephotobutton.onclick = takephoto; function takephoto() { imagecapture.takephoto().then(function(blob) { console.log('took photo:', blob); img.classlist.remove('hidden'); img.src = url.createobjecturl(blob); }).catch(function(error) { console.log('takephoto() error: ', error); }); } specifications ...
ImageCapture - Web APIs
var imagecapture; function ongetusermediabuttonclick() { navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); }) .catch(error => console.log(error)); } function ongrabframebuttonclick() { imagecapture.grabframe() .then(imagebitmap => { const canvas = document.queryselector('#grabframecanvas'); drawcanvas(canvas, imagebitmap); }) .catch(error => console.l...
...og(error)); } function ontakephotobuttonclick() { imagecapture.takephoto() .then(blob => createimagebitmap(blob)) .then(imagebitmap => { const canvas = document.queryselector('#takephotocanvas'); drawcanvas(canvas, imagebitmap); }) .catch(error => console.log(error)); } /* utils */ function drawcanvas(canvas, img) { canvas.width = getcomputedstyle(canvas).width.split('px')[0]; canvas.height = getcomputedstyle(canvas).height.split('px')[0]; let ratio = math.min(canvas.width / img.width, canvas.height / img.height); let x = (canvas.width - img.width * ratio) / 2; let y = (canvas.height - img.height * ratio) / 2; canvas.getcontext('2d').clearrect(0, 0, canvas.width, canvas.height); canvas.getcontext('2d').drawimage(img, 0, 0, img.width, img.height, x, y, im...
...g.width * ratio, img.height * ratio); } document.queryselector('video').addeventlistener('play', function() { document.queryselector('#grabframebutton').disabled = false; document.queryselector('#takephotobutton').disabled = false; }); specifications specification status comment mediastream image capturethe definition of 'imagecapture' in that specification.
KeyboardEvent: code values - Web APIs
arch" 0xe066 "browserfavorites" "browserfavorites" 0xe067 "browserrefresh" "browserrefresh" 0xe068 "browserstop" "browserstop" 0xe069 "browserforward" "browserforward" 0xe06a "browserback" "browserback" 0xe06b "launchapp1" "" 0xe06c "launchmail" "" 0xe06d "launchmediaplayer" ("mediaselect" prior to firefox 49) "" 0xe06e ~ 0xe0f0 "unidentified" "" 0xe0f1 (hanja key with korean keyboard layout) "lang2" "" 0xe0f2 (han/yeong key with korean keyboard layout) "lang1" "" code values on mac on mac os x, it's hard to get scancode or something which can distinguish a physical key from a key event.
...ng1" "hangulmode" 0x0083 "lang2" "hanja" 0x0084 "intlyen" "intlyen" 0x0085 "osleft" "osleft" 0x0086 "osright" "osright" 0x0087 "contextmenu" "contextmenu" 0x0088 "browserstop" "cancel" 0x0089 "again" "" 0x008a "props" "" 0x008b "undo" "undo" 0x008c "select" "" 0x008d "copy" "copy" 0x008e "open" "" 0x008f "paste" "paste" 0x0090 "find" "" 0x0091 "cut" "cut" 0x0092 "help" "help" 0x0093 "unidentified" "" 0x0094 "launchapp2" "" 0x0095, 0x0096 "unidentified" "" 0x0097 "wakeup" "" 0x0098 "laun...
... 0x0078 "unidentified" 0x0079 "numpadcomma" 0x007a "lang1" 0x007b "lang2" 0x007c "intlyen" 0x007d "metaleft" 0x007e "metaright" 0x007f "contextmenu" 0x0080 "browserstop" 0x0081 "again" 0x0082 "props" 0x0083 "undo" 0x0084 "select" 0x0085 "copy" 0x0086 "open" 0x0087 "paste" 0x0088 "find" 0x0089 "cut" 0x008a "help" 0x008b ~ 0x008d "unidentified" 0x008e "sleep" 0x008f "wakeup" 0x0090 "launchapp1" 0x0091 ~ 0x009b "unidentified" 0x009c "browserfavorites" ...
MediaDevices.getDisplayMedia() - Web APIs
the mediadevices interface's getdisplaymedia() method prompts the user to select and grant permission to capture the contents of a display or portion thereof (such as a window) as a mediastream.
... return value a promise that resolves to a mediastream containing a video track whose contents come from a user-selected screen area, as well as an optional audio track.
... notreadableerror the user selected a screen, window, tab, or other source of screen data, but a hardware or operating system level error or lockout occurred, preventing the sharing of the selected source.
MediaTrackConstraints.logicalSurface - Web APIs
syntax var constraintsobject = { logicalsurface: constraint }; constraintsobject.logicalsurface = constraint; value a constrainboolean which is true if logical surfaces should be permitted among the selections available to the user.
... usage notes you can check the setting selected by the user agent after the display media has been created by getdisplaymedia() by calling getsettings() on the display media's video mediastreamtrack, then checking the value of the returned mediatracksettings object's logicalsurface object.
... for example, if your app needs to know if the selected display surface is a logical one: let islogicalsurface = displaystream.getvideotracks()[0].getsettings().logicalsurface; following this code, islogicalsurface is true if the display surface contained in the stream is a logical surface; that is, one which may not be entirely onscreen, or may even be entirely offscreen.
MediaTrackConstraints - Web APIs
displaysurface a constraindomstring which specifies the types of display surface that may be selected by the user.
... browser the stream contains the contents of a single browser tab selected by the user.
... window the stream contains a single window selected by the user for sharing.
MediaTrackSettings.displaySurface - Web APIs
the windows are aggragated into a single video track, with any empty space filled with a backdrop; that backdrop is selected by the user agent.
... browser the stream's video track presents the entire contents of a single browser tab which the user selected during the getdisplaymedia() call.
... window the stream's video track presents the contents of a single window selected by the user.
Using the Media Capabilities API - Web APIs
navigator.mediacapabilities.decodinginfo(videoconfiguration).then( console.log('it worked') ).catch(error => console.log('it failed: ' + error) ); media capabilities live example css li { margin : 1em; } html <form> <p>select your video configuration and find out if this browser supports the codec, and whether decoding will be smooth and power efficient:</p> <ul> <li> <label for="codec">select a codec</label> <select id="codec"> <option>video/webm; codecs=vp8</option> <option>video/webm; codecs=vp9</option> <option>video/mp4; codecs=avc1</option> <option>video/mp4; codecs=avc1.42003...
...4</option> <option>video/ogg; codecs=theora</option> <option>invalid</option> </select> </li> <li> <label for="size">select a size</label> <select id="size"> <option>7680x4320</option> <option>3840x2160</option> <option>2560x1440</option> <option>1920x1080</option> <option>1280x720</option> <option selected>800x600</option> <option>640x480</option> <option>320x240</option> <option value=" x ">none</option> </select> </li> <li> <label for="framerate">select a framerate</label> <select id="framerate"> <option>60</option> <option>50</option> <option>30</option> <option>24</option> <option selected>15</option> </select> </li> <li> <label for="bitrate">select a...
... bitrate</label> <select id="bitrate"> <option>4000</option> <option>2500</option> <option>800</option> </select> </li> </ul> <p><input type="button" value="test this video configuration" id="tryit"></p> </form> <ul id="results"></ul> javascript let mc = { videoconfiguration : new object(), tryit: function () { mc.createconfiguration(); mc.testit(); }, createconfiguration: function () { var size = document.getelementbyid('size').value.split('x'); mc.videoconfiguration = { type: 'file', video: { contenttype: document.getelementbyid('codec').value, width: size[0], height: size[1], bitrate: document.getelementbyid('bitrate').value, framerate: document.getelementbyid('framerate').value, ...
PaymentMethodChangeEvent.methodName - Web APIs
the read-only methodname property of the paymentmethodchangeevent interface is a string which uniquely identifies the payment handler currently selected by the user.
... syntax var methodname = paymentmethodchangeevent.methodname; value a domstring which uniquely identifies the currently-selected payment handler.
... example this example uses the paymentmethodchange event to watch for changes to the payment method selected for apple pay, in order to compute a discount if the user chooses to use a visa card as their payment method.
PaymentRequest.PaymentRequest() - Web APIs
for example, the basic card payment method is selected by specifying the string basic-card here.
...if you set this type to true, you should select an appropriate shippingtype.
... 'diners', 'discover', 'mir', 'unionpay'] } }]; var details = { total: {label: 'donation', amount: {currency: 'usd', value: '65.00'}}, displayitems: [ { label: 'original donation amount', amount: {currency: 'usd', value: '65.00'} } ], shippingoptions: [ { id: 'standard', label: 'standard shipping', amount: {currency: 'usd', value: '0.00'}, selected: true } ] }; var options = {requestshipping: true}; try { var request = new paymentrequest(supportedinstruments, details, options); // add event listeners here.
PaymentRequest: shippingoptionchange event - Web APIs
the string identifying the currently-selected shipping option can be found in the shippingoption property.
...the code recalculates the total charge for the payment based on the selected shipping option.
... paymentrequest.addeventlistener("shippingoptionchange", event => { const value = calculatenewtotal(paymentrequest.shippingoption); const total = { currency: "eur", label: "total due", value, }; event.updatewith({ total }); }, false); after caling a custom function, calculatenewtotal(), to compute the updated total based on the newly-selected shipping option as specified by the shippingoption.
PaymentResponse.shippingOption - Web APIs
the shippingoption read-only property of the paymentrequest interface returns the id attribute of the shipping option selected by the user.
...}).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingoption, resolve, reject) { var selectedshippingoption; var othershippingoption; if (shippingoption === 'standard') { selectedshippingoption = details.shippingoptions[0]; othershippingoption = details.shippingoptions[1]; details.total.amount.value = '55.00'; } else if (shippingoption === 'express') { selectedshippingoption = details.shippingoptions[1]; othershippingoption = details.shippingoptions[0]; det...
...ails.total.amount.value = '67.00'; } else { reject('unknown shipping option \'' + shippingoption + '\''); return; } selectedshippingoption.selected = true; othershippingoption.selected = false; details.displayitems.splice(2, 1, selectedshippingoption); resolve(details); } specifications specification status comment payment request api candidate recommendation initial definition.
PaymentResponse - Web APIs
the paymentresponse interface of the payment request api is returned after a user selects a payment method and approves a payment request.
... paymentresponse.methodname read only secure context returns the payment method identifier for the payment method that the user selected, for example, visa, mastercard, paypal, etc..
... paymentresponse.shippingoption read only secure context returns the id attribute of the shipping option selected by the user.
Using the Permissions API - Web APIs
see the following code in our demo: var revokebtn = document.queryselector('.revoke'); ...
...select always ask.
...in the resulting dialog, find the location section and select ask when a site tries to...
RTCIceCandidatePair - Web APIs
it is used as the return value from rtcicetransport.getselectedcandidatepair() to identify the currently-selected candidate pair identified by the ice agent.
... example in this example, an event handler for selectedcandidatepairchange is set up to update an on-screen display showing the protocol used by the currently selected candidate pair.
... var icetransport = pc.getsenders()[0].transport.icetransport; var localproto = document.getelementbyid("local-protocol"); var remoteproto = document.getelementbyid("remote-protocol"); icetransport.onselectedcandidatepairchange = function(event) { var pair = icetransport.getselectedcandidatepair(); localprotocol.innertext = pair.local.protocol.touppercase(); remoteprotocol.innertext = pair.remote.protocol.touppercase(); } specifications specification status comment webrtc 1.0: real-time communication between browsersthe definition of 'rtcicecandidatepair' in that specification.
RTCIceTransport.state - Web APIs
"connected" a viable candidate pair has been found and selected, and the rtcicetransport has connected the two peers together using that pair.
... the transport may revert from the "connected" state to the "checking" state if either peer decides to cancel consent to use the selected candidate pair, and may revert to "disconnected" if there are no candidates left to check but one or both clients are still gathering candidates.
...in addition, all candidate pairs have been considered and a pair has been selected for use.
RTCIceTransportState - Web APIs
"connected" a viable candidate pair has been found and selected, and the rtcicetransport has connected the two peers together using that pair.
... the transport may revert from the "connected" state to the "checking" state if either peer decides to cancel consent to use the selected candidate pair, and may revert to "disconnected" if there are no candidates left to check but one or both clients are still gathering candidates.
...in addition, all candidate pairs have been considered and a pair has been selected for use.
Range.commonAncestorContainer - Web APIs
since a range need not be continuous, and may also partially select nodes, this is a convenient way to find a node which encloses a range.
...the listener gets the common ancestors of each piece of selected text, and triggers an animation to highlight them.
... .highlight { animation: highlight linear 1s; } @keyframes highlight { from { outline: 1px solid #f00f; } to { outline: 1px solid #f000; } } body { padding: 1px; } javascript document.addeventlistener('pointerup', e => { const selection = window.getselection(); if (selection.type === 'range') { for (let i = 0; i < selection.rangecount; i++) { const range = selection.getrangeat(i); playanimation(range.commonancestorcontainer); } } }); function playanimation(el) { if (el.nodetype === node.text_node) { el = el.parentnode; } el.classlist.remove('highlight'); settimeout(() => { el.classli...
Range.compareNode() - Web APIs
WebAPIRangecompareNode
the node is completely selected by the range.
... the following function can be used as replacement: function rangecomparenode(range, node) { var noderange = node.ownerdocument.createrange(); try { noderange.selectnode(node); } catch (e) { noderange.selectnodecontents(node); } var nodeisbefore = range.compareboundarypoints(range.start_to_start, noderange) == 1; var nodeisafter = range.compareboundarypoints(range.end_to_end, noderange) == -1; if (nodeisbefore && !nodeisafter) return 0; if (!nodeisbefore && nodeisafter) return 1; if (nodeisbefore && nodeisafter) return 2; r...
... example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); returnvalue = range.comparenode(document.getelementsbytagname("p").item(0)); notes this method is obsolete; you should use the w3c dom range.compareboundarypoints() method.
Range - Web APIs
WebAPIRange
range objects can also be retrieved by using the getrangeat() method of the selection object or the caretrangefrompoint() method of the document object.
... range.selectnode() sets the range to contain the node and its contents.
... range.selectnodecontents() sets the range to contain the contents of a node.
Screen Capture API - Web APIs
the screen capture api introduces additions to the existing media capture and streams api to let the user select a screen or portion of a screen (such as a window) to capture as a media stream.
...its sole method is mediadevices.getdisplaymedia(), whose job is to ask the user to select a screen or portion of a screen to capture in the form of a mediastream.
...similar to getusermedia(), this method creates a promise that resolves with a mediastream containing the display area selected by the user, in a format that matches the specified options.
SpeechSynthesisUtterance - Web APIs
after defining some necessary variables, we retrieve a list of the voices available using speechsynthesis.getvoices() and populate a select menu with them so the user can choose what voice they want.
... inside the inputform.onsubmit handler, we stop the form submitting with preventdefault(), use the constructor to create a new utterance instance containing the text from the text <input>, set the utterance's voice to the voice selected in the <select> element, and start the utterance speaking via the speechsynthesis.speak() method.
... var synth = window.speechsynthesis; var voices = synth.getvoices(); var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); for(var i = 0; i < voices.length; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; option.value = i; voiceselect.appendchild(option); } inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); utterthis.voice = voices[voiceselect.value]; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesisutterance' in that specific...
SubtleCrypto.deriveBits() - Web APIs
async function derivesharedsecret(privatekey, publickey) { const sharedsecret = await window.crypto.subtle.derivebits( { name: "ecdh", namedcurve: "p-384", public: publickey }, privatekey, 128 ); const buffer = new uint8array(sharedsecret, 0, 5); const sharedsecretvalue = document.queryselector(".ecdh .derived-bits-value"); sharedsecretvalue.classlist.add("fade-in"); sharedsecretvalue.addeventlistener("animationend", () => { sharedsecretvalue.classlist.remove("fade-in"); }); sharedsecretvalue.textcontent = `${buffer}...[${sharedsecret.bytelength} bytes total]`; } // generate 2 ecdh key pairs: one for alice and one for bob // in more normal usage, they would generate their...
...ame: "ecdh", namedcurve: "p-384" }, false, ["derivebits"] ); const generatebobskeypair = window.crypto.subtle.generatekey( { name: "ecdh", namedcurve: "p-384" }, false, ["derivebits"] ); promise.all([generatealiceskeypair, generatebobskeypair]).then(values => { const aliceskeypair = values[0]; const bobskeypair = values[1]; const derivebitsbutton = document.queryselector(".ecdh .derive-bits-button"); derivebitsbutton.addeventlistener("click", () => { // alice then generates a secret using her private key and bob's public key.
...{ const keymaterial = await getkeymaterial(); salt = window.crypto.getrandomvalues(new uint8array(16)); const derivedbits = await window.crypto.subtle.derivebits( { "name": "pbkdf2", salt: salt, "iterations": 100000, "hash": "sha-256" }, keymaterial, 256 ); const buffer = new uint8array(derivedbits, 0, 5); const derivedbitsvalue = document.queryselector(".pbkdf2 .derived-bits-value"); derivedbitsvalue.classlist.add("fade-in"); derivedbitsvalue.addeventlistener("animationend", () => { derivedbitsvalue.classlist.remove("fade-in"); }); derivedbitsvalue.textcontent = `${buffer}...[${derivedbits.bytelength} bytes total]`; } const derivebitsbutton = document.queryselector(".pbkdf2 .derive-bits-button"); derivebitsbutton.addeventlistener...
USBDevice.configuration - Web APIs
the configuration read only property of the usbdevice interface returns a usbconfiguration object for the currently selected interface for a paired usb device.
... example the following example uses this property to test for the existence of a usbconfiguration property to select a configuration before claiming an interface.
... async function connectdevice(usbdevice) { await usbdevice.open(); if (usbdevice.configuration === null) await usbdevice.selectconfiguration(1); await usbdevice.claiminterface(0); } specifications specification status comment webusbthe definition of 'configuration' in that specification.
USBDevice - Web APIs
WebAPIUSBDevice
properties usbdevice.configuration read only a usbconfiguration object for the currently selected interface for a paired usb device.
... usbdevice.selectalternateinterface() returns a promise that resolves when the specified alternative endpoint is selected.
... usbdevice.selectconfiguration() returns a promise that resolves when the specified configuration is selected.
VideoTrackList: change event - Web APIs
the change event is fired when a video track is made active or inactive, for example by changing the track's selected property.
... bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.videotracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); // changing the value of `selected` will trigger the `change` event const toggletrackbutton = document.queryselector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.videotracks[0]; track.selected = !track.selected; }); using the onchange event handler property: const videoelement = document.queryselector('video'); videoelement.videotracks.onchange = (event) => { console.log(`'${event.type}' event fired`)...
...; }; // changing the value of `selected` will trigger the `change` event const toggletrackbutton = document.queryselector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.videotracks[0]; track.selected = !track.selected; }); specifications specification status html living standardthe definition of 'change' in that specification.
VideoTrackList - Web APIs
selectedindex read only the index of the currently selected track, if any, or −1 otherwise.
... onchange an event handler to be called when the change event occurs — that is, when the value of the selected property for a track has changed, due to the track being made active or inactive.
... var videotracks = document.queryselector("video").videotracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
Hello GLSL - Web APIs
="x-shader/x-fragment" id="fragment-shader"> #version 100 void main() { gl_fragcolor = vec4(0.18, 0.54, 0.34, 1.0); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.queryselector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.queryselector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.queryselector("p").innerhtml = "shader program did not link successfully.
... var buffer; function initializeattributes() { gl.enablevertexattribarray(0); buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.vertexattribpointer(0, 1, gl.float, false, 0, 0); } function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.
Scissor animation - Web APIs
position = [0, gl.drawingbufferheight]; var button = document.queryselector("button"); var timer; function startanimation(evt) { button.removeeventlistener(evt.type, startanimation, false); button.addeventlistener("click", stopanimation, false); document.queryselector("strong").innerhtml = "stop"; timer = setinterval(drawanimation, 17); drawanimation(); } function stopanimation(evt) { button.removeeventlistener(evt.type, stopanimation, f...
...alse); button.addeventlistener("click", startanimation, false); document.queryselector("strong").innerhtml = "start"; clearinterval(timer); } stopanimation({type: "click"}); } // variables to hold the size and velocity of the square.
...m()*(gl.drawingbufferwidth - size[0]), gl.drawingbufferheight ]; // random velocity between 1.0 and 7.0 velocity = 1.0 + 6.0*math.random(); color = getrandomcolor(); gl.clearcolor(color[0], color[1], color[2], 1.0); } } function getrandomcolor() { return [math.random(), math.random(), math.random()]; } function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.
Textures from code - Web APIs
istancesqrd = distance * distance; gl_fragcolor = vec4( 0.2/distancesqrd, 0.1/distancesqrd, 0.0, 1.0 ); } </script> ;(function(){ "use strict" window.addeventlistener("load", setupwebgl, false); var gl, program; function setupwebgl (evt) { window.removeeventlistener(evt.type, setupwebgl, false); if (!(gl = getrenderingcontext())) return; var source = document.queryselector("#vertex-shader").innerhtml; var vertexshader = gl.createshader(gl.vertex_shader); gl.shadersource(vertexshader,source); gl.compileshader(vertexshader); source = document.queryselector("#fragment-shader").innerhtml var fragmentshader = gl.createshader(gl.fragment_shader); gl.shadersource(fragmentshader,source); gl.compileshader(fragmentshader); program = gl.createprogram(); gl...
...hshader(program, vertexshader); gl.attachshader(program, fragmentshader); gl.linkprogram(program); gl.detachshader(program, vertexshader); gl.detachshader(program, fragmentshader); gl.deleteshader(vertexshader); gl.deleteshader(fragmentshader); if (!gl.getprogramparameter(program, gl.link_status)) { var linkerrlog = gl.getprograminfolog(program); cleanup(); document.queryselector("p").innerhtml = "shader program did not link successfully.
... buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, new float32array([0.0, 0.0]), gl.static_draw); gl.vertexattribpointer(0, 2, gl.float, false, 0, 0); } function cleanup() { gl.useprogram(null); if (buffer) gl.deletebuffer(buffer); if (program) gl.deleteprogram(program); } function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.
Starting up and shutting down a WebXR session - Web APIs
if you use xr input controllers, watch the inputsourceschange event to detect the addition or removal of xr input controllers, and the various select and squeeze action events.
... in basic form, code to do this final setup might look something like this: async function runsession(session) { let worlddata; session.addeventlistener("end", onsessionend); let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); // set up webgl data and such worlddata = loadglprograms(session, "worlddata.xml"); if (!worlddata) { return null; } // finish configuring webgl worlddata.session.updaterenderstate({ baselayer: new xrwebgllayer(worlddata.session, gl) }); // start rendering the scene referencespace = await world...
... to understand how to select the right reference space for your needs, see selecting the reference space type in geometry and reference spaces in webxr.
WindowOrWorkerGlobalScope.setInterval() - Web APIs
color() { clearinterval(nintervid); } </script> </head> <body onload="changecolor();"> <div id="my_box"> <p>hello world</p> </div> <button onclick="stoptextcolor();">stop</button> </body> </html> example 3: typewriter simulation the following example simulates typewriter by first clearing and then slowly typing content into the nodelist that matches a specified group of selectors.
... <!doctype html> <html> <head> <meta charset="utf-8" /> <title>javascript typewriter - mdn example</title> <script> function typewriter (sselector, nrate) { function clean () { clearinterval(nintervid); btyping = false; bstart = true; ocurrent = null; asheets.length = nidx = 0; } function scroll (osheet, npos, beraseandstop) { if (!osheet.hasownproperty('parts') || amap.length < npos) { return true; } var orel, bexit = false; if (amap.length === npos) { amap.push(0); } while (amap[npos] < osheet.parts.length) { orel = osheet.parts[amap[npos]]; scroll(orel, npos + 1, beraseandstop) ?
....parts.length; nchild++) { onode.removechild(this.parts[nchild]); this.parts[nchild] = new sheet(this.parts[nchild]); } } var nintervid, ocurrent = null, btyping = false, bstart = true, nidx = 0, spart = "", asheets = [], amap = []; this.rate = nrate || 100; this.play = function () { if (btyping) { return; } if (bstart) { var aitems = document.queryselectorall(sselector); if (aitems.length === 0) { return; } for (var nitem = 0; nitem < aitems.length; nitem++) { asheets.push(new sheet(aitems[nitem])); /* uncomment the following line if you have previously hidden your elements via css: */ // aitems[nitem].style.visibility = "visible"; } bstart = false; } nintervid = setinterval(typewrite, th...
XRInputSource - Web APIs
when a primary action begins, a selectstart event is sent to the xrsession.
... when the action has completed (such as when the user releases the button), a select event is sent.
... finally, once that is done—or if the user aborts the action—a selectend event is sent to the session object.
XRInputSourceEvent.frame - Web APIs
examples this code shows a handler for the selectstart event which gets the target ray's pose from the frame, mapping the pose representing the ray (event.inputsource.targetrayspace) to the overall reference space myrefspace.
... then, if the result isn't null, the target ray pose's transform is passed into a function called mycheckandhandlehit() to see if the ray was pointing at anything when the select was triggered.
... xrsession.onselectstart = event => { let targetraypose = event.frame.getpose(event.inputsource.targetrayspace, myrefspace); if (targetraypose) { checkandhandlehit(targetraypose.transform); } }; specifications specification status comment webxr device apithe definition of 'xrinputsourceevent.frame' in that specification.
ARIA: table role - Accessibility
the cells are not focusable or selectable, though widgets within individual cells of the table can be interactive.
... if a table maintains a selection state, has two-dimensional navigation, or allows the user to rearrange cell order use grid or treegrid instead.
...if the interaction provides for the selection state of individual cells, if left to right and top to bottom navigation is provided, or if the user interface allows the rearranging of cell order or otherwise changing individual cell order such as through drag and drop, use grid or treegrid instead.
HTML To MSAA - Accessibility
map html element role name value states relations actions events notes a role_system_ link n/a value of @href attribute state_system_ selectable if @name attribute is presented state_system_ linked if @href attribute is presented or click event listener is registered state_system_ traversed if link is traversed n/a "jump" if @href is valid n/a br role_system_ whitespace '\n' (new line char) state_system_ readonly n/a n/a n/a button role_system_ pushbutton from child nodes n/a state_system_ focusable state_system_ default...
...f intermediate property of dom element returns true state_system_ checked if checked property of dom element returns true n/a "check"/"uncheck"/"cycle" depending on state event_object_ statechange when state is changed input type="radio" role_system_ radiobutton n/a n/a state_system_ marqueed used as state checkable state_system_ checked if checked property of dom element returns true n/a "select" event_object_ statechange when state is changed label role_system_ statictext from child nodes n/a n/a n/a n/a n/a legend role_system_ statictext n/a n/a n/a label_for (0x1002), points to caption element n/a n/a li and others role_system_ listitem n/a n/a state_system_ readonly n/a n/a n/a contains child accessible for list bullet ol, ul and others role_system_ list n/a n/a state_s...
...ystem_ readonly n/a n/a n/a optgroup bstr role n/a n/a n/a n/a n/a n/a option role_system_ listitem from @label attribute, from child text nodes n/a state_system_ selected if option is selected n/a "select" event_object_ selectionwithin event_object_ selectionadd if selected event_object_ selectionremove if unselected select @size > 1 role_system_ list n/a n/a state_system_ multiselectable if multiselectable n/a n/a n/a select @size = 1 role_system_ combobox n/a name of focused option state_system_ expanded if combobox open state_system_ collapsed if combobox is collapsed state_system_ haspopup state_system_ focusable n/a "open"/"close" depending on state event_object_ valuechange when selected option is changed table role_system_ table from @summary attribute n/a des...
Keyboard-navigable JavaScript widgets - Accessibility
non-native controls native html elements that are interactive, like <a>, <input> and <select>, are already accessible by keyboards, so to use one of them is the fastest path to make components work with keyboards.
...there are two techniques for accomplishing this: roving tabindex: programmatically moving focus aria-activedescendant: managing a 'virtual' focus technique 1: roving tabindex setting the tabindex of the focused element to "0" ensures that if the user tabs away from the widget and then returns, the selected item within the group retains focus.
... note that updating the tabindex to "0" requires also updating the previously selected item to tabindex="-1".
Text labels and names - Accessibility
select an area for more information on that area." /> <map id="map1" name="map1"> <area shape="rect" coords="0,0,30,30" href="reference.html" alt="reference" /> <area shape="rect" coords="34,34,100,100" href="media.html" alt="audio visual lab" /> </map> see the <area> element reference page for a live interactive example.
...this applies to all types of <input> items, as well as <button>, <output>, <select>, <textarea>, <progress> and <meter> elements, as well as any element with the switch aria role.
... <label for="dino-select">choose a dinosaur:</label> <select id="dino-select"> <optgroup label="theropods"> <option>tyrannosaurus</option> <option>velociraptor</option> <option>deinonychus</option> </optgroup> <optgroup label="sauropods"> <option>diplodocus</option> <option>saltasaurus</option> <option>apatosaurus</option> </optgroup> </select> toolbars mus...
:-moz-locale-dir(ltr) - CSS: Cascading Style Sheets
note: this selector is mainly used by extensions and themes to adapt the user interface based on the user's locale.
... this selector does not work properly from html; it always matches, regardless of whether the ui locale is left-to-right or right-to-left.
... syntax :-moz-locale-dir(ltr) examples this example doesn't work if you're not using firefox, and may not work even in firefox due to an issue with the selector not working propertly with html content.
:-moz-locale-dir(rtl) - CSS: Cascading Style Sheets
note: this selector is mainly used by extensions and themes to adapt the user interface based on the user's locale.
... this selector does not work properly from html; it never matches, no matter whether the ui locale is left-to-right or right-to-left.
... syntax :-moz-locale-dir(rtl) examples this example will not work if you're not using firefox, and might not work properly even in firefox due to an issue with using this selector in html.
::after (:after) - CSS: Cascading Style Sheets
WebCSS::after
in css, ::after creates a pseudo-element that is the last child of the selected element.
... we can also support keyboard users with this technique, by adding a tabindex of 0 to make each span keyboard focusable, and using a css :focus selector.
... selectors level 3the definition of '::after' in that specification.
::before (:before) - CSS: Cascading Style Sheets
WebCSS::before
in css, ::before creates a pseudo-element that is the first child of the selected element.
... 0.5em 0.5em 0.5em 2em; background: lightgrey; font-family: sans-serif; } li.done { background: #ccff99; } li.done::before { content: ''; position: absolute; border-color: #009933; border-style: solid; border-width: 0 0.3em 0.25em 0; height: 1em; top: 1.3em; left: 0.6em; margin-top: -1em; transform: rotate(45deg); width: 0.5em; } javascript var list = document.queryselector('ul'); list.addeventlistener('click', function(ev) { if (ev.target.tagname === 'li') { ev.target.classlist.toggle('done'); } }, false); here is the above code example running live.
... selectors level 3the definition of '::before' in that specification.
:active - CSS: Cascading Style Sheets
WebCSS:active
/* selects any <a> that is being activated */ a:active { color: red; } the :active pseudo-class is commonly used on <a> and <button> elements.
... living standard selectors level 4the definition of ':active' in that specification.
... selectors level 3the definition of ':active' in that specification.
:blank - CSS: Cascading Style Sheets
WebCSS:blank
note: the :blank selector is considered at risk, as the csswg keeps changing it.
... the :blank css pseudo-class selects empty user input elements (eg.
... html <textarea></textarea> css textarea:blank { border: 3px solid red; } result specifications specification status comment selectors level 4the definition of ':blank' in that specification.
:dir() - CSS: Cascading Style Sheets
WebCSS:dir
/* selects any element with right-to-left text */ :dir(rtl) { background-color: red; } the :dir() pseudo-class uses only the semantic value of the directionality, i.e., the one defined in the document itself.
... note: be aware that the behavior of the :dir() pseudo-class is not equivalent to the [dir=…] attribute selectors.
... selectors level 4the definition of ':dir()' in that specification.
:host - CSS: Cascading Style Sheets
WebCSS:host
the :host css pseudo-class selects the shadow host of the shadow dom containing the css it is used inside — in other words, this allows you to select a custom element from inside its shadow dom.
... /* selects a shadow root host */ :host { font-weight: bold; } syntax :host examples styling the shadow host the following snippets are taken from our host-selectors example (see it live also).
... in this example we have a simple custom element — <context-span> — that you can wrap around text: <h1>host selectors <a href="#"><context-span>example</context-span></a></h1> inside the element's constructor, we create style and span elements, fill the span with the content of the custom element, and fill the style element with some css rules: let style = document.createelement('style'); let span = document.createelement('span'); span.textcontent = this.textcontent; const shadowroot = this.attachshadow({mode: 'open'}); shadowroot.appendchild(style); shadowroot.appendchild(span); style.textcontent = 'span:hover { text-decoration: underline; }' + ':host-context(h1) { font-style: italic; }' + ':host-context(h1):after { content: " - no links in head...
:hover - CSS: Cascading Style Sheets
WebCSS:hover
/* selects any <a> element when "hovered" */ a:hover { color: orange; } styles defined by the :active pseudo-class will be overridden by any subsequent link-related pseudo-class (:link, :visited, or :active) that has at least equal specificity.
... whatwg html github issues selectors level 4the definition of ':hover' in that specification.
... css working group drafts github issues selectors level 3the definition of ':hover' in that specification.
:invalid - CSS: Cascading Style Sheets
WebCSS:invalid
/* selects any invalid <input> */ input:invalid { background-color: pink; } this pseudo-class is useful for highlighting field errors for the user.
... mdn understanding wcag, guideline 1.4 explanations understanding success criterion 1.4.1 | w3c understanding wcag 2.0 notes radio buttons if any one of the radio buttons in a group is required, the :invalid pseudo-class is applied to all of them if none of the buttons in the group is selected.
... selectors level 4the definition of ':invalid' in that specification.
:lang() - CSS: Cascading Style Sheets
WebCSS:lang
/* selects any <p> in english (en) */ p:lang(en) { quotes: '\201c' '\201d' '\2018' '\2019'; } note: in html, the language is determined by a combination of the lang attribute, the <meta> element, and possibly by information from the protocol (such as http headers).
...v lang="fr"><q>this french quote has a <q>nested</q> quote inside.</q></div> <div lang="de"><q>this german quote has a <q>nested</q> quote inside.</q></div> css :lang(en) > q { quotes: '\201c' '\201d' '\2018' '\2019'; } :lang(fr) > q { quotes: '« ' ' »'; } :lang(de) > q { quotes: '»' '«' '\2039' '\203a'; } result specifications specification status comment selectors level 4the definition of ':lang()' in that specification.
... selectors level 3the definition of ':lang()' in that specification.
:nth-last-of-type() - CSS: Cascading Style Sheets
/* selects every fourth <p> element among any group of siblings, counting backwards from the last one */ p:nth-last-of-type(4n) { color: lime; } note: this pseudo-class is essentially the same as :nth-of-type, except it counts items backwards from the end, not forwards from the beginning.
... examples html <div> <span>this is a span.</span> <span>this is another span.</span> <em>this is emphasized.</em> <span>wow, this span gets limed!!!</span> <strike>this is struck through.</strike> <span>here is one last span.</span> </div> css span:nth-last-of-type(2) { background-color: lime; } result specifications specification status comment selectors level 4the definition of ':nth-last-of-type' in that specification.
... selectors level 3the definition of ':nth-last-of-type' in that specification.
:nth-of-type() - CSS: Cascading Style Sheets
/* selects every fourth <p> element among any group of siblings */ p:nth-of-type(4n) { color: lime; } syntax the nth-of-type pseudo-class is specified with a single argument, which represents the pattern for matching elements.
...hs */ p:nth-of-type(2n+1) { color: red; } /* even paragraphs */ p:nth-of-type(2n) { color: blue; } /* first paragraph */ p:nth-of-type(1) { font-weight: bold; } /* this has no effect, as the .fancy class is only on the 4th p element, not the 1st */ p.fancy:nth-of-type(1) { text-decoration: underline; } result specifications specification status comment selectors level 4the definition of ':nth-of-type' in that specification.
... selectors level 3the definition of ':nth-of-type' in that specification.
:root - CSS: Cascading Style Sheets
WebCSS:root
in html, :root represents the <html> element and is identical to the selector html, except that its specificity is higher.
... /* selects the root element of the document: <html> in the case of html */ :root { background: yellow; } syntax :root examples declaring global css variables :root can be useful for declaring global css variables: :root { --main-color: hotpink; --pane-padding: 5px 42px; } specifications specification status comment selectors level 4the definition of ':root' in that specification.
... selectors level 3the definition of ':root' in that specification.
:target - CSS: Cascading Style Sheets
WebCSS:target
/* selects an element with an id matching the current url's fragment */ :target { border: 2px solid black; } for example, the following url has a fragment (denoted by the # sign) that points to an element called section2: http://www.example.com/index.html#section2 the following element would be selected by a :target selector when the current url is equal to the above: <section id="section2">example</section> syntax :target examples a table of contents the :target pseudo-class can be used to highlight the portion of a page that has been linked to from a table of contents.
... selectors level 4the definition of ':target' in that specification.
... selectors level 3the definition of ':target' in that specification.
font-style - CSS: Cascading Style Sheets
syntax font-style: normal; font-style: italic; font-style: oblique; font-style: oblique 30deg; font-style: oblique 30deg 50deg; values normal selects the normal version of the font-family.
... oblique with angle selects a font classified as oblique, and additionally specifies an angle for the slant of the text.
... oblique with angle range selects a font classified as oblique, and additionally specifies a range of allowable angle for the slant of the text.
@page - CSS: Cascading Style Sheets
WebCSS@page
formal syntax @page <page-selector-list> { <page-body> }where <page-selector-list> = [ <page-selector># ]?<page-body> = <declaration>?
...| <page-margin-box> <page-body>where <page-selector> = <pseudo-page>+ | <ident> <pseudo-page>*<page-margin-box> = <page-margin-box-type> '{' <declaration-list> '}'where <pseudo-page> = : [ left | right | first | blank ]<page-margin-box-type> = @top-left-corner | @top-left | @top-center | @top-right | @top-right-corner | @bottom-left-corner | @bottom-left | @bottom-center | @bottom-right | @bottom-right-corner | @left-top | @left-middle | @left-bottom | @right-top | @right-middle | @right-bottom examples @page pseudo-class examples please refer to the various pseudo-classes of @page for examples.
... editor's draft adds the :recto and :verso page selectors css paged media module level 3the definition of '@page' in that specification.
Stacking context example 3 - CSS: Cascading Style Sheets
« css « understanding css z-index stacking context example 3 this last example shows problems that arise when mixing several positioned elements in a multi-level html hierarchy and when z-indexes are assigned using class selectors.
...usually this kind of menu is script-generated either client-side or server-side, so style rules are assigned with a class selector instead of the id selector.
... level #1 this problem can be avoided by removing overlapping between different level menus, or by using individual (and different) z-index values assigned through the id selector instead of class selector, or by flattening the html hierarchy.
Column combinator - CSS: Cascading Style Sheets
the column combinator (||) is placed between two css selectors.
... it matches only those elements matched by the second selector that belong to the column elements matched by the first.
... /* table cells that belong to the "selected" column */ col.selected || td { background: gray; } syntax column-selector || cell-selector { /* style properties */ } examples html <table border="1"> <colgroup> <col span="2"/> <col class="selected"/> </colgroup> <tbody> <tr> <td>a <td>b <td>c </tr> <tr> <td colspan="2">d</td> <td>e</td> </tr> <tr> <td>f</td> <td colspan="2">g</td> </tr> </tbody> </table> css col.selected || td { background: gray; color: white; font-weight: bold; } result specifications specification status comment selectors level 4the definition of 'column combinator' in that specification.
General sibling combinator - CSS: Cascading Style Sheets
the general sibling combinator (~) separates two selectors and matches the second element only if it follows the first element (though not necessarily immediately), and both are children of the same parent element.
...lor: red; } syntax former_element ~ target_element { style properties } examples css p ~ span { color: red; } html <span>this is not red.</span> <p>here is a paragraph.</p> <code>here is some code.</code> <span>and here is a red span!</span> <code>more code...</code> <span>and this is a red span!</span> result specifications specification status comment selectors level 4the definition of 'subsequent-sibling combinator' in that specification.
... selectors level 3the definition of 'general sibling combinator' in that specification.
align-content - CSS: Cascading Style Sheets
nt: center; } #item1 { background-color: #8cffa0; min-height: 30px; } #item2 { background-color: #a0c8ff; min-height: 50px; } #item3 { background-color: #ffa08c; min-height: 40px; } #item4 { background-color: #ffff8c; min-height: 60px; } #item5 { background-color: #ff8cff; min-height: 70px; } #item6 { background-color: #8cffff; min-height: 50px; font-size: 30px; } select { font-size: 16px; } .row { margin-top: 10px; } html <div id="container" class="flex"> <div id="item1">1</div> <div id="item2">2</div> <div id="item3">3</div> <div id="item4">4</div> <div id="item5">5</div> <div id="item6">6</div> </div> <div class="row"> <label for="display">display: </label> <select id="display"> <option value="flex">flex</option> <option value=...
..."grid">grid</option> </select> </div> <div class="row"> <label for="values">align-content: </label> <select id="values"> <option value="normal">normal</option> <option value="stretch">stretch</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="center" selected>center</option> <option value="space-between">space-between</option> <option value="space-around">space-around</option> <option value="space-evenly">space-evenly</option> <option value="start">start</option> <option value="end">end</option> <option value="left">left</option> <option value="right">right</option> <option value="baseline">baseline</option> <option value="first baseline">first baseline</option> <op...
... center</option> <option value="unsafe center">unsafe center</option> <option value="safe right">safe right</option> <option value="unsafe right">unsafe right</option> <option value="safe end">safe end</option> <option value="unsafe end">unsafe end</option> <option value="safe flex-end">safe flex-end</option> <option value="unsafe flex-end">unsafe flex-end</option> </select> </div> javascript var values = document.getelementbyid('values'); var display = document.getelementbyid('display'); var container = document.getelementbyid('container'); values.addeventlistener('change', function (evt) { container.style.aligncontent = evt.target.value; }); display.addeventlistener('change', function (evt) { container.classname = evt.target.value; }); result speci...
align-items - CSS: Cascading Style Sheets
nt: center; } #item1 { background-color: #8cffa0; min-height: 30px; } #item2 { background-color: #a0c8ff; min-height: 50px; } #item3 { background-color: #ffa08c; min-height: 40px; } #item4 { background-color: #ffff8c; min-height: 60px; } #item5 { background-color: #ff8cff; min-height: 70px; } #item6 { background-color: #8cffff; min-height: 50px; font-size: 30px; } select { font-size: 16px; } .row { margin-top: 10px; } html <div id="container" class="flex"> <div id="item1">1</div> <div id="item2">2</div> <div id="item3">3</div> <div id="item4">4</div> <div id="item5">5</div> <div id="item6">6</div> </div> <div class="row"> <label for="display">display: </label> <select id="display"> <option value="flex">flex</option> <option value="...
...grid">grid</option> </select> </div> <div class="row"> <label for="values">align-items: </label> <select id="values"> <option value="normal">normal</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="center" selected>center</option> <option value="baseline">baseline</option> <option value="stretch">stretch</option> <option value="start">start</option> <option value="end">end</option> <option value="self-start">self-start</option> <option value="self-end">self-end</option> <option value="left">left</option> <option value="right">right</option> <option value="first baseline">first baseline</option> <option value="last baseline">last baseline</option> <option value="sa...
...ption> <option value="unsafe right">unsafe right</option> <option value="safe end">safe end</option> <option value="unsafe end">unsafe end</option> <option value="safe self-end">safe self-end</option> <option value="unsafe self-end">unsafe self-end</option> <option value="safe flex-end">safe flex-end</option> <option value="unsafe flex-end">unsafe flex-end</option> </select> </div> javascript var values = document.getelementbyid('values'); var display = document.getelementbyid('display'); var container = document.getelementbyid('container'); values.addeventlistener('change', function (evt) { container.style.alignitems = evt.target.value; }); display.addeventlistener('change', function (evt) { container.classname = evt.target.value; }); result specifi...
<blend-mode> - CSS: Cascading Style Sheets
below it we have a provided a <select> menu that allows you to change the background-blend-mode applied to the <div>, allowing you to compare the different blend mode effects.
... html <div></div> <p>choose a blend-mode:</p> <select> <option selected>normal</option> <option>multiply</option> <option>screen</option> <option>overlay</option> <option>darken</option> <option>lighten</option> <option>color-dodge</option> <option>color-burn</option> <option>hard-light</option> <option>soft-light</option> <option>difference</option> <option>exclusion</option> <option>hue</option> <option>saturation</option> <option>color</option> <option>luminosity</option> </select> css div { width: 300px; height: 300px; background: url(https://media.prod.mdn.mozit.cloud/attachments/2020/07/29/17350/3b4892b7e820122ac6dd7678891d4507/firefox.png) no-repeat center, linear-gradient(to bottom, blue, orange); } javascript const selectelem = document.quer...
...yselector('select'); const divelem = document.queryselector('div'); selectelem.addeventlistener('change', () => { divelem.style.backgroundblendmode = selectelem.value; }); result specifications specification status comment compositing and blending level 1the definition of '<blend-mode>' in that specification.
display - CSS: Cascading Style Sheets
WebCSSdisplay
below that, we have a select menu that allows you to apply different display values to the containers, allowing you to compare and contrast how the different values affect the element's layout, and that of their children.
... html <article class="container"> <span>first</span> <span>second</span> <span>third</span> </article> <article class="container"> <span>first</span> <span>second</span> <span>third</span> </article> <div> <label for="display">choose a display value:</label> <select id="display"> <option selected>block</option> <option>inline</option> <option>inline-block</option> <option>none</option> <option>flex</option> <option>inline-flex</option> <option>grid</option> <option>inline-grid</option> <option>table</option> <option>list-item</option> </select> </div> css html { font-family: helvetica, arial, sans-serif; letter...
...-spacing: 1px; padding-top: 10px; } article { background-color: red; } article span { background-color: black; color: white; margin: 1px; } article, span { padding: 10px; border-radius: 7px; } article, div { margin: 20px; } javascript const articles = document.queryselectorall('.container'); const select = document.queryselector('select'); function updatedisplay() { articles.foreach((article) => { article.style.display = select.value; }); } select.addeventlistener('change', updatedisplay); updatedisplay(); result note: you can find more examples in the pages for each separate display data type, linked above.
place-content - CSS: Cascading Style Sheets
examples placing content in a flex container html <div id="container"> <div class="small">lorem</div> <div class="small">lorem<br/>ipsum</div> <div class="large">lorem</div> <div class="large">lorem<br/>impsum</div> <div class="large"></div> <div class="large"></div> </div> <code>writing-mode:</code><select id="writingmode"> <option value="horizontal-tb" selected>horizontal-tb</option> <option value="vertical-rl">vertical-rl</option> <option value="vertical-lr">vertical-lr</option> <option value="sideways-rl">sideways-rl</option> <option value="sideways-lr">sideways-lr</option> </select><code>;</code><br/> <code>direction:</code><select id="direction"> <option value="ltr" selected>ltr</o...
...ption> <option value="rtl">rtl</option> </select><code>;</code><br/> <code>place-content:</code><select id="aligncontentalignment"> <option value="normal">normal</option> <option value="first baseline">first baseline</option> <option value="last baseline">last baseline</option> <option value="baseline">baseline</option> <option value="space-between">space-between</option> <option value="space-around">space-around</option> <option value="space-evenly" selected>space-evenly</option> <option value="stretch">stretch</option> <option value="center">center</option> <option value="start">start</option> <option value="end">end</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="safe">safe</option> <option value...
...="unsafe">unsafe</option> </select> <select id="justifycontentalignment"> <option value="normal">normal</option> <option value="space-between">space-between</option> <option value="space-around">space-around</option> <option value="space-evenly">space-evenly</option> <option value="stretch">stretch</option> <option value="center" selected>center</option> <option value="start">start</option> <option value="end">end</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="left">left</option> <option value="right">right</option> <option value="safe">safe</option> <option value="unsafe">unsafe</option> </select><code>;</code> var update = function () { document.getelementbyid("container").style.placecontent ...
Audio and Video Delivery - Developer guides
here's a trick that stops the download at once: var mediaelement = document.queryselector("#mymediaelementid"); mediaelement.removeattribute("src"); mediaelement.load(); by removing the media element's src attribute and invoking the load() method, you release the resources associated with the video, which stops the network download.
... var mediaelement = document.queryselector('#mediaelementid'); mediaelement.seekable.start(0); // returns the starting time (in seconds) mediaelement.seekable.end(0); // returns the ending time (in seconds) mediaelement.currenttime = 122; // seek to 122 seconds mediaelement.played.end(0); // returns the number of seconds the browser has played specifying playback range when specifying the uri of media for an <audio> or <vide...
...then you can replace the video with its fallback content: <video controls> <source src="dynamicsearch.mp4" type="video/mp4"></source> <a href="dynamicsearch.mp4"> <img src="dynamicsearch.jpg" alt="dynamic app search in firefox os"> </a> <p>click image to play a video demo of dynamic app search</p> </video> var v = document.queryselector('video'), sources = v.queryselectorall('source'), lastsource = sources[sources.length-1]; lastsource.addeventlistener('error', function(ev) { var d = document.createelement('div'); d.innerhtml = v.innerhtml; v.parentnode.replacechild(d, v); }, false); audio/video javascript libraries a number of audio and video javascript libaries exist.
Challenge solutions - Developer guides
selectors second paragraph blue challenge without changing your html file, add a single rule to your css file that keeps all the initial letters the same color as they are now, but makes all the other text in the second paragraph blue.
... solution add a rule with an id selector of #second and a declaration color: blue;, as shown below: #second { color: blue; } a more specific selector, p#second also works.
... solution change the selector of the new rule to be a tag selector using p: p { color: blue; } the rules for the other colors all have more specific selectors, so they override the blue of the paragraph.
The HTML autocomplete attribute - HTML: Hypertext Markup Language
the html autocomplete attribute is available on <input> elements that take a text or numeric value as input, <textarea> elements, <select> elements, and <form> elements.
... if an <input>, <select> or <textarea> element has no autocomplete attribute, then browsers use the autocomplete attribute of the element's form owner, which is either the <form> element that the element is a descendant of, or the <form> whose id is specified by the form attribute of the element.
... in order to provide autocompletion, user-agents might require <input>/<select>/<textarea> elements to: have a name and/or id attribute be descendants of a <form> element the form to have a submit button values "off" the browser is not permitted to automatically enter or select a value for this field.
HTML attribute: size - HTML: Hypertext Markup Language
WebHTMLAttributessize
the size attribute defines the width of the <input> and the height of the <select> element.
...adding size on a select changes the height, definining how many options are visible in the closed state.
... <label for="fruit">enter a fruit</label> <input type="text" size="15" id="fruit"> <label for="vegetable">enter a vegetable</label> <input type="text" id="vegetable"> <select name="fruits" size="5"> <option>banana</option> <option>cherry</option> <option>strawberry</option> <option>durian</option> <option>blueberry</option> </select> <select name="vegetables" size="5"> <option>carrot</option> <option>cucumber</option> <option>cauliflower</option> <option>celery</option> <option>collard greens</option> </select> specifications specification status html living standardthe definition of 'size attribute' in that specification.
<keygen> - HTML: Hypertext Markup Language
WebHTMLElementkeygen
it will cause some sort of selection to be presented to the user for selecting key size.
... the ui for the selection may be a menu, radio buttons, or possibly something else.
... when the submit button is pressed, a key pair of the selected size is generated.
<menuitem> - HTML: Hypertext Markup Language
WebHTMLElementmenuitem
checked boolean attribute which indicates whether the command is selected.
... radiogroup this attribute specifies the name of a group of commands to be toggled as radio buttons when selected.
... radio: represent one selection from a group of commands that can be toggled as radio buttons.
<textarea> - HTML: Hypertext Markup Language
WebHTMLElementtextarea
unlike the disabled attribute, the readonly attribute does not prevent the user from clicking or selecting in the control.
...have a play with both and you'll see the difference in behavior — the disabled element is not selectable in any way (and its value is not submitted), whereas the readonly element is selectable and its contents copyable (and its value is submitted); you just can't edit the contents.
... note: in browsers other than firefox, such as chrome, the disabled textarea content may be selectable and copyable.
Digest - HTTP
WebHTTPHeadersDigest
in rfc 7231 terms this is the selected representation of a resource.
... the selected representation depends on the content-type and content-encoding header values: so a single resource may have multiple different digest values.
... examples digest: sha-256=x48e9qookqqrvdts8nojrjn3owduoywxbf7kbu9dbpe= digest: sha-256=x48e9qookqqrvdts8nojrjn3owduoywxbf7kbu9dbpe=,unixsum=30637 specifications specification title draft-ietf-httpbis-digest-headers-latest resource digests for http this header was originally defined in rfc 3230, but the definition of "selected representation" in rfc 7231 made the original definition inconsistent with current http specifications.
Protocol upgrade mechanism - HTTP
these should be selected from the iana websocket extension name registry.
...the first one that is supported by the server will be selected and returned by the server in a sec-websocket-protocol header included in the response.
...the subprotocols may be selected from the iana websocket subprotocol name registry or may be a custom name jointly understood by the client and the server.
Array.prototype.map() - JavaScript
[2, 8, 18] // numbers is still [1, 4, 9] using map generically this example shows how to use map on a string to get an array of bytes in the ascii encoding representing the character values: let map = array.prototype.map let a = map.call('hello world', function(x) { return x.charcodeat(0) }) // a now equals [72, 101, 108, 108, 111, 32, 87, 111, 114, 108, 100] using map generically queryselectorall this example shows how to iterate through a collection of objects collected by queryselectorall.
... this is because queryselectorall returns a nodelist (which is a collection of objects).
... in this case, we return all the selected options' values on the screen: let elems = document.queryselectorall('select option:checked') let values = array.prototype.map.call(elems, function(obj) { return obj.value }) an easier way would be the array.from() method.
Intl - JavaScript
the matcher can be selected using a property of the options argument (see below).
... if the selected language tag had a unicode extension substring, that extension is now used to customize the constructed object or the behavior of the function.
... one property is supported by all language sensitive constructors and functions: the localematcher property, whose value must be a string "lookup" or "best fit" and which selects one of the locale matching algorithms described above.
Using images in HTML - Web media technologies
WebMediaimages
object-position the object-position css property specifies the alignment of content in a selected replaced element within the element's box.
... guides these articles provide guidance on selecting and configuring image types.
...additionally, this article provides guidance for selecting the best image file type for a given situation.
Add to Home screen - Progressive web apps (PWAs)
first of all, we declare a deferredprompt variable (which we'll explain later on), get a reference to our install button, and set it to display: none initially: let deferredprompt; const addbtn = document.queryselector('.add-button'); addbtn.style.display = 'none'; we hide the button initially because the pwa will not be available for install until it follows the a2hs criteria.
... if the user selects install, the app is installed (available as standalone desktop app), and the install button no longer shows (the onbeforeinstallprompt event no longer fires if the app is already installed).
... when you open the app, it will appear in its own window: if the user selects cancel, the state of the app goes back to how it was before the button was clicked.
The building blocks of responsive design - Progressive web apps (PWAs)
the markup is very simple: <x-deck selected-index="0"> <x-card> … </x-card> <x-card> … </x-card> <x-card> … </x-card> </x-deck> note: these weird x- elements may be unfamiliar; they are part of brick, mozilla's ui element library for mobile web apps.
... note: media queries are a css3 feature that allow you to selectively apply css depending on the results of media feature tests — for more on the basics, read media queries.
...there are currently some standards proposals in the works that would provide this — the w3c responsive images community group discussed this problem for ages and arrived at the <picture> element, which provides a similar markup structure to <video>, with <source> alternatives selectable via media query results.
<a> - SVG: Scalable Vector Graphics
WebSVGElementa
ement/circle"> <circle cx="50" cy="40" r="35"/> </a> <!-- a link around a text --> <a href="/docs/web/svg/element/text"> <text x="50" y="90" text-anchor="middle"> &lt;circle&gt; </text> </a> </svg> /* as svg does not provide a default visual style for links, it's considered best practice to add some */ @namespace svg url(http://www.w3.org/2000/svg); /* necessary to select only svg <a> elements, and not also html’s.
... see warning below */ svg|a:link, svg|a:visited { cursor: pointer; } svg|a text, text svg|a { fill: blue; /* even for text, svg uses fill over color */ text-decoration: underline; } svg|a:hover, svg|a:active { outline: dotted 1px blue; } since this element shares its tag name with html's <a> element, selecting a with css or queryselector may apply to the wrong kind of element.
...tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriescontainer elementpermitted contentany number of the following elements, in a...
<feDisplacementMap> - SVG: Scalable Vector Graphics
xc(x,y) and yc(x,y) are the component values of the channel designated by xchannelselector and ychannelselector.
... usage context categoriesfilter primitive elementpermitted contentany number of the following elements, in any order:<animate>, <set> attributes global attributes core attributes presentation attributes filter primitive attributes class style specific attributes in in2 scale xchannelselector ychannelselector dom interface this element implements the svgfedisplacementmapelement interface.
... example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of '<fedisplacementmap>' in that specification.
SVG documentation index - SVG: Scalable Vector Graphics
WebSVGIndex
255 xchannelselector filters, needsexample, svg, svg attribute the xchannelselector attribute indicates which color channel from in2 to use to displace the pixels in in along the x-axis.
... 267 ychannelselector filters, svg, svg attribute the ychannelselector attribute indicates which color channel from in2 to use to displace the pixels in in along the y-axis.
... 295 <altglyph> deprecated, element, reference, svg, svg text content the <altglyph> svg element allows sophisticated selection of the glyphs used to render its child character data.
SVG 1.1 Support in Firefox - SVG: Scalable Vector Graphics
various presentation attributes don't work (alignment-baseline, baseline-shift, dominant-baseline, kerning, letter-spacing, word-spacing, writing-mode, glyph-orientation-horizontal, glyph-orientation-vertical) recently implemented presentation attributes: direction, unicode-bidi, font-variant, text-decoration svgtextelement recently imlemented bindings: selectsubstring recently implemented attributes: textlength, lengthadjust tspan implemented.
... various presentation attributes don't work (alignment-baseline, baseline-shift, dominant-baseline, kerning, letter-spacing, word-spacing, writing-mode, glyph-orientation-horizontal, glyph-orientation-vertical) recently implemented presentation attributes: direction, unicode-bidi, font-variant, text-decoration svgtspanelement recently implemented bindings: selectsubstring recently implemented attributes: textlength, lengthadjust tref this feature, present in early draft of the spec, has been removed from it and is therefor not implemented (bug 273171).
... recently implemented bindings: selectsubstring altglyph implemented as tspans, no font features as of gecko 2.0 (bug 456286, bug 571808).
SVG 2 support in Mozilla - SVG: Scalable Vector Graphics
implementation status unknown auto as initial value for width and height attributes of <svg> implementation status unknown baseprofile and version attributes removed from <svg> implementation status unknown svgsvgelement.forceredraw() deprecated turned into a no-op (bug 733764) svgsvgelement.deselectall() deprecated not yet deprecated (bug 1302705) <switch> not affecting <style> implementation status unknown requiredfeatures attribute removed implementation status unknown svgsvgelement.currentview and svgsvgelement.usecurrentview removed svgsvgelement.currentview was never implemented, svgsvgelement.usecurrentview not removed yet (bug 1174097) s...
... svg applying to whole document content implementation status unknown presentation attributes on any svg namespaced element implementation status unknown display behavior of <style> defined via ua style sheet implementation status unknown !important user agent style rules controlling never-rendered elements implementation status unknown :focus and ::selection styles implementation status unknown geometry change notes x and y attributes removed from <pattern> and <filter> implementation status unknown auto value of width and height computes to 0 but 100% on <svg> not implemented coordinate systems, transformations and units change notes exception for bad values on sv...
... single closed path, effected by the startoffset attribute and text-anchor property implementation status unknown <tref> removed implementation status unknown <altglyph>, <altglyphdef>, <altglyphitem> and <glyphref> removed <altglyph>, <altglyphdef> and <altglyphitem> removed (bug 1260032), <glyphref> never really implemented (bug 1302693) svgtextcontentelement.selectsubstring() deprecated implementation status unknown getcomputedtextlength() not including dx and dy values implementation status unknown text in non-rendered elements not included in addressable characters implementation status unknown unknown elements in text render as unpositioned spans implementation status unknown offset distances of text positi...
Web Components
:host: selects the shadow host of the shadow dom containing the css it is used inside.
... :host(): selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the selector given as the function's parameter matches the shadow host.
... :host-context(): selects the shadow host of the shadow dom containing the css it is used inside (so you can select a custom element from inside its shadow dom) — but only if the selector given as the function's parameter matches the shadow host's ancestor(s) in the place it sits inside the dom hierarchy.
Index - XPath
WebXPathIndex
found 57 pages: # page tags and summary 1 xpath css selectors, dom, jxon, landing, path, xml, xpath, xslt xpath stands for xml path language.
...since only the root node or element nodes have children, any other use will select nothing.
... 16 comparison of css selectors and xpath css, draft, needscontent, reference, selectors, xpath this article seeks to document the difference between css selectors and xpath for web developers to be able to better choose the right tool for the right job.
<xsl:sort> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementsort
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes the <xsl:sort> element defines a sort key for nodes selected by <xsl:apply-templates> or <xsl:for-each> and determines the order in which they are processed.
... syntax <xsl:sort select=expression order="ascending" | "descending" case-order="upper-first" | "lower-first" lang=xml:lang-code data-type="text" | "number" /> required attributes none.
... optional attributes select uses an xpath expression to specify the nodes to be sorted.
panel - Archive of obsolete content
the html <select> element doesn't work.
...for example, a content script could create a menu and send the user's selection to the add-on.
dev/panel - Archive of obsolete content
to use volcan.js, you can just include it from your panel's html like this: <html> <head> <meta charset="utf-8"> <link href="./my-panel.css"rel="stylesheet"></link> <script src="resource://sdk/dev/volcan.js"></script> </head> <body> <div id = "content"></div> </body> <script src="./my-panel.js"></script> </html> here's a script that uses volcan.js to get the selected tab and display its url: // my-panel.js var content = document.getelementbyid("content"); window.addeventlistener("message", function(event) { var debuggee = event.ports[0]; volcan.connect(debuggee).
... then(writetablist); }); function listtabs(root) { return root.listtabs(); } function writetablist(tablist) { content.textcontent = tablist.tabs[tablist.selected].url; } we don't have detailed documentation for volcan.js, but it's coming soon.
Getting Started (jpm) - Archive of obsolete content
you can do this by pressing the ctrl+o key combination (cmd+o on mac) from within firefox, or selecting the "open" item from firefox's "file" menu.
... this will bring up a file selection dialog: navigate to the "@my-addon.xpi" file, open it and follow the prompts to install the add-on.
Getting started (cfx) - Archive of obsolete content
you can do this by pressing the ctrl+o key combination (cmd+o on mac) from within firefox, or selecting the "open" item from firefox's "file" menu.
... this will bring up a file selection dialog; navigate to the "my-addon.xpi" file, open it and follow the prompts to install the add-on.
Forms related code snippets - Archive of obsolete content
>30</td> </tr> <tr> <td id="zdp-day-1-31" class="zdp-active-cell">31</td> <td class="zdp-empty-cell">&nbsp;</td> <td class="zdp-empty-cell">&nbsp;</td> <td class="zdp-empty-cell">&nbsp;</td> <td class="zdp-empty-cell">&nbsp;</td> <td class="zdp-empty-cell">&nbsp;</td> <td class="zdp-empty-cell">&nbsp;</td> </tr> </tbody> </table> editable <select> fields the content of the <select> element is actually static and not editable.
... if you want to emulate an editable select through a <fieldset> of radioboxes and textboxes (written in pure css, without javascript), please see this example.
Examples and demos from articles - Archive of obsolete content
[article] typewriter effect [html] the following example will delete and re-type simulating a typewriter all the text content of the nodelist which match a specified group of selectors.
...[article] pure-css editable (pseudo)<select> [html] this example shows how it's possible to simulate an editable <select> through a fieldset of radioboxes and textboxes.
Adding Events and Commands - Archive of obsolete content
onselect.
... fired when the selection in a tree or listbox changes.
Handling Preferences - Archive of obsolete content
to open the preferences window in firefox, select the following from the main menu: on windows, tools > options on mac, firefox > preferences on linux, edit > preferences note: keep in mind the usage of the terms "preferences" and "options" in different platforms.
... the standard way of opening a preferences window is to open the add-ons manager, select the add-on, and then click on the preferences button.
Performance best practices in extensions - Archive of obsolete content
remember that any selector in your rule which might match many different nodes is a source of inefficiency during either selector matching or dynamic update processing.
... this is especially bad for the latter if the selector can dynamically start or stop matching.
Extensions support in SeaMonkey 2 - Archive of obsolete content
ser-bottombox"> <something insertbefore="status-bar" /> </vbox> use the following technique to make your overlay work on both seamonkey 2 and firefox 3: <window id="main-window"> <vbox id="browser-bottombox" insertbefore="status-bar"> <something insertbefore="status-bar" /> </vbox> </window> thunderbird 3 gfolderdisplay api seamonkey 2.0 only supports a reduced set of methods: selectedcount selectedmessage selectedmessageisfeed selectedmessageisimap selectedmessageisnews selectedmessageisexternal selectedindices selectedmessages selectedmessageuris messagedisplay gmessagedisplay api seamonkey 2.0 only supports a reduced set of methods: displayedmessage visible javascript tweaks firefox supports some shorthand in various places.
...you can use the application flag to select which overlay should be used with which application: overlay chrome://browser/content/browser.xul chrome://myaddon/content/ffoverlay.xul application={ec8030f7-c20a-464f-9b0e-13a3a9e97384} overlay chrome://messenger/content/mailwindowoverlay.xul chrome://myaddon/content/tboverlay.xul application={3550f703-e582-4d05-9a08-453d09bdfdc6} overlay chrome://navigator/content/navigator.xul chrome://myadd...
Promises - Archive of obsolete content
yield db.execute( "select owners.group as group, nodes.value as task \ from nodes \ inner join owners on owner.id = nodes.owner \ where nodes.key = 'task';", { onrow: row => { runtask(row.getresultbyname("task"), row.getresultbyname("group")); } }); // and quickly grab a s...
... let [row] = yield db.execute( "select value from nodes where key = 'timestamp' \ order by value desc limit 1"); latesttimestamp = row.getresultbyindex(0); } finally { // make sure to close the database when finished.
Adding preferences to an extension - Archive of obsolete content
to do so, we call the nsiprefbranch.getcharpref() method, specifying that we want the preference named "symbol", which is where we store the user's selection for the stock to watch.
...(yhoo)" oncommand="stockwatcher.watchstock('yhoo')"/> </menupopup> </popupset> each item in the menu has a label property, which specifies the text displayed in the menu, as well as an oncommand property, which indicates the javascript code to execute when the user selects that item.
Creating reusable content with CSS and XBL - Archive of obsolete content
you can use css to provide content for selected elements, but the content is limited to text and images, and its positioning is limited to before or after the selected element.
...you can use xbl to link selected elements to their own: stylesheets content properties and methods event handlers because you avoid linking everything at the document level, you can make self-contained parts that are easy to maintain and reuse.
Autodial for Windows NT - Archive of obsolete content
if more than one dialup connection is configured, and none is selected as the default, we display a list of dialup connections and let the user choose one.
...select "dial whenever a network connection is not present" or "always dial my default connection".
Finding the file to modify - Archive of obsolete content
to access it, go to the "tools" menu, select the "web development" submenu, then select the "dom inspector" item.
... in the dom inspector window, go to the file menu, select the inspect a window submenu, then select the mozilla browser window item (named after the page currently loaded in the browser).
Block and Line Layout Cheat Sheet - Archive of obsolete content
ns_frame_external_reference ns_frame_replaced_element ns_frame_generated_content ns_frame_has_loaded_images ns_frame_out_of_flow ns_frame_selected_content ns_frame_is_dirty ns_frame_is_unflowable an unflowable frame is an error condition; for example, due to system limitations.
...(see nsframe::isframetreetoodeep().) ns_frame_has_dirty_children ns_frame_has_view ns_frame_independent_selection ns_frame_is_special nsblockframe mflags these flags are the private flags that are meaningful to block frames.
Documentation for BiDi Mozilla - Archive of obsolete content
examples of this are in nstextframe::painttextslowly; nstextframe::paintunicodetext when a selection is displayed; nstextframe::getposition; nstextframe::getpointfromoffset.
...the implementation is mostly in layout code, especially in nsselection.cpp and nscaret.cpp.
Monitoring downloads - Archive of obsolete content
dlogger.sqlite"); // get access to the storage service and open the database this.storageservice = components.classes["@mozilla.org/storage/service;1"] .getservice(components.interfaces.mozistorageservice); var dbconn = this.storageservice.opendatabase(this.dbfile); var loglist = document.getelementbyid("loglist"); var statement = dbconn.createstatement("select * from items"); // get all items in table try { while (statement.executestep()) { var row = document.createelement('listitem'); // add the cells to the row var cell = document.createelement('listcell'); var sourcestr = statement.getstring(0); row.setattribute("tooltiptext", sourcestr); sourcestr = sourcestr.slice(sourcestr.lastindexof("/")+1);...
...it starts by opening the sqlite database containing the log information, then creates a select sql statement to pull all entries from the database.
New Skin Notes - Archive of obsolete content
--nickolay 09:19, 25 aug 2005 (pdt) (moving this to a new item) on the contrary, the list of categories current page belongs to, should be near the footer (see mdc:policies_and_guidelines page) (dria: fix catlinks style) the arrows that appear if you select "enhanced recent changes" in your preferences have an ugly border around them.
... --nickolay 04:43, 25 aug 2005 (pdt) the radio buttons on history page are jumping in a weird way because the selected row becomes bold.
Table Layout Regression Tests - Archive of obsolete content
select from the regression-test menu the add new list...entry.
... select %moz_src%/layout/html/tests/block/rtest.lst.
Elements - Archive of obsolete content
only immediate children are matched against the selector.
... for example, an xml fragment <customelement><foobar><hoge/></foobar></customelement> with an binding definition <binding id="customelement"><content><xul:box><children includes="hoge"/></xul:box></content></binding> for the customelement element, <xul:box/> becomes empty because the selector includes="hoge" doesn't match for the immediate child foobar element.
confirm - Archive of obsolete content
this string is typically in the form of a prompt for the user (e.g., "are you sure you want to delete the selected file(s)?").
...alue: false }; var button = confirm("are you sure you want to install foobar 0.1?", "confirm", std_yes_no_buttons, null, null, null, "install fluxcompensator 0.4 as well", check); returns the return value is an integer indicating which button the user selected: value button 0 'cancel' or button 1.
gestalt - Archive of obsolete content
method of install object syntax int gestalt ( string selector ); parameters the gestalt method takes the following parameters: selector the selector code for the information you want.
...the format depends on the select code specified in the selector parameter.
linkedpanel - Archive of obsolete content
« xul reference home linkedpanel type: id the id of the linked tabpanel element that will be displayed when the tab is selected.
...this might be used to avoid duplication by linking several tabs to one panel with slight differences to the content adjusted in the select event.
unread - Archive of obsolete content
« xul reference home unread type: boolean this attribute is set to true if the tab is unread; that is, either it has not yet been selected during the current session, or has changed since the last time it was selected.
... see also selected ...
findbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata close() return type: no return value closes the notification or findbar and removes it from its enclosing notificationbox or findbar.
... this opens the findbar, focuses the edit field for the search term, and selects its contents.
insertItemAt - Archive of obsolete content
note: you cannot insert an item to an index that does not exist, eg: trying to insert an item at the end with element.getrowcount() + 1 example <!-- this example inserts at the selected item or appends, then selects the newly created item --> <script language="javascript"> function insertitemtolist(){ var mylistbox = document.getelementbyid('mylistbox'); // create a date to get some labels and values var somedate = new date(); if(mylistbox.selectedindex == -1){ // no item was selected in list so append to the end mylistbox.appenditem( somedat...
...e.tolocaletimestring(), somedate.gettime() ); var newindex = mylistbox.getrowcount() -1 }else{ // item was selected so insert at the selected item var newindex = mylistbox.selectedindex; mylistbox.insertitemat(newindex, somedate.tolocaletimestring(), somedate.gettime()); } // select the newly created item mylistbox.selectedindex = newindex; } </script> <button label="insert item at selected" oncommand="insertitemtolist()"/> <listbox id="mylistbox"> <listitem label="foo"/> </listbox> see also appenditem() removeitemat() ...
MenuItems - Archive of obsolete content
the user can select the menu item to switch the toolbar visibility.
...this works similarly to the checkbox type, except when selecting an item, all others in the same group are automatically unchecked.
Popup Guide - Archive of obsolete content
the user may select a command and the menu disappears again.
...usually it would contain tools related to the main window, or an inspector which displays properties of a selected element.
date - Archive of obsolete content
ArchiveMozillaXULPropertydate
« xul reference date type: integer the currently selected date of the month from 1 to 31.
... set this property to change the selected date.
datepicker.value - Archive of obsolete content
« xul reference value type: string the currently selected date in the form yyyy-mm-dd.
...set this property to change the selected date.
hour - Archive of obsolete content
ArchiveMozillaXULPropertyhour
« xul reference hour type: integer the currently selected hour from 0 to 23.
... set this property to change the selected hour.
listbox.currentIndex - Archive of obsolete content
(or, on some platforms, typeof(listboxcurrentindex) will be undefined) in a single selection list, the current index will always be the same as the selected index.
... in a multiple selection list, the currently focused row may be modified by the user without changing the selection by pressing the control key and pressing the cursor keys to navigate.
minute - Archive of obsolete content
« xul reference minute type: integer the currently selected minute from 0 to 59.
... set this property to change the selected minute.
month - Archive of obsolete content
ArchiveMozillaXULPropertymonth
« xul reference month type: integer the currently selected month from 0 to 11.
... set this property to change the selected month.
pageIndex - Archive of obsolete content
« xul reference pageindex type: integer this property returns the index of the currently selected page.
... you can change the selected page by modifying this property.
second - Archive of obsolete content
« xul reference second type: integer the currently selected second from 0 to 59.
... set this property to change the selected second.
selstyle - Archive of obsolete content
« xul reference selstyle type: string if set to the value primary, only the label of the primary column will be highlighted when an item in the tree is selected.
...to see the difference, compare the selection style in the folder list and the message list in mozilla mail.
year - Archive of obsolete content
ArchiveMozillaXULPropertyyear
« xul reference year type: integer the currently selected year from 1 to 9999.
... set this property to change the selected year.
Filtering - Archive of obsolete content
for example, you wish the user to be able to select a value from a list, and the template results should be filtered based on that value.
...a menulist is used to allow one to select either a specific country, or select all to show all of the photos.
Result Generation - Archive of obsolete content
://www.xulplanet.com/rdf/b"/> <rel:relateditem rdf:resource="http://www.xulplanet.com/rdf/c"/> <rel:relateditem rdf:resource="http://www.xulplanet.com/rdf/d"/> </rdf:description> <rdf:description rdf:about="http://www.xulplanet.com/rdf/c"> <rel:relateditem rdf:resource="http://www.xulplanet.com/rdf/d"/> </rdf:description> </rdf:rdf> for a xul template query, you first need to select a starting point in the rdf graph.
... once you have selected a starting point, you use a number of statements which indicate where to go next when navigating the graph.
Adding Event Handlers - Archive of obsolete content
the command event is fired when a user activates an element, for example by pressing a button, changing a checkbox or selecting an item from a menu.
...by using this handler, the user will be able to close the window by clicking the menu item with the mouse or by selecting it with the keyboard.
Creating Dialogs - Archive of obsolete content
othing" title="dialog example" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul" buttons="accept,cancel" ondialogaccept="return dook();" ondialogcancel="return docancel();"> <script> function dook(){ alert("you pressed ok!"); return true; } function docancel(){ alert("you pressed cancel!"); return true; } </script> <description value="select a button"/> </dialog> you may place any elements that you wish in a dialog.
... buttonaccesskeyaccept="s" ondialogaccept="return dosave();" buttonlabelcancel="cancel" buttonaccesskeycancel="n" ondialogcancel="return docancel();"> <script> function dosave(){ //dosomething() return true; } function docancel(){ return true; } </script> <dialogheader title="my dialog" description="example dialog"/> <groupbox flex="1"> <caption label="select favourite fruit"/> <radio id="orange" label="oranges because they are fruity"/> <radio id="violet" selected="true" label="strawberries because of their colour"/> <radio id="yellow" label="bananas because they are pre-packaged"/> </groupbox> </dialog> the buttons elements can be accessed with the following javascript // the accept button var acceptbutt = document.documentelement.getbutto...
Creating a Wizard - Archive of obsolete content
an example wizard source <?xml version="1.0"?> <?xml-stylesheet href="chrome://global/skin/" type="text/css"?> <wizard id="example-window" title="select a dog wizard" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <wizardpage> <description> this wizard will help you select the type of dog that is best for you." </description> <label value="why do you want a dog?"/> <menulist> <menupopup> <menuitem label="to scare people away"/> <menuitem label="to get rid of a cat"/> ...
...for example: <wizard id="example-window" title="select a dog wizard" onwizardfinish="return savedoginfo();" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> when the user clicks the finish button, the function savedoginfo() will be called, which would be defined in a script file to save the information that was entered.
Introduction to RDF - Archive of obsolete content
for example, a selection of the fields in the mozilla bookmark list is described by the uris below: name http://home.netscape.com/nc-rdf#name bookmark name url http://home.netscape.com/nc-rdf#url url to link to description http://home.netscape.com/nc-rdf#description bookmark description last visited http://home.net...
...the name was selected because it has meaning in this case, but we could have selected something else.
Localization - Archive of obsolete content
label="&pastecmd.label;" accesskey="&pastecmd.accesskey;" key="paste_cmd" disabled="true"/> </menupopup> </menu> </menubar> <toolbar id="findfiles-toolbar"> <toolbarbutton id="opensearch" label="&opencmdtoolbar.label;"/> <toolbarbutton id="savesearch" label="&savecmdtoolbar.label;"/> </toolbar> </toolbox> <tabbox> <tabs> <tab label="&searchtab;" selected="true"/> <tab label="&optionstab;"/> </tabs> <tabpanels> <tabpanel id="searchpanel" orient="vertical" context="editpopup"> <description> &finddescription; </description> <spacer class="titlespace"/> <groupbox orient="horizontal"> <caption label="&findcriteria;"/> <menulist id="searchtype"> <menupopup> <menuitem label="&type.name;"/> ...
...ste"> <!entity cutcmd.accesskey "t"> <!entity copycmd.accesskey "c"> <!entity pastecmd.accesskey "p"> <!entity cutcmd.commandkey "x"> <!entity copycmd.commandkey "c"> <!entity pastecmd.commandkey "v"> <!entity opencmdtoolbar.label "open"> <!entity savecmdtoolbar.label "save"> <!entity searchtab "search"> <!entity optionstab "options"> <!entity finddescription "enter your search criteria below and select the find button to begin the search."> <!entity findcriteria "search criteria"> <!entity type.name "name"> <!entity type.size "size"> <!entity type.date "date modified"> <!entity mode.is "is"> <!entity mode.isnot "is not"> <!entity casesensitive "case sensitive search"> <!entity matchfilename "match entire filename"> <!entity results.filename "filename"> <!entity results.location "location"> <!en...
More Tree Features - Archive of obsolete content
the user can choose to show the column by selecting it from the drop-down on the end of the header row.
... next, we'll find out to get and set the selection for trees.
Templates - Archive of obsolete content
s="rdf:bookmarks" ref="nc:bookmarksroot" flex="1"> <template> <rule rdf:type="http://home.netscape.com/nc-rdf#bookmarkseparator"> <spacer uri="rdf:*" height="16"/> </rule> <rule> <button uri="rdf:*" label="rdf:http://home.netscape.com/nc-rdf#name"/> </rule> </template> </vbox> </window> by using two rules, we have allowed the contents of the template to be selectively generated.
... in the first rule, bookmark separators are selected, as can be seen by the rdf:type attribute.
Updating Commands - Archive of obsolete content
select: occurs when the selected text changes.
...<commandset id="globaleditmenuitems" commandupdater="true" events="focus" oncommandupdate="goupdateglobaleditmenuitems()"/> <commandset id="selecteditmenuitems" commandupdater="true" events="select" oncommandupdate="goupdateselecteditmenuitems()"/> <commandset id="undoeditmenuitems" commandupdater="true" events="undo" oncommandupdate="goupdateundoeditmenuitems()"/> <commandset id="clipboardeditmenuitems" commandupdater="true" events="clipboard" ...
XUL Event Propagation - Archive of obsolete content
in the example above, when the menuitem raises the "command" event, indicating that it has been selected, the menupopup, the menu itself, the parent box, or the root window element itself can all take advantage of this.
...for example, if an event handler at the menu is handling an event raised by one of the menu items, then the menu should be able to identify the raising element and take the appropriate action, as in the following example, where a javascript function determines which menuitem was selected and responds appropriately: <script> function docmd(el) { v = el.getattribute("value"); if (v == "new") alert("new clicked"); else if (v == "open") alert("open clicked"); else alert("close clicked"); } </script> ...
browser - Archive of obsolete content
this is the preferred value for any browser element in an application, which will use multiple browsers of equal privileges, and is unselected at the moment.
..., getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata addprogresslistener( listener ) return type: no return value add a progress listener to the browser which will monitor loaded documents.
caption - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements groupbox, checkbox ...
dialog - Archive of obsolete content
s" type="text/css"?> <dialog id="donothing" title="dialog example" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul" buttons="accept,cancel" buttonlabelcancel="cancel" buttonlabelaccept="save"> <dialogheader title="options" description="my preferences"/> <groupbox> <caption label="colour"/> <radiogroup> <radio label="red"/> <radio label="green" selected="true"/> <radio label="blue"/> </radiogroup> <label value="nickname"/> <textbox/> </groupbox> </dialog> attributes activetitlebarcolor type: color string specify background color of the window's titlebar when it is active (foreground).
..., getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata acceptdialog() return type: no return value accepts the dialog and closes it, similar to pressing the ok button.
grid - Archive of obsolete content
ArchiveMozillaXULgrid
column --> <groupbox> <caption label="details"/> <grid> <columns> <column flex="1"/> <column flex="2"/> </columns> <rows> <row> <label value="user name"/> <textbox id="user"/> </row> <row> <label value="group"/> <menulist> <menupopup> <menuitem label="accounts"/> <menuitem label="sales" selected="true"/> <menuitem label="support"/> </menupopup> </menulist> </row> </rows> </grid> </groupbox> attributes inherited from xul element align, allowevents, allownegativeassertions, class, coalesceduplicatearcs, collapsed, container, containment, context, contextmenu, datasources, dir, empty, equalsize, flags, flex, height, hidden, id, insertafter,...
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements columns, column, rows, row.
key - Archive of obsolete content
ArchiveMozillaXULkey
this occurs when a user selects a menu item or presses a keyboard shortcut attached to the command.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata details on key, keycode, and modifiers attributes for example, consider the following key: <key key="r" modifiers="shift"/> this key will only match when the sh...
label - Archive of obsolete content
ArchiveMozillaXULlabel
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
... these classes should be used instead of changing the style of the element directly since they will fit more naturally with the user's selected theme.
listcell - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes listcell-iconic use this class to have an image appear on the listcell.
listheader - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listcols, listhead, listitem ...
notification - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
..., getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata close() return type: no return value closes the notification or findbar and removes it from its enclosing notificationbox or findbar.
preference - Archive of obsolete content
a change event is fired in different ways for different xul input elements as listed below: onchange type: script code textbox when enter key is pressed radio/check box when the state is changed select list when the selected item is changed what is accessible the script context at this point can only access the following things: global values/functions i.e.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata events change when a preference value changes, an onchange/change event is fired on the <preference> element.
scrollbar - Archive of obsolete content
the scroll bar may also be used independently when a numeric value or percentage needs to be selected by the user.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
separator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
... these classes should be used instead of changing the style of the element directly since they will fit more naturally with the user's selected theme.
splitter - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes the following classes may be used to style the element.
... these classes should be used instead of changing the style of the element directly since they will fit more naturally with the user's selected theme.
toolbaritem - Archive of obsolete content
examples <toolbaritem> <menulist label="bus"> <menupopup> <menuitem label="car"/> <menuitem label="taxi"/> <menuitem label="bus" selected="true"/> <menuitem label="train"/> </menupopup> </menulist> </toolbaritem> <toolbaritem id="sample-toolbutton-unified"> <toolbarbutton id="myext-button1" class="toolbarbutton-1" label="label1" /> <toolbarbutton id="myext-button2" class="toolbarbutton-1" label="labe2l" /> </toolbaritem> attributes inherited from xul element align, allowevents...
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox ...
tooltip - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
..., getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
treecell - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treerow and treeseparator.
treeitem - Archive of obsolete content
the treeitem can be clicked by the user to select the row of the tree.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treerow, treecell and treeseparator.
wizardpage - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
...tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related wizard ...
XULRunner tips - Archive of obsolete content
ss.type.skin", "extension:manager-themes"); pref("xpinstall.dialog.progress.type.chrome", "extension:manager-extensions"); pref("extensions.update.enabled", true); pref("extensions.update.interval", 86400); pref("extensions.dss.enabled", false); pref("extensions.dss.switchpending", false); pref("extensions.ignoremtimechanges", false); pref("extensions.logging.enabled", false); pref("general.skins.selectedskin", "classic/1.0"); // nb these point at amo pref("extensions.update.url", "chrome://mozapps/locale/extensions/extensions.properties"); pref("extensions.getmoreextensionsurl", "chrome://mozapps/locale/extensions/extensions.properties"); pref("extensions.getmorethemesurl", "chrome://mozapps/locale/extensions/extensions.properties"); if your application is based on gecko 2.0, you need to regi...
...municator classic/1.0 skin/communicator/ add a skin folder named "communicator" and add a single css file named "communicator.css" with this content: @import url("chrome://global/skin"); dom inspector to add dom inspector 2.0.* to your xulrunner 1.9.0.* application follow these steps: download the dom inspector (instead of clicking the "add to..." button, right-click and select "save link as...").
Gecko Compatibility Handbook - Archive of obsolete content
to understand why, consider the following: html without optional ending tags equivalent html with optional ending tags <select> <option>optionvalue </select> <select> <option>optionvalue</option> </select> now consider if we used the xml empty tag notation: the <option />.
... html with xml empty tag notation equivalent html with ending tags <select> <option />optionvalue </select> <select> <option></option>optionvalue </select> this is simply not correct.
Sunbird Theme Tutorial - Archive of obsolete content
select it and press the use theme button.
...select the newly installed theme and press the use theme button.
Theme changes in Firefox 3.5 - Archive of obsolete content
to do this only for 3.5 use a css selector that is only supported in 3.5, like so: window:not([active="true"]) menubar>menu:nth-child(1n) { color:threedshadow } private browsing: show private browsing state by coloring the url bar, or by adding an icon to the toolbox/tabbrowserbar.
... native hyperlink color: use -moz-nativehyperlinktext, to select the computer's native hyperlink color.
-ms-content-zoom-snap-points - Archive of obsolete content
in the first selector, the first snap-point is at 0%, and the interval is set to 100%.
... in the second selector, each snap-point is listed separately—100%, 200%, 300%, and so on.
-ms-scroll-snap-points-x - Archive of obsolete content
in the first selector, the first snap-point is at 0%, and the interval is set to 100%.
... in the second selector, each snap-point is listed separately — 100%, 200%, 300%, and so on.
-ms-scroll-snap-points-y - Archive of obsolete content
in the first selector, the first snap-point is at 0%, and the interval is set to 100%.
... in the second selector, each snap-point is listed separately — 100%, 200%, 300%, and so on.
::-ms-browse - Archive of obsolete content
permitted properties only the following css properties can be used in a rule with ::-ms-browse in its selector.
...box-shadow box-sizing color cursor display (values block, inline-block, none) @font-face font-size font-style font-weight height margin-bottom margin-left margin-right margin-top opacity outline-color outline-style outline-width padding-bottom padding-left padding-right padding-top transform transform-origin visibility width syntax ::-ms-browse example html <label>select image: <input type="file"></label> css input[type="file"]::-ms-browse { color: red; background-color: yellow; } result output example specifications not part of any specification.
::-ms-expand - Archive of obsolete content
the ::-ms-expand css pseudo-element is a microsoft extension that represents the button of a <select> menu control that opens or closes the drop-down menu.
... allowable properties only the following css properties can be used in a rule with ::-ms-expand in its selector.
::-ms-fill-lower - Archive of obsolete content
the ::-ms-fill-lower css pseudo-element represents the lower portion of the track of a slider control; that is, the portion corresponding to values less than the value currently selected by the thumb.
... allowable properties only the following css properties can be used in a rule with ::-ms-fill-lower in its selector.
::-ms-fill-upper - Archive of obsolete content
the ::-ms-fill-upper css pseudo-element is a microsoft extension that represents the upper portion of the track of a slider control; that is, the portion corresponding to values greater than the value currently selected by the thumb.
... allowable properties only the following css properties can be used in a rule with ::-ms-fill-upper in its selector.
::-ms-fill - Archive of obsolete content
an indeterminate progress bar can be selected with the :indeterminate pseudo-class.) by default, internet explorer and edge display a moving dots animation for an indeterminate progress bar.
... allowable properties only the following css properties can be used in a rule with ::-ms-fill in its selector.
::-ms-track - Archive of obsolete content
applying the color property within the ::-ms-track selector affects the tick marks inside the track area.
... allowable properties only the following css properties can be used in a rule with ::-ms-track in its selector.
Descendants and Filters - Archive of obsolete content
the * selector returns all descendants in an xml list.
... filters in many cases, especially with the * selector, you don't want to work with all of the nodes that would be returned by the .
Array comprehensions - Archive of obsolete content
var numbers = [1, 2, 3, 4]; var doubled = [for (i of numbers) i * 2]; console.log(doubled); // logs 2,4,6,8 this is equivalent to the following map() operation: var doubled = numbers.map(i => i * 2); comprehensions can also be used to select items that match a particular expression.
... here is a comprehension which selects only even numbers: var numbers = [1, 2, 3, 21, 22, 30]; var evens = [for (i of numbers) if (i % 2 === 0) i]; console.log(evens); // logs 2,22,30 filter() can be used for the same purpose: var evens = numbers.filter(i => i % 2 === 0); map() and filter() style operations can be combined into a single array comprehension.
Back to the Server: Server-Side JavaScript On The Rise - Archive of obsolete content
ase from rhino // import the java sql packages importpackage( java.sql ); // load the mysql driver java.lang.class.forname( "com.mysql.jdbc.driver" ); // create connection to the database var conn = drivermanager.getconnection( "jdbc:mysql://localhost/rhino", "urhino", "prhino" ); // create a statement handle var stmt = conn.createstatement(); // get a resultset var rs = stmt.executequery( "select * from employee" ); // get the metadata from the resultset var meta = rs.getmetadata(); // loop over the records, dump out column names and values while( rs.next() ) { for( var i = 1; i <= meta.getcolumncount(); i++ ) { print( meta.getcolumnname( i ) + ": " + rs.getobject( i ) + "\n" ); } print( "----------\n" ); } // cleanup rs.close(); stmt.close(); conn.close(); this ...
... listing 10 - creating a simple xml service <script runat="server"> var rs_comments = jaxer.db.execute("select * from comments"); var doc = document.implementation.createdocument('', 'comments', null); var root = doc.documentelement; rs_comments.rows.foreach(function(row, index) { if (true || index < 10) { var node = doc.createelement('comment'); node.setattribute('id', row.id); node.setattribute('name', row.name); node.setattribute('message', row.message); root.appendchild(node); } }); jaxer.response.exi...
Troubleshooting XForms Forms - Archive of obsolete content
right-click on a blank spot on the page, and select view page info.
...in order to fix this, go to the noscript options dialog (right-click on the 's' icon on the status bar and select 'options...') and select the advanced tab.
XForms Input Element - Archive of obsolete content
specific handling of attributes incremental - if "true", the bound instance node will be updated when the user selects a value from the list.
... specific handling of attributes incremental - if "true", the bound instance node will be updated when the user selects a value from the list.
Visual-js game engine - Game development
1) click create application 2) enter new application name in input prompt 3) select folder for server part of application (important : www is not secure place) 4) select folder for client part of application ( any path in www) 5) new app name will appear in project list , select and click open application 6) open your server folder : install node.js modules one way - use windows bat-s file (in server root folder with prefix install_ ) second way - open cmd terminal and e...
... inserting new code will be always at current line selected intro editor .
Pseudo-class - MDN Web Docs Glossary: Definitions of Web-related terms
in css, a pseudo-class selector targets elements depending on their state rather than on information from the document tree.
... for example, the selector a:visited applies styles only to links that the user has already followed.
SQL Injection - MDN Web Docs Glossary: Definitions of Web-related terms
how it works after entering username and password, behind the gui the sql queries work as follows: "select count(*) from users where username=' " + txt.user.text+" ' and password=' "+ txt.password.text+" ' "; now suppose user enters the username: admin and password: passwd123, so after clicking on the log in button, sql query will run as follows: "select count(*) from users where username=' admin ' and password=' passwd123 ' "; if the credentials are correct, then the user is allowed to log in, s...
... hackers use a simple string called a magical string, for example: username: admin password: anything 'or'1'='1 after clicking on the login button, the sql query will work as follows: "select count(*) from users where username=' admin ' and password=' anything 'or'1'='1 ' "; just take a closer look at the above query's password section.
jQuery - MDN Web Docs Glossary: Definitions of Web-related terms
jquery uses a format, $(selector).action() to assign an element(s) to an event.
... to explain it in detail, $(selector) will call jquery to select selector element(s), and assign it to an event api called .action().
CSS and JavaScript accessibility best practices - Learn web development
"standard" text content structure headings, paragraphs, lists — the core text content of your page: <h1>heading</h1> <p>paragraph</p> <ul> <li>my list</li> <li>has two items.</li> </ul> some typical css might look like this: h1 { font-size: 5rem; } p, li { line-height: 1.5; font-size: 1.6rem; } you should: select sensible font sizes, line heights, letter spacing, etc.
...for example, in our tabbed info box example (see source code) we have three panels of information, but we are positioning them on top of one another and providing tabs that can be clicked to show each one (it is also keyboard accessible — you can alternatively use tab and enter/return to select them).
Accessible multimedia - Learn web development
we will first need to store references to each of the controls — add the following to the top of your javascript file: const playpausebtn = document.queryselector('.playpause'); const stopbtn = document.queryselector('.stop'); const rwdbtn = document.queryselector('.rwd'); const fwdbtn = document.queryselector('.fwd'); const timelabel = document.queryselector('.time'); next, we need to grab a reference to the video/audio player itself — add this line below the previous lines: const player = document.queryselector('video'); this holds a reference to ...
...note that to turn the subtitles on, you need to press the "cc" button and select an option — english, deutsch, or español.
Overflowing content - Learn web development
changing the value of overflow to hide content, or to add scrollbars, is likely to be reserved for a few select use cases.
... previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
The box model - Learn web development
add display: inline-block to the rule with the .links-list a selector, and you will see how it fixes this issue by causing the padding to be respected by other elements.
... previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Flexbox - Learn web development
specifying what elements to lay out as flexible boxes to start with, we need to select which elements are to be laid out as flexible boxes.
... article { flex: 1 200px; } article:nth-of-type(3) { flex: 3 200px; display: flex; flex-flow: column; } next, we select the first <div>.
Legacy layout methods - Learn web development
update the second css rule (with the .wrapper selector) as follows: body { width: 90%; max-width: 980px; margin: 0 auto; } .wrapper { padding-right: 2.08333333%; } not only have we given it a percentage width, we have also added a max-width property in order to stop the layout becoming too wide.
... next, update the fourth css rule (with the .col selector) like so: .col { float: left; margin-left: 2.08333333%; width: 6.25%; background: rgb(255, 150, 150); } now comes the slightly more laborious part — we need to update all our .col.span rules to use percentages rather than pixel widths.
Responsive design - Learn web development
whether the user's screen is greater than a certain width, or a certain resolution) and apply css selectively to style the page appropriately for the user's needs.
...the css for the .container selector will only be applied if these two things are true.
Use CSS to solve common problems - Learn web development
LearnCSSHowto
common use cases basics how to apply css to the dom how to use whitespace in css how to write comments in css how to select elements via element name, class or id how to select elements via attribute name and content how to use pseudo-classes how to use pseudo-elements how to apply multiple selectors to the same rule how to specify colors in css how to debug css in the browser css and text how to style text how to customize a list of elements how to style links how to add shadows to text boxes and layouts how to size css boxes how to control overflowing content how to control the part of a css box that the background is drawn under how do i define inline, block, and inl...
... general how to calculate specificity of a css selector how to control inheritance in css advanced effects how to use filters in css how to use blend modes in css layout using css flexible boxes using css multi-column layouts using css generated content ...
Styling lists - Learn web development
background-position: this defines where in the background of the selected element the image will appear — in this case we are saying 0 0, which means the bullet will appear in the very top left of each list item.
...d;"></textarea> <h2>output</h2> <div class="output" style="width: 90%;height: 12em;padding: 10px;border: 1px solid #0095dd;overflow: auto;"></div> <div class="controls"> <input id="reset" type="button" value="reset" style="margin: 10px 10px 0 0;"> <input id="solution" type="button" value="show solution" style="margin: 10px 0 0 10px;"> </div> </div> var htmlinput = document.queryselector(".html-input"); var cssinput = document.queryselector(".css-input"); var reset = document.getelementbyid("reset"); var htmlcode = htmlinput.value; var csscode = cssinput.value; var output = document.queryselector(".output"); var solution = document.getelementbyid("solution"); var styleelem = document.createelement('style'); var headelem = document.queryselector('head'); headelem.appendchild(st...
Web fonts - Learn web development
to select a font family, press the ⊕ button alongside it.
... when you've chosen the font families, press the [number] families selected bar at the bottom of the page.
What text editors are available? - Learn web development
ings configure any available plugins and investigate how to get new ones change color schemes adjust view settings and see how you can change the layout of the views check what programming languages/technologies your editor supports while you're learning the default settings of most text editors should be fine to use, but it is important to become familiar with your chosen tools, so you can select the best one for your usage.
...these functionalities are often helpful: search-and-replace, in one or multiple documents, based on regular expressions or other patterns as needed quickly jump to a given line view two parts of a large document separately view html as it will look in the browser select text in multiple places at once view your project's files and directories format your code automatically with code beautifier check spelling auto-indent code based on indentation settings do i want to add extra features to my text editor?
How do you host your website on Google App Engine? - Learn web development
if you've not created a project before, you'll need to select whether you want to receive email updates or not, agree to the terms of service, and then you should be able to continue.
... run the following in the command line to select your project: gcloud config set project gaesamplesite then run the following command to go to your app's directory: cd sample-app you are now ready to deploy your application, i.e.
Sending form data - Learn web development
select "network" select "all" select "foo.com" in the "name" tab select "headers" you can then get the form data, as shown in the image below.
... include one or more <input type="file"> controls to allow your users to select the file(s) that will be uploaded.
Test your skills: Basic controls - Learn web development
turn the first <fieldset>'s contents into a set of radio buttons — you should only be able to select one pony character at once.
... make it so that the first radio button is selected upon page load.
Test your skills: Other controls - Learn web development
other controls 2 now it's time to have a go at implementing a drop-down select menu, to allow a user to pick their favourite food from the choices provided.
... create your basic select box structure.
Adding vector graphics to the Web - Learn web development
" disabled> </div> html { font-family: sans-serif; } h2 { font-size: 16px; } .a11y-label { margin: 0; text-align: right; font-size: 0.7rem; width: 98%; } body { margin: 10px; background: #f5f9fa; } const textarea = document.getelementbyid('code'); const reset = document.getelementbyid('reset'); const solution = document.getelementbyid('solution'); const output = document.queryselector('.output'); let code = textarea.value; let userentry = textarea.value; function updatecode() { output.innerhtml = textarea.value; } reset.addeventlistener('click', function() { textarea.value = code; userentry = textarea.value; solutionentry = htmlsolution; solution.value = 'show solution'; updatecode(); }); solution.addeventlistener('click', function() { if(solution.value === ...
...ventlistener('load', updatecode); // stop tab key tabbing out of textarea and // make it write a tab at the caret position instead textarea.onkeydown = function(e){ if (e.keycode === 9) { e.preventdefault(); insertatcaret('\t'); } if (e.keycode === 27) { textarea.blur(); } }; function insertatcaret(text) { const scrollpos = textarea.scrolltop; const caretpos = textarea.selectionstart; const front = (textarea.value).substring(0, caretpos); const back = (textarea.value).substring(textarea.selectionend, textarea.value.length); textarea.value = front + text + back; caretpos = caretpos + text.length; textarea.selectionstart = caretpos; textarea.selectionend = caretpos; textarea.focus(); textarea.scrolltop = scrollpos; } // update the saved usercode every ...
Responsive images - Learn web development
this is the image's real size, which can be found by inspecting the image file on your computer (for example, on a mac you can select the image in finder and press cmd + i to bring up the info screen).
... note: when testing this with a desktop browser, if the browser fails to load the narrower images when you've got its window set to the narrowest width, have a look at what the viewport is (you can approximate it by going into the browser's javascript console and typing in document.queryselector('html').clientwidth).
HTML table basics - Learn web development
LearnHTMLTablesBasics
these exist because it can be a bit annoying and inefficient having to specify styling on columns — you generally have to specify your styling information on every <td> or <th> in the column, or use a complex selector such as :nth-child().
...to set other properties you'll have to either style every <td> or <th> in the column, or use a complex selector such as :nth-child().
Cooperative asynchronous JavaScript: Timeouts and intervals - Learn web development
const spinner = document.queryselector('div'); let rotatecount = 0; let starttime = null; let raf; below the previous code, insert a draw() function that will be used to contain our animation code, which includes the timestamp parameter: function draw(timestamp) { } inside draw(), add the following lines.
... inside the empty <script> element on your page, start by adding the following lines of code that define some constants and variables you'll need in the rest of the code: const spinner = document.queryselector('.spinner p'); const spinnercontainer = document.queryselector('.spinner'); let rotatecount = 0; let starttime = null; let raf; const btn = document.queryselector('button'); const result = document.queryselector('.result'); in order, these are: a reference to the spinner, so you can animate it.
Client-side storage - Learn web development
add the following lines to your javascript file: // create needed constants const rememberdiv = document.queryselector('.remember'); const forgetdiv = document.queryselector('.forget'); const form = document.queryselector('form'); const nameinput = document.queryselector('#entername'); const submitbtn = document.queryselector('#submitname'); const forgetbtn = document.queryselector('#forgetname'); const h1 = document.queryselector('h1'); const personalgreeting = document.queryselector('.personal-greeting'); ...
... select file > work offline if you are using firefox.
Drawing graphics - Learn web development
add the following code into it, just below the opening <body> tag: <canvas class="mycanvas"> <p>add suitable fallback here.</p> </canvas> we have added a class to the <canvas> element so it will be easier to select if we have multiple canvases on the page, but we have removed the width and height attributes for now (you could add them back in if you wanted, but we will set them using javascript in a below section).
... now add the following lines of javascript inside the <script> element: const canvas = document.queryselector('.mycanvas'); const width = canvas.width = window.innerwidth; const height = canvas.height = window.innerheight; here we have stored a reference to the canvas in the canvas constant.
Third-party APIs - Learn web development
const audioelement = document.queryselector('audio'); ...
... let's request a key for the article search api — create a new app, selecting this as the api you want to use (fill in a name and description, toggle the switch under the "article search api" to the on position, and then click "create").
Video and Audio APIs - Learn web development
next we use generated content to display an icon on each button: we use the ::before selector to display the content before each <button> element.
... at the top of this file, insert the following code: const media = document.queryselector('video'); const controls = document.queryselector('.controls'); const play = document.queryselector('.play'); const stop = document.queryselector('.stop'); const rwd = document.queryselector('.rwd'); const fwd = document.queryselector('.fwd'); const timerwrapper = document.queryselector('.timer'); const timer = document.queryselector('.timer span'); const timerbar = document.queryselector('.t...
Basic math in JavaScript — numbers and operators - Learn web development
for example, booleans can be used to: display the correct text label on a button depending on whether a feature is turned on or off display a game over message if a game is over or a victory message if the game has been won display the correct seasonal greeting depending what holiday season it is zoom a map in or out depending on what zoom level is selected we'll look at how to code such logic when we look at conditional statements in a future article.
... for now, let's look at a quick example: <button>start machine</button> <p>the machine is stopped.</p> const btn = document.queryselector('button'); const txt = document.queryselector('p'); btn.addeventlistener('click', updatebtn); function updatebtn() { if (btn.textcontent === 'start machine') { btn.textcontent = 'stop machine'; txt.textcontent = 'the machine has started!'; } else { btn.textcontent = 'start machine'; txt.textcontent = 'the machine is stopped.'; } } open in new window you can see the equality operator being used just inside the updatebtn() function.
Silly story generator - Learn web development
in this block we are saying "if a value has been entered into the customname text input, replace bob in the story with that custom name." inside the second if block, we are checking to see if the uk radio button has been selected.
...the following for example turns the background of the <html> element red — so the entire browser window should go red if the javascript is applied properly: document.queryselector('html').style.backgroundcolor = 'red'; math.round() is a built-in javascript method that simply rounds the result of a calculation to the nearest whole number.
JavaScript object basics - Learn web development
instead of using these: person.age person.name.first you can use person['age'] person['name']['first'] this looks very similar to how you access the items in an array, and it is basically the same thing — instead of using an index number to select an item, you are using the name associated with each member's value.
... when you accessed the document object model using lines like this: const mydiv = document.createelement('div'); const myvideo = document.queryselector('video'); you were using methods available on an instance of the document class.
Working with JSON - Learn web development
inside the powers property is an array containing the selected hero's superpowers.
...at the moment it only contains two lines, which grab references to the <header> and <section> elements and store them in variables: const header = document.queryselector('header'); const section = document.queryselector('section'); we have made our json data available on our github, at https://mdn.github.io/learning-area/javascript/oojs/json/superheroes.json.
Client-Server Overview - Learn web development
this discussion is however still very relevant, because the described behaviour must be implemented by your server-side code, irrespective of which programming language or web framework you select.
...in order to "keep things real" we'll use the context of a sports-team manager website where a coach can select their team name and team size in an html form and get back a suggested "best lineup" for their next game.
React interactivity: Editing, filtering, conditional rendering - Learn web development
when you press a filter button, you should see its text take on a new outline — this tells you it has been selected.
...a task should only render if it is included in the results of applying the selected filter.
TypeScript support in Svelte - Learn web development
it should end up looking like this: // actions.ts export function selectonfocus(node: htmlinputelement) { if (node && typeof node.select === 'function' ) { // make sure node is defined and has a select() method const onfocus = () => node.select() // event handler node.addeventlistener('focus', onfocus) // when node gets focus call onfocus() return { destroy: () => node.removeeventlistene...
...in each case it should end up like this: import { selectonfocus } from '../actions' migrating the stores to typescript now we have to migrate the stores.js and localstore.js files to typescript.
Componentizing our Svelte app - Learn web development
you'll notice that when you click on the filter buttons, they are selected and the style updates appropriately.
...whenever the user clicks on any filter button, the child will call the onclick handler, passing the selected filter as a parameter, back up to its parent.
Styling Vue components with CSS - Learn web development
rgin-bottom: 0; } ul { list-style: none; padding: 0; } button { border: none; margin: 0; padding: 0; width: auto; overflow: visible; background: transparent; color: inherit; font: inherit; line-height: normal; -webkit-font-smoothing: inherit; -moz-osx-font-smoothing: inherit; -webkit-appearance: none; } button::-moz-focus-inner { border: 0; } button, input, optgroup, select, textarea { font-family: inherit; font-size: 100%; line-height: 1.15; margin: 0; } button, input { /* 1 */ overflow: visible; } input[type="text"] { border-radius: 0; } body { width: 100%; max-width: 68rem; margin: 0 auto; font: 1.6rem/1.25 "helvetica neue", helvetica, arial, sans-serif; background-color: #f5f5f5; color: #4d4d4d; -moz-osx-font-smoothing: grayscale; -...
...this is where the scoped attribute can be useful — this attaches a unique html data attribute selector to all of your styles, preventing them from colliding globally.
Accessibility information for UI designers and developers
this includes form elements like inputs and select boxes, but also buttons.
...for example, the select element displays an ideal mobile interface on mobile operating systems like android and ios.
CSUN Firefox Materials
browse with caret allows users to select arbitrary content with the keyboard and move through content as if inside a read-only editor.
...you can even select web content and copy it to the clipboard.
Software accessibility: Where are we today?
select text, pictures, and other information using a mouse react to sounds played.
...de: screen reading software, which speaks text displayed on the screen using hardware or software text-to-speech, and which allows a blind person to use the keyboard to simulate mouse actions alternate input devices, which allow people with physical disabilities to use alternatives to a keyboard and mouse voice recognition software, which allows a person to simulate typing on a keyboard or selecting with a mouse by speaking into the computer screen magnification software, which allows a low-vision computer user to more easily read portions of the screen comprehension software, which allows a dyslexic or learning disabled computer user to see and hear text as it is manipulated on the computer screen in fact, the entire adaptive technology industry has grown up around these issues.
Capturing a minidump
from the menu, select debug → go, and firefox should start.
... if the debugger spits out some text right away and firefox doesn't come up, select debug → go again.
Windows SDK versions
note that if you're running a 64 bit version of windows you may require the "amd" version of the sdk even if you have an intel processor, and you may need to deselect the documentation component in the installer in order to avoid an installation error.
...try the following things in order: run the windows sdk configuration tool (if available) and make sure the right sdk is selected.
Obsolete Build Caveats and Tips
see the chart at the top of this page to ensure that the version you've selected is compatible with the branch you want to build.
... if you are building mozilla source code from before firefox 5, then you must first select the mozilla application that you want to build (see below), and you will probably also need to set at least some of the other basic configuration options (such as whether to build a debug build or not) to get the type of build that you need.
Experimental features in Firefox
nightly 72 no developer edition 72 no beta 72 no release 72 no preference name devtools.inspector.color-scheme-simulation.enabled execution context selector this feature displays a button on the console's command line that lets you change the context in which the expression you enter will be executed.
... nightly 75 no developer edition 75 no beta 75 no release 75 no preference name devtools.webconsole.input.context mobile gesture support in responsive design mode mouse gestures are used to simulate mobile gestures like swiping/scrolling, double-tap and pinch-zooming and long-press to select/open the context menu.
Frame script loading and lifetime
this line of code loads a frame script into the currently selected tab.
... the script just writes "foo" to the command line: // chrome script var mm = gbrowser.selectedbrowser.messagemanager; mm.loadframescript('data:,dump("foo\\n")', true); loadframescript() takes two mandatory parameters: a url that points to the frame script you want to load a boolean flag, allowdelayedload note: if the message manager is a global frame message manager or a window message manager, loadframescript() may load the script multiple times, once in each applicable frame.
Performance
ript or jsm instead load frame scripts on demand bad: // addon.js services.mm.loadframescript("framescript.js", /*delayed:*/ true) // stuff communicating with the framescript // framescript.js function onlyonceinabluemoon() { // we only need this during a total solar eclipse while goat blood rains from the sky sendasyncmessage('my-addon:paragraph-count', {num: content.document.queryselectorall('p').length}) } addmessagelistener("my-addon:request-from-parent", onlyonceinabluemoon) better: // addon.js function ontoolbarbutton(event) { let tabmm = gbrowser.mcurrentbrowser.frameloader.messagemanager; let button = event.target; let callback = (message) => { tabmm.removemessagelistener("my-addon:paragraph-count", callback) decoratebutton(button, message.data.num) } ...
...tabmm.addmessagelistener("my-addon:paragraph-count", callback); tabmm.loadframescript("data:,sendasyncmessage('my-addon:paragraph-count', {num: content.document.queryselectorall('p').length})", false) } function decoratebutton(button, count) { // do stuff with result } this executes the script only when it is needed and only in one tab and allows it to be garbage-collected immediately after execution.
Browser API
mozbrowsercaretstatechanged sent when the text selected inside the browser <iframe> content changes.
... mozbrowserselectionstatechanged sent when the text selected inside the browser <iframe> content changes.
Chrome-only CSS reference
MozillaGeckoChromeCSS
it only works in chrome code, and only on mac os x.:-moz-lwthemethe :-moz-lwtheme pseudo-class matches in chrome documents when the root element's lightweightthemes attribute is true and a theme is selected.:-moz-lwtheme-brighttextthe :-moz-lwtheme-brighttext pseudo-class matches in chrome documents when :-moz-lwtheme is true and a lightweight theme with a bright text color is selected.:-moz-lwtheme-darktextthe :-moz-lwtheme-darktext pseudo-class matches in chrome documents when :-moz-lwtheme is true and a lightweight theme with a dark text color is selected.::-moz-tree-cellactivated by the proper...
... ::-moz-tree-rowthe ::-moz-tree-row css pseudo-element is used to select rows and apply styles to tree rows.::-moz-tree-row(hover)the ::-moz-tree-row(hover) css pseudo-class will match an element if the mouse cursor is presently hovering over a tree row.::-moz-tree-separatoractivated by the properties attribute.::-moz-tree-twistyactivated by the properties attribute.css -moz-bool-pref() @supports functionthe -moz-bool-pref() @supports condition is available to gecko c...
Overview of Mozilla embedding APIs
this interface supports cut/copy/paste operations on the current selection within the webbrowser window.
...interface definition: nsiselection interface status...
Gecko Keypress Event
that is, when the currently selected keyboard layout produces a unicode character (according to the current state of capslock and numlock), the charcode property contains that character.
...this makes it impossible for users to distinguish between accesskeys using two different characters on the same key (when the shift modifier is usually used to select one of the characters).
How to implement a custom autocomplete search component
* * @return {number} the result code of this result object, either: * result_ignored (invalid searchstring) * result_failure (failure) * result_nomatch (no matches found) * result_success (matches found) */ get searchresult() { return this._searchresult; }, /** * @return {number} the index of the default item that should be entered if * none is selected */ get defaultindex() { return this._defaultindex; }, /** * @return {string} description of the cause of a search failure */ get errordescription() { return this._errordescription; }, /** * @return {number} the number of matches */ get matchcount() { return this._results.length; }, /** * @return {string} the value of the result at the given ind...
...rchstring; }, /** * the result code of this result object, either: * result_ignored (invalid searchstring) * result_failure (failure) * result_nomatch (no matches found) * result_success (matches found) */ get searchresult() { return this._searchresult; }, /** * index of the default item that should be entered if none is selected */ get defaultindex() { return this._defaultindex; }, /** * a string describing the cause of a search failure */ get errordescription() { return this._errordescription; }, /** * the number of matches */ get matchcount() { return this._results.length; }, /** * get the value of the result at the given index */ getvalueat: function(index) { ...
How to Report a Hung Firefox
another way to trigger a crash in a hung tab is to run the following script in the browser console (opened after selecting the hung tab): let wm = cc["@mozilla.org/appshell/window-mediator;1"].
... getservice(ci.nsiwindowmediator); let win = wm.getmostrecentwindow("navigator:browser"); let browser = win.gbrowser.selectedbrowser; if (browser.isremotebrowser) { browser.messagemanager.loadframescript('data:,let appinfo = components.classes["@mozilla.org/xre/app-info;1"];if (appinfo && appinfo.getservice(components.interfaces.nsixulruntime).processtype != components.interfaces.nsixulruntime.process_type_default) {components.utils.import("resource://gre/modules/ctypes.jsm");var zero = new ctypes.intptr_t(8);var badptr = ctypes.cast(zero, ctypes.pointertype(ctypes.int32_t));var crash = badptr.contents;}', true); } other techniques on os x if you use a nightly build (>= firefox 16), you can use activity monitor's "sample process" feature to generate a sample.
CustomizableUI.jsm
ithin_customizableui_and_dom', defaultarea: customizableui.area_navbar, label: 'my widget', // type: 'button', //we don't need to type this, the default type is button tooltiptext: 'this is my widget created with cui.jsm', oncommand: function(aevent) { var thisdomwindow = aevent.target.ownerdocument.defaultview; //this is the browser (xul) window var thiswindowsselectedtabswindow = thisdomwindow.gbrowser.selectedtab.linkedbrowser.contentwindow; //this is the html window of the currently selected tab thiswindowsselectedtabswindow.alert('alert from html window of selected tab'); thisdomwindow.alert('alert from xul window'); } }); giving the button an icon non-style sheet method the style sheet method (below) is one way to add an icon.
...ithin_customizableui_and_dom', defaultarea: customizableui.area_navbar, label: 'my widget', // type: 'button', //we don't need to type this, the default type is button tooltiptext: 'this is my widget created with cui.jsm', oncommand: function(aevent) { var thisdomwindow = aevent.target.ownerdocument.defaultview; //this is the browser (xul) window var thiswindowsselectedtabswindow = thisdomwindow.gbrowser.selectedtab.linkedbrowser.contentwindow; //this is the html window of the currently selected tab thiswindowsselectedtabswindow.alert('alert from html window of selected tab'); thisdomwindow.alert('alert from xul window'); } }); //end - use customizableui.jsm to create the widget //start - use style sheet service to style our widget to give...
Mozilla Content Localized in Your Language
for example, "cancel", "clear history", "add email", "select all", etc.
... value selector lists capitalize the first letter of the first word and the first letter of any proper nouns.
Patching a Localization
alternatively, you can select specific files for diff to evaluate and print (see below).
... the command will only print the differences found in the selected files.
Release phase
you've setup up your local and remote environments, you've selected your l10n tools and projects, done some localization and even some testing!
... in the attachment details, select the ?
Creating localizable web applications
this is useful to add minor corrective rules to the css that apply only for selected locales.
...in general though, we should consider implementing such decorations as css images (background-image or ::after's/::before's content) and then select them with "html[dir="rtl"] > ...".
Fonts for Mozilla 2.0's MathML engine
mathml font selection with css you can get these fonts from the mathml-fonts add-on ; the xpi is just a zip archive that you can fetch and extract for example with the following command: wget https://addons.mozilla.org/firefox/downloads/latest/367848/addon-367848-latest.xpi -o mathml-fonts.zip; \ unzip mathml-fonts.zip -d mathml-fonts then copy the mathml-fonts/resource/ directory somewhere on your web site and ens...
...for example to force the use of stix fonts: math { font-family: stixgeneral; } ::-moz-math-stretchy { font-family: stixnonunicode, stixsizeonesym, stixsize1, stixgeneral; } try the mathml torture test to compare the rendering of various fonts and the css rules to select them.
MathML Torture Test
mathml torture test html content <p> render mathematics with: <select name="mathfont" id="mathfont"> <option value="default" selected="selected">default fonts</option> <option value="asana">asana</option> <option value="cambria">cambria</option> <option value="dejavu">dejavu</option> <option value="latinmodern">latin modern</option> <option value="libertinus">libertinus</option> <option value="lucidabright">lucida bright</option> <option value="minion">minion</option> <option value="stixtwo">stix two</option> <option value="texgyrebonum">tex gyre bonum</option> <option value="texgyrepagella">tex gyre pagella</option> <option value="texgyreschola">tex gyre schola</option> <option value="texgyretermes">tex gyre termes</option> ...
...<option value="xits">xits</option> </select> <br/> </p> <table> <tr> <td></td> <th scope="col">as rendered by tex</th> <th scope="col">as rendered by your browser</th></tr> <tr> <td>1</td> <td><img src="https://udn.realityripple.com/samples/45/d5a0dbbca3.png" width="38" height="22" alt="texbook, 16.2-16.3" /></td> <td> <math display="block"> <mrow> <msup> <mi>x</mi> <mn>2</mn> </msup> <msup> <mi>y</mi> <mn>2</mn> </msup> </mrow> </math> </td></tr> <tr> <td>2</td> <td><img src="https://udn.realityripple.com/samples/b8/da4a50ea34.png" width="30" height="17" alt="texbook, 16.2-16.3" /></td> <td> <math display="block"> ...
Mozilla Web Developer FAQ
the element selectors are case-sensitive with xml.
... css selectors are case-sensitive.
Profiling with Instruments
official apple documentation instruments user guide instruments user reference instruments help articles instruments help performance overview basic usage select "time profiler" from the "choose a profiling template for:" dialog.
...click "all processes" and select "firefox" from the "running applications" section.
Profiling with Xperf
make sure you select the trace -> load symbols menu option in the windows performance analyzer (xperfview).
... these refer to the time range that was selected for the summary graph; for example, something that's in the aofi category was allocated before the start of the selected time range, but the free event happened inside.
Reporting a Performance Problem
press ctrl+shift+2 or click on the profiler toolbar icon in the top right and select 'capture'.
... make sure you are selecting the process that is using up the cpu since all of the processes are shown.
about:memory
if you do not wish to share this information, you can select the "anonymize" checkbox before clicking on "measure and save..." or "measure...".
...if you select the "verbose" checkbox before measuring, all trees will be shown fully expanded and no artificial nodes will be inserted.
A guide to searching crash reports
by default, the "signature facet" tab is selected.
... select "new line", and then choose a field ("is garbage collecting") and an operator ("is true").
L20n Javascript API
ctx.localize(['hello', 'new'], function(l10n) { var node = document.queryselector('[data-l10n-id=hello]'); node.textcontent = l10n.entities.hello.value; node.classlist.remove('hidden'); }); ctx.registerlocales(defaultlocale: string?, availablelocales: array<string>?) register the default locale of the context instance, as well as all other locales available to the context instance before the language negotiation.
... ctx.localize(['hello', 'about'], function(l10n) { var node = document.queryselector('[data-l10n-id=hello]'); node.textcontent = l10n.entities.hello.value; node.classlist.remove('hidden'); }); the callback becomes bound to the entities on the ids list.
Logging
you can select events to be logged by module or level.
...you can combine module and level criteria to get highly selective logging.
NSS Certificate Download Specification
for nss-based servers it will depend upon the options selected in the server's administration interface.
...server or ca or cert chain) is specified by the server administrator by selections made on the admin pages.
NSS 3.20 release notes
a new api ssl_dhegroupprefset has been added to nss, which allows a server application to select one or multiple of the embedded dhe parameters as the preferred parameters.
...in future versions of the tls implementation, a tls client might show a preference for certain dhe parameters, and the nss tls server side implementation might select a matching entry from the set of parameters that have been configured as preferred on the server side.
NSS 3.35 release notes
in order to ease transitions, experimental functions return secfailure and set the ssl_error_unsupported_experimental_api code if the selected api is not available.
... feedback bugs discovered should be reported by filing a bug report with bugzilla.mozilla.org (select product 'nss').
NSS API Guidelines
the pkcs11wrap library provides functions for selecting/finding pkcs #11 modules and slots.
... it also provides functions that invoke operations in selected modules and slots, such as key selection and generation, signing, encryption and decryption, etc.
NSS tools : certutil
certutil prompts for the certificate constraint extension to select.
... the certificate database tool will prompt you to select the authority key id extension.
certutil
certutil prompts for the certificate constraint extension to select.
...the certificate database tool will prompt you to select the authority key id extension.
JS_NewObject
the javascript engine selects a prototype object for you.
... choosing a default prototype like many jsapi functions, js_newobject selects an appropriate prototype for the newly created object if you don't supply one yourself.
Parser API
interface xmlattributeselector <: expression { type: "xmlattributeselector"; attribute: expression; } an e4x attribute selector expression, i.e., an @ expression.
... xmlattributeselector(expr[, loc]) expr: customexpression loc: sourcelocation returns: customxml/customexpression callback to produce a custom xml attribute selector node.
Running Automated JavaScript Tests
or you can run all but selected tests with the --exclude option.
...basic usage is the same: jit_test.py path_to_js_shell developers will usually want to run like this to skip the slow tests and cover the most important options: jit_test.py --no-slow path_to_js_shell you can select specific tests to run in the same way as the jstests shell harness.
Secure Development Guidelines
that is similar to xss but targeted at sql rather than html and javascript if input is mixed with sql, it could itself become an sql instruction and be used to: query data from the database (passwords) insert value into the database (a user account) change application logic based on results returned by the database sql injection: example snprintf(str, sizeof(str), "select * from account where name ='%s'", name); sqlite3_exec(db, str, null, null, null); sql injection: prevention use parameterized queries insert a marker for every piece of dynamic content so data does not get mixed with sql instructions example: sqlite3_stmt *stmt; char *str = "select * from account where name='?'"; sqlite3_prepare_v2(db, str, strlen(str), &stmt, null); sqlite3_bind_t...
...handles could be a race if instances of fh are shared between threads fh inheritence: default in unix, needs to be set in windows int main(int argc, char **argv, char **envp) { int fd = open("/etc/shadow", o_rdwr); setreuid(getuid(), getuid()); excve("/bin/sh", argv, envp); } suid root applications file i/o: file descriptors and handles potential overflows when using select fd_set struct, static length, holds a bitmask of fds manipulated with fd_set, fd_isset, fd_clr and fd_zero macros fd_set’s size depends on the operating system if the os allows opening more fds, then fd_set can hold could overflow fd_set file i/o: file descriptors and handles good solution: dynamically allocate fd_set structs int main(void) { int i, fd; fd_set fdset; for...
Using the Places history service
a session is ended when a new url is typed in or selected from bookmarks.
...this will cause the transition type of the next visit of the url to be marked as "typed." nsinavhistoryservice.markpageasfollowedbookmark: called by the ui (implemented, but not yet called, see bug 409301) when the user selects a bookmark.
Using XPCOM Components
when a user selects one of the cookies displayed in the list and then clicks the remove button, the remove method in the nsicookiemanager interface is called.
... the function is carried out by the cookiemanager component, and the selected cookie is deleted from disk and removed from the displayed list.
Components.utils.Sandbox
example of obtaining content principal from the window: var principal = gbrowser.selectedtab.linkedbrowser.contentprincipal; var sandbox = components.utils.sandbox(principal); expanded principal an expanded principal is specified as an array of the principals it subsumes.
...for example the content principal above can be made expanded/extended like so: var principal = [gbrowser.selectedtab.linkedbrowser.contentprincipal]; // this is now an expanded (aka extended) principal var sandbox = components.utils.sandbox(principal); null principal you can create a null principal using code like: cc["@mozilla.org/nullprincipal;1"].createinstance(ci.nsiprincipal); from firefox 37 onwards, you can also specify the null principal by simply passing null as the principal argument.
Components.utils.evalInWindow
example suppose a page script defines a variable: // page-script.js var somelocalvariable = { name: "selection1", node: document.documentelement }; an add-on script or other privileged script can access the variable using evalinwindow(): // add-on-script.js var result = components.utils.evalinwindow("somelocalvariable", contentwindow); console.log(result); // {"name":"selection1","node":{}} the add-on code can modify the variable as well, of course: // add-on-script.js components.utils.evalinwindow...
...if the returned object contains a function, calls to evalinwindow() will throw an error: // page-script.js function bar() { } var somelocalvariablecontainingafunction = {name: "selection1", foo : bar}; // add-on-script.js components.utils.evalinwindow("somelocalvariablecontainingafunction", contentwindow); // error, function can't be cloned ...
Observer Notifications
profile-do-change this is fired after the profile has been selected.
... lightweight-theme-styling-update json sent when the current theme being used is changed; this is sent even when the user is previewing a theme, not just when the theme is actually selected.
mozISpellCheckingEngine
this will be either element from the array returned by getdictionarylist() or an empty string if no dictionary is selected.
...if the dictionary was set to "no dictionary" (that is, by specifying an empty string), the observer may select another dictionary before returning.
mozIStorageAggregateFunction
let stmt = dbconn.createstatement("select stddev(value) from some_table"); try { while (stmt.executestep()) { // handle the results } } finally { stmt.reset(); } c++ // first, create our class that will represent our function.
...nscomptr<mozistoragestatement> stmt; rv = dbconn->createstatement(ns_literal_cstring( "select stddev(value) from some_table"), getter_addrefs(stmt) ); ns_ensure_success(rv, rv); prbool hasmore; while (ns_succeeded(stmt->executestep(&hasmore)) && hasmore) { // handle the results } ...
nsIAccessibleHyperText
inherits from: nsisupports last changed in gecko 1.9 (firefox 3) method overview nsiaccessiblehyperlink getlink(in long linkindex); long getlinkindex(in long charindex); long getselectedlinkindex(); obsolete since gecko 1.9 attributes attribute type description linkcount long the number of links contained within this hypertext object.
... getselectedlinkindex() obsolete since gecko 1.9 (firefox 3) long getselectedlinkindex(); parameters none.
nsIAuthPrompt
one of the save_password_* constants pwd the password entered by the user if ok was selected.
... pwd the password entered by the user if ok was selected.
nsIMsgSearchSession
searchscopes(); void getnthsearchscope(in long which,out nsmsgsearchscopevalue scopeid, out nsimsgfolder folder); void addscopeterm(in nsmsgsearchscopevalue scope, in nsimsgfolder folder); void adddirectoryscopeterm(in nsmsgsearchscopevalue scope); void clearscopes(); [noscript] boolean scopeusescustomheaders(in nsmsgsearchscopevalue scope, in voidptr selection, in boolean forfilters); boolean isstringattribute(in nsmsgsearchattribvalue attrib); void addallscopes(in nsmsgsearchscopevalue attrib); void search(in nsimsgwindow awindow); void interruptsearch(); void pausesearch(); void resumesearch(); [noscript] nsmsgsearchtype setsearchparam(in nsmsgsearchtype type, in voidptr param); ...
... [noscript] boolean scopeusescustomheaders(in nsmsgsearchscopevalue scope, in voidptr selection, in boolean forfilters); parameters scope selection could be a folder or server based on scope forfilters isstringattribute() use this to determine if your attribute is a string attribute.
nsIProtocolProxyFilter
netwerk/base/public/nsiprotocolproxyfilter.idlscriptable this interface is used to apply filters to the proxies selected for a given uri.
... 1.0 66 introduced gecko 1.8 inherits from: nsisupports last changed in gecko 1.8 (firefox 1.5 / thunderbird 1.5 / seamonkey 1.0) this interface is used to apply filters to the proxies selected for a given uri.
nsISound
event_select_dialog_open 4 a select dialog (one that contains a list box) is opened.
... _moz_selectdialog the system sound when a select dialog (one that contains a list box) is opened.
nsITreeColumn
selectable boolean if true the nsitreecolumn is able to be selected.
... if the selectable attribute is not set, the column cells are not selectable.
nsIUpdatePatch
selected boolean true if this patch is currently selected as the patch to be downloaded and installed for this update transaction.
... false if another update is selected.
nsIWindowMediator
important: this will attach the functionality to future opened windows, so if you copy paste this code to scratchpad, then after running this script, you need to open a new window by pressing ctrl + n and then in the new window, selecting tabs will fire the alert.
...yinterface(ci.nsiinterfacerequestor).getinterface(ci.nsidomwindowinternal || ci.nsidomwindow); domwindow.addeventlistener("load", function () { domwindow.removeeventlistener("load", arguments.callee, false); //this removes this load function from the window //window has now loaded now do stuff to it //as example this will add a function to listen to tab select and will fire alert in that window if (domwindow.gbrowser && domwindow.gbrowser.tabcontainer) { domwindow.gbrowser.tabcontainer.addeventlistener('tabselect', function () { domwindow.alert('tab was selected') }, false); } }, false); }, onclosewindow: function (awindow) {}, onwindowtitlechange: function ...
nsIZipWriter
it will then recursively go through all contents in the folder selected and add them into this zip file.
...createinstance(ci.nsizipwriter); var pr = {pr_rdonly: 0x01, pr_wronly: 0x02, pr_rdwr: 0x04, pr_create_file: 0x08, pr_append: 0x10, pr_truncate: 0x20, pr_sync: 0x40, pr_excl: 0x80}; //https://developer.mozilla.org/docs/pr_open#parameters var fu = cu.import('resource://gre/modules/fileutils.jsm').fileutils; var fp = cc['@mozilla.org/filepicker;1'].createinstance(ci.nsifilepicker); fp.init(window, 'select directory to compile', ci.nsifilepicker.modegetfolder); fp.appendfilters(ci.nsifilepicker.filterall | ci.nsifilepicker.filtertext); var rv = fp.show(); if (rv == ci.nsifilepicker.returnok) { var dir = fp.file; //dir must exist, as the user selected it.
Index
if you are on mac os x, and on linux do edit > preferences on, select the advanced options panel, click on the general tab, and click on config editor.
...to do this you need to capture the select event of the folder [[xul:tree|tree]] whose id is (conveniently) foldertree like so: 103 filter incoming mail filter, incoming, mails, thunderbird to filter incoming mail, the first step is to detect new messages inconming.
customDBHeaders Preference
(amsgfolder, atopic, adata) { dump("here here!"); addcustomcolumnhandler(); } } function doonceloaded(){ var observerservice = components.classes["@mozilla.org/observer-service;1"].getservice(components.interfaces.nsiobserverservice); observerservice.addobserver(createdbobserver, "msgcreatedbview", false); window.document.getelementbyid('foldertree').addeventlistener("select",addcustomcolumnhandler,false); } window.addeventlistener("load",doonceloaded,false); dump(" ~ ~ ~ ~ end superfluous ~ ~ ~ ~ \n"); important be aware that only messages that are added to the .msf database after the customdbheaders pref is set will have the corresponding string property set on the msghdr.
... the attaching of the column handler through the observerservice object is some pretty new stuff, so i was using the addeventlistener("select"...) stuff as a backup.
WebIDL bindings
the type of the enum class is automatically selected to be the smallest unsigned integer type that can hold all the values.
...this allows the method implementation to select which compartment it cares about in its checks.
Standard OS Libraries
to call objective-c based api from ctypes, use the following functions in libobjc.dylib: objc_getclass to get class sel_registername to register selector name objc_msgsend and some variants to send message to class and instance objective-c code can be translated into c code by the following rule: // objective-c code nsevent loc = [nsevent mouselocation]; // pseudo c code nsevent loc = (nspoint)objc_msgsend(objc_getclass("nsevent"), sel_registername("mouselocation")); example: [nsevent mouselocation] co...
...mponents.utils.import("resource://gre/modules/ctypes.jsm"); let objc = ctypes.open(ctypes.libraryname("objc")); let id = ctypes.structtype("objc_object").ptr; let sel = ctypes.structtype("objc_selector").ptr; let objc_getclass = objc.declare("objc_getclass", ctypes.default_abi, id, ctypes.char.ptr); let sel_registername = objc.declare("sel_registername", ctypes.default_abi, sel, ctypes.char.ptr); let objc_msgsend = objc.declare("objc_msgsend", ctypes.default_abi, id, id, ...
3D view - Firefox Developer Tools
conversely, you can click on elements in the breadcrumb bar to change which element is selected in the 3d view.
... function keyboard mouse zoom in/out + / - scroll wheel up/down rotate left/right a / d mouse left/right rotate up/down w / s mouse up/down pan left/right ← / → mouse left/right pan up/down ↑ / ↓ mouse up/down reset zoom level 0 resets the zoom level to the default focus on selected node f makes sure the currently selected node is visible reset view r resets zoom, rotation, and panning to the default hide current node x makes the currently selected node invisible; this can be helpful if you need to get at a node that's obscured use cases for the 3d view there are a variety of ways the 3d view is useful: if you have broken h...
DOM Property Viewer - Firefox Developer Tools
the dom property viewer lets you inspect the properties of the dom as an expandable tree structure, starting from the window object of the current page or the selected iframe.
... opening the dom property viewer once enabled, you can open the dom property viewer by selecting "dom" from the web developer submenu in the firefox menu panel (or tools menu if you display the menu bar or are on macos), or by pressing its ctrl + shift + w keyboard shortcut.
Break on DOM mutation - Firefox Developer Tools
click on the icon following the node name to go back to the page inspector with the node selected.
...in the following example, the selected node (the unordered list) is modified by adding a new child node.
Open the debugger - Firefox Developer Tools
there are three ways to open the debugger: select "debugger" from the web developer submenu in the firefox menu (or tools menu if you display the menu bar or are on mac os x) press ctrl + shift + z on windows and linux, or cmd + opt + z on macos (starting in firefox 71; prior to firefox 66, the letter in this shortcut was s).
... press the menu button ( ), select "developer", then "debugger".
Using the Debugger map scopes feature - Firefox Developer Tools
open the example page and then open the debugger using tools > web developer > debugger (or press ctrl + i and then select the debugger).
... select the "bundle.js" file in the sources panel on the left and then set a breakpoint at line 102 in the increment function.
Network request details - Firefox Developer Tools
(there may be some exceptions, such as x-firefox-spdy, which is added by firefox.) you can copy some or all of the response header in json format by using the context menu: if you select copy, a single key word, value pair is copied.
... if you select copy all, the entire header is copied in json format, giving you something like this (after running the results through a json validator): { "response headers (1.113 kb)": { "headers": [ { "name": "accept-ranges", "value": "bytes" }, { "name": "age", "value": "0" }, { "name": "backend-timing", "value": "d=74716 t=1560258099074460" }, { "name": "cache-control", "value": "private, must-revalidate, max-age=0" }, { "name": "content-disposition", "value": "inline; filename=api-result.js" }, { "name": "content-encoding", "value": "gzip" }, { "name": "content-length", "value": "673" }, ...
Edit CSS filters - Firefox Developer Tools
you can also add new effects by selecting an effect from the dropdown list at the bottom of the dialog.
... once you have selected the effect you want to add, click the plus sign (+) to the right of the dropdown list.
Use the Inspector API - Firefox Developer Tools
attributes and functions: .selection - information about the inspector's selection: .isnode() - returns true if selection is node.
... .node - returns the actual element from the page .window - the window object of the frame the selection is in.
Use the Inspector from the Web Console - Firefox Developer Tools
the element that's currently selected in the page inspector can be referenced in the web console using the variable $0.
...if you hover over this target, the element is highlighted in the page, and if you click the target, the element is selected in the inspector: ...
Animation inspector example: CSS transitions - Firefox Developer Tools
: middle; line-height: normal; } .icon { width: 50px; height: 50px; filter: grayscale(100%); transition: transform 750ms ease-in, filter 750ms ease-in-out; } .note { margin-left: 1em; font: 1.5em "open sans",arial,sans-serif; overflow: hidden; white-space: nowrap; display: inline-block; opacity: 0; width: 0; transition: opacity 500ms 150ms, width 500ms 150ms; } .icon#selected { filter: grayscale(0%); transform: scale(1.5); } .icon#selected+span { opacity: 1; width: 300px; } javascript content function toggleselection(e) { if (e.button != 0) { return; } if (e.target.classlist.contains("icon")) { var wasselected = (e.target.getattribute("id") == "selected"); clearselection(); if (!wasselected) { e.target.setattribute("id", "sele...
...cted"); } } } function clearselection() { var selected = document.getelementbyid("selected"); if (selected) { selected.removeattribute("id"); } } document.addeventlistener("click", toggleselection); ...
How to - Firefox Developer Tools
open the performance tools to open the performance tools: press shift + f5 select "performance" from the web developer submenu in the firefox menu (or tools menu if you display the menu bar or are on os x) select "performance" from tools button, in the toolbar, if you have one: record a profile to start a new recording, press the stopwatch icon in the recordings pane.
... select a tool to switch between the waterfall, call tree, and flame chart tools, use the buttons in the toolbar: configure markers displayed to control which markers are shown in the waterfall, use the button in the toolbar: zoom in to zoom into a slice of the recording, select that slice in the recording overview: ...
Intensive JavaScript - Firefox Developer Tools
we can select one of these periods and have a closer look at it in the main waterfall view: here, when we pressed the button, the browser ran a javascript function, or series of functions, that blocked the main thread for 71.73ms, or more than four times our frame budget.
... isprime = false; break; } } if (isprime) { primes.push(candidate); } // schedule the next var testfunction = testcandidate.bind(this, index + 1); window.requestanimationframe(testfunction); } var primes = []; var testfunction = testcandidate.bind(this, 0); window.requestanimationframe(testfunction); } let's test this version out: select the radio button labeled "use requestanimationframe" and capture another profile.
Shader Editor - Firefox Developer Tools
you'll now see a window divided into three panes: a list of all the glsl programs on the left, the vertex shader for the currently selected program in the middle, and the fragment shader for the currently selected program on the right: managing programs the left hand pane lists all programs currently in use by a webgl context.
... editing shaders the middle and right hand panes show the vertex and fragment shaders for the currently selected program.
Local Storage / Session Storage - Firefox Developer Tools
when an origin corresponding to local storage or session storage is selected within the storage inspector, the names and values of all the items corresponding to local storage or session storage will be listed in a table.
... you can edit local and session storage items by double-clicking inside cells in the table widget and editing the values they contain: you can delete local storage and session storage entries using the context menu: you can also delete local and session storage entries by selecting an item and pressing the delete or backspace key.
Taking screenshots - Firefox Developer Tools
the screenshot is saved to your browser's "downloads" directory: taking a screenshot of an element to take a screenshot of a single element in the page, activate the context menu on that element in the inspector's html pane, and select "screenshot node".
... --selector string a css selector that selects a single element on the page.
View Source - Firefox Developer Tools
to activate view source: context-click in the page and select view page source press ctrl + u on windows and linux, or cmd + u on macos the command opens a new tab with the source for the current page.
... for example view-source:https://www.mozilla.org/#line100 view selection source if you select part of a web page and conext-click, you'll see a context menu item labeled "view selection source", that behaves just like "view page source", except you only see the source for the selection.
about:debugging (before Firefox 68) - Firefox Developer Tools
select the web developer menu under the hamburger menu (), then select "service workers".
...just click the button, navigate to the directory containing the add-on's file, and select any file in that directory.
AudioContext.createMediaStreamDestination() - Web APIs
<!doctype html> <html> <head> <title>createmediastreamdestination() demo</title> </head> <body> <h1>createmediastreamdestination() demo</h1> <p>encoding a pure sine wave to an opus file </p> <button>make sine wave</button> <audio controls></audio> <script> var b = document.queryselector("button"); var clicked = false; var chunks = []; var ac = new audiocontext(); var osc = ac.createoscillator(); var dest = ac.createmediastreamdestination(); var mediarecorder = new mediarecorder(dest.stream); osc.connect(dest); b.addeventlistener("click", function(e) { if (!clicked) { mediarecorder.start(); osc.start(0); ...
... var blob = new blob(chunks, { 'type' : 'audio/ogg; codecs=opus' }); document.queryselector("audio").src = url.createobjecturl(blob); }; </script> </body> </html> note: you can view this example live, or study the source code, on github.
AudioTrack - Web APIs
usage notes to get an audiotrack for a given media element, use the element's audiotracks property, which returns an audiotracklist object from which you can get the individual tracks contained in the media: var el = document.queryselector("video"); var tracks = el.audiotracks; you can then access the media's individual tracks using either array syntax or functions such as foreach().
... example this example returns an array of track kinds and labels for potential use in a user interface to select audio tracks for a specified media element.
AudioTrackList: change event - Web APIs
bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.audiotracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); // changing the value of `enabled` will trigger the `change` event const toggletrackbutton = document.queryselector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.audiotracks[0]; track.enabled = !track.enabled; }); using the onchange event handler property: const videoelement = documen...
...t.queryselector('video'); videoelement.audiotracks.onchange = (event) => { console.log(`'${event.type}' event fired`); }; // changing the value of `enabled` will trigger the `change` event const toggletrackbutton = document.queryselector('.toggle-track'); toggletrackbutton.addeventlistener('click', () => { const track = videoelement.audiotracks[0]; track.enabled = !track.enabled; }); specifications specification status html living standardthe definition of 'change' in that specification.
AudioTrackList.length - Web APIs
example this snippet gets the number of audio tracks in the first <video> element found in the dom by queryselector().
... var videoelem = document.queryselector("video"); var numaudiotracks = 0; if (videoelem.audiotracks) { numaudiotracks = videoelem.audiotracks.length; } note that this sample checks to be sure htmlmediaelement.audiotracks is defined, to avoid failing on browsers without support for audiotrack.
CSS.escape() - Web APIs
WebAPICSSescape
the css.escape() static method returns a cssomstring containing the escaped string passed as parameter, mostly for use as part of a css selector.
... examples basic results css.escape(".foo#bar") // "\.foo\#bar" css.escape("()[]{}") // "\(\)\[\]\{\}" css.escape('--a') // "--a" css.escape(0) // "\30 ", the unicode code point of '0' is 30 css.escape('\0') // "\ufffd", the unicode replacement character in context uses to escape a string for use as part of a selector, the escape() method can be used: var element = document.queryselector('#' + css.escape(id) + ' > img'); the escape() method can also be used for escaping strings, although it escapes characters that don't strictly need to be escaped: var element = document.queryselector('a[href="#' + css.escape(fragment) + '"]'); specification specification status comment css objec...
CSSPageRule - Web APIs
interface csspagerule : cssrule { attribute domstring selectortext; readonly attribute cssstyledeclaration style; }; properties as a cssrule, csspagerule also implements the properties of this interface.
... it has the following specific properties: csspagerule.selectortext represents the text of the page selector associated with the at-rule.
CSSPseudoElement.type - Web APIs
the type read-only property of the csspseudoelement interface returns the type of the pseudo-element as a string, represented in the form of a css selector.
... syntax var typeofpseudoelement = csspseudoelement.type; value a cssomstring containing one of the following values: "::before" "::after" "::marker" examples the example below demonstrates the relationship between csspseudoelement.type and element.pseudo(): const myelement = document.queryselector('q'); const myselector = '::after'; const csspseudoelement = myelement.pseudo(myselector); const typeofpseudoelement = csspseudoelement.type; console.log(myselector === typeofpseudoelement); // outputs true specifications specification status comment css pseudo-elements level 4the definition of 'type' in that specification.
CSSPseudoElement - Web APIs
csspseudoelement.type read only returns the pseudo-element selector as a cssomstring.
... const element = document.queryselector('q'); const csspseudoelement = element.pseudo('::before'); console.log(csspseudoelement.element); // outputs [object htmlquoteelement] console.log(csspseudoelement.type); // outputs '::before' specifications specification status comment css pseudo-elements level 4the definition of 'csspseudoelement' in that specification.
Cache - Web APIs
WebAPICache
examples this code snippet is from the service worker selective caching sample.
... (see selective caching live) the code uses cachestorage.open() to open any cache objects with a content-type header that starts with font/.
CanvasRenderingContext2D.arc() - Web APIs
const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); ctx.beginpath(); ctx.arc(100, 75, 50, 0, 2 * math.pi); ctx.stroke(); result different shapes demonstrated this example draws various shapes to show what is possible with arc().
... html <canvas width="150" height="200"></canvas> javascript const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); // draw shapes for (let i = 0; i <= 3; i++) { for (let j = 0; j <= 2; j++) { ctx.beginpath(); let x = 25 + j * 50; // x coordinate let y = 25 + i * 50; // y coordinate let radius = 20; // arc radius let startangle = 0; // starting point on circle let endangle = math.pi + (math.pi * j) / 2; // end point on circle let anticlockwise = i % 2 == 1; // draw anticlockwise ctx.arc(x, y, radius, startangle, endangle, anticlockwise); if (i > 1) { ctx.fill(); } else { ...
CanvasRenderingContext2D.lineDashOffset - Web APIs
marching ants the marching ants effect is an animation technique often found in selection tools of computer graphics programs.
... it helps the user to distinguish the selection border from the image background by animating the border.
Applying styles and colors - Web APIs
it is an animation technique often found in selection tools of computer graphics programs.
... it helps the user to distinguish the selection border from the image background by animating the border.
Using channel messaging - Web APIs
var input = document.getelementbyid('message-input'); var output = document.getelementbyid('message-output'); var button = document.queryselector('button'); var iframe = document.queryselector('iframe'); var channel = new messagechannel(); var port1 = channel.port1; // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for button clicks button.addeventlistener('click', onclick); // listen for messages on port1 port1.onmessage = onmessage; // transfer port2 to the iframe ifr...
... receiving the port and message in the iframe over in the iframe, we have the following javascript: var list = document.queryselector('ul'); var port2; // listen for the initial port transfer message window.addeventlistener('message', initport); // setup the transferred port function initport(e) { port2 = e.ports[0]; port2.onmessage = onmessage; } // handle messages received on port2 function onmessage(e) { var listitem = document.createelement('li'); listitem.textcontent = e.data; list.appendchild(listitem); p...
CompositionEvent.data - Web APIs
syntax mydata = compositionevent.data value a domstring representing the event data: for compositionstart events, this is the currently selected text that will be replaced by the string being composed.
... this value doesn't change even if content changes the selection range; rather, it indicates the string that was selected when composition started.
CredentialsContainer.get() - Web APIs
from the resulting set of credentials, it then selects the best one.
... depending on the options, it may display a dialog to the user and ask the user to make the selection.
CustomElementRegistry.whenDefined() - Web APIs
<menu-item>item n</menu-item> </nav-menu> </nav> const container = document.getelementbyid('menu-container'); const placeholder = container.queryselector('.menu-placeholder'); // fetch all the children of menu that are not yet defined.
... const undefinedelements = container.queryselectorall(':not(:defined)'); const promises = [...undefinedelements].map( button => customelements.whendefined(button.localname) ); // wait for all the children to be upgraded, // then remove the placeholder.
DOMTokenList - Web APIs
first, the html: <p class="a b c"></p> now the javascript: let para = document.queryselector("p"); let classes = para.classlist; para.classlist.add("d"); para.textcontent = `paragraph classlist is "${classes}"`; the output looks like this: trimming of whitespace and removal of duplicates methods that modify the domtokenlist (such as domtokenlist.add()) automatically trim any excess whitespace and remove duplicate values from the list.
... for example: <span class=" d d e f"></span> let span = document.queryselector("span"); let classes = span.classlist; span.classlist.add("x"); span.textcontent = `span classlist is "${classes}"`; the output looks like this: specifications specification status comment domthe definition of 'domtokenlist' in that specification.
DataTransfer.clearData() - Web APIs
html <span class="tweaked" id="source" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.
...="target">drop zone</span> <div>status: <span id="status">drag to start</span></div> <div>data is: <span id="data">uninitialized</span></div> css span.tweaked { display: inline-block; margin: 1em 0; padding: 1em 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } javascript window.addeventlistener('domcontentloaded', function () { // select html elements var draggable = document.getelementbyid('source'); var dropable = document.getelementbyid('target'); var status = document.getelementbyid('status'); var data = document.getelementbyid('data'); var dropped = false; // register event handlers draggable.addeventlistener('dragstart', dragstarthandler); draggable.addeventlistener('dragend', dragendhandler); dropable.ad...
Document: drag event - Web APIs
the drag event is fired every few hundred milliseconds as an element or text selection is being dragged by the user.
...ventlistener("dragleave", function(event) { // reset background of potential drop target when the draggable element leaves it if (event.target.classname == "dropzone") { event.target.style.background = ""; } }, false); document.addeventlistener("drop", function(event) { // prevent default action (open as link for some elements) event.preventdefault(); // move dragged elem to the selected drop target if (event.target.classname == "dropzone") { event.target.style.background = ""; dragged.parentnode.removechild( dragged ); event.target.appendchild( dragged ); } }, false); specifications specification status comment html living standardthe definition of 'drag event' in that specification.
Document.getElementById() - Web APIs
if you need to get access to an element which doesn't have an id, you can use queryselector() to find the element using any selector.
... unlike some other element-lookup methods such as document.queryselector() and document.queryselectorall(), getelementbyid() is only available as a method of the global document object, and not available as a method on all element objects in the dom.
Document.lastStyleSheetSet - Web APIs
this property's value changes whenever the document.selectedstylesheetset property is changed.
...if the current style sheet set has not been changed by setting document.selectedstylesheetset, the returned value is null.
Document.queryCommandState() - Web APIs
the querycommandstate() method will tell you if the current selection has a certain document.execcommand() command applied.
... example html <div contenteditable="true">select a part of this text!</div> <button onclick="makebold();">test the state of the 'bold' command</button> javascript function makebold() { var state = document.querycommandstate("bold"); switch (state) { case true: alert("the bold formatting will be removed from the selected text."); break; case false: alert("the selected text will be displayed in bold."); break; case null: alert("the state of the 'bold' command is indeterminable."); break; } document.execcommand('bold'); } result specifi...
Examples of web and XML development using the DOM - Web APIs
you can access these stylesheets and their rules individually using the stylesheet, style, and cssrule objects, as demonstrated in this example, which prints out all of the style rule selectors to the console.
... var ss = document.stylesheets; for(var i = 0; i < ss.length; i++) { for(var j = 0; j < ss[i].cssrules.length; j++) { dump( ss[i].cssrules[j].selectortext + "\n" ); } } for a document with a single stylesheet in which the following three rules are defined: body { background-color: darkblue; } p { font-face: arial; font-size: 10pt; margin-left: .125in; } #lumpy { display: none; } this script outputs the following: body p #lumpy example 5: event propagation this example demonstrates how events fire and are handled in the dom in a very simple way.
Introduction to the DOM - Web APIs
<html> <head> <title>dom tests</title> <script> function setbodyattr(attr, value) { if (document.body) document.body[attr] = value; else throw new error("no support"); } </script> </head> <body> <div style="margin: .5in; height: 400px;"> <p><b><tt>text</tt></b></p> <form> <select onchange="setbodyattr('text', this.options[this.selectedindex].value);"> <option value="black">black</option> <option value="red">red</option> </select> <p><b><tt>bgcolor</tt></b></p> <select onchange="setbodyattr('bgcolor', this.options[this.selectedindex].value);"> <option value="white">white</option> <option value="lightgrey">gr...
...ay</option> </select> <p><b><tt>link</tt></b></p> <select onchange="setbodyattr('link', this.options[this.selectedindex].value);"> <option value="blue">blue</option> <option value="green">green</option> </select> <small> <a href="http://some.website.tld/page.html" id="sample"> (sample link) </a> </small><br /> <input type="button" value="version" onclick="ver()" /> </form> </div> </body> </html> to test a lot of interfaces in a single page—for example, a "suite" of properties that affect the colors of a web page—you can create a similar test page with a whole console of buttons, textfields, and other html elements.
Traversing an HTML table with JavaScript and DOM Interfaces - Web APIs
html <body> <input type="button" value="set paragraph background color" onclick="set_background()"> <p>hi</p> <p>hello</p> </body> javascript function set_background() { // get a list of all the body elements (there will only be one), // and then select the zeroth (or first) such element mybody = document.getelementsbytagname("body")[0]; // now, get all the p elements that are descendants of the body mybodyelements = mybody.getelementsbytagname("p"); // get the second item of the list of p elements myp = mybodyelements[1]; myp.style.background = "rgb(255,0,0)"; } in this example, we set the myp variable to the dom object for the...
... second p element inside the body: first, we get a list of all the body elements via mybody = document.getelementsbytagname("body")[0] since there is only one body element in any valid html document, this list will have only one item, which we retrieve by selecting the first element in that list using [0].
Element: compositionend event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.queryselector('input[type="text"]'); inputelement.addeventlistener('compositionend', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="eve...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.queryselector('input[type="text"]'); const log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.a...
Element: compositionstart event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.queryselector('input[type="text"]'); inputelement.addeventlistener('compositionstart', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="e...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.queryselector('input[type="text"]'); const log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.a...
Element: compositionupdate event - Web APIs
bubbles yes cancelable yes interface compositionevent event handler property none examples const inputelement = document.queryselector('input[type="text"]'); inputelement.addeventlistener('compositionupdate', (event) => { console.log(`generated characters were: ${event.data}`); }); live example html <div class="control"> <label for="name">on macos, click in the textbox below,<br> then type <kbd>option</kbd> + <kbd>`</kbd>, then <kbd>a</kbd>:</label> <input type="text" id="example" name="example"> </div> <div class="...
...ss body { padding: .2rem; display: grid; grid-template-areas: "control log"; } .control { grid-area: control; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } input[type="text"] { margin: .5rem 0; } kbd { border-radius: 3px; padding: 1px 2px 0; border: 1px solid black; } js const inputelement = document.queryselector('input[type="text"]'); const log = document.queryselector('.event-log-contents'); const clearlog = document.queryselector('.clear-log'); clearlog.addeventlistener('click', () => { log.textcontent = ''; }); function handleevent(event) { log.textcontent = log.textcontent + `${event.type}: ${event.data}\n`; } inputelement.addeventlistener('compositionstart', handleevent); inputelement.a...
Element: copy event - Web APIs
bubbles yes cancelable yes interface clipboardevent event handler property oncopy the event's default action is to copy the selection (if any) to the clipboard.
... examples live example html <div class="source" contenteditable="true">try copying text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const source = document.queryselector('div.source'); source.addeventlistener('copy', (event) => { const selection = document.getselection(); event.clipboarddata.setdata('text/plain', selection.tostring().touppercase()); event.preventdefault(); }); result specifications specification status clipboard api and events working draft ...
Element.innerHTML - Web APIs
WebAPIElementinnerHTML
javascript function log(msg) { var logelem = document.queryselector(".log"); var time = new date(); var timestr = time.tolocaletimestring(); logelem.innerhtml += timestr + ": " + msg + "<br/>"; } log("logging mouse events inside this container..."); the log() function creates the log output by getting the current time from a date object using tolocaletimestring(), and building a string with the timestamp and the message text.
...thod that logs information about mouseevent based events (such as mousedown, click, and mouseenter): function logevent(event) { var msg = "event <strong>" + event.type + "</strong> at <em>" + event.clientx + ", " + event.clienty + "</em>"; log(msg); } then we use this as the event handler for a number of mouse events on the box that contains our log: var boxelem = document.queryselector(".box"); boxelem.addeventlistener("mousedown", logevent); boxelem.addeventlistener("mouseup", logevent); boxelem.addeventlistener("click", logevent); boxelem.addeventlistener("mouseenter", logevent); boxelem.addeventlistener("mouseleave", logevent); html the html is quite simple for our example.
Using Fetch - Web APIs
const formdata = new formdata(); const filefield = document.queryselector('input[type="file"]'); formdata.append('username', 'abc123'); formdata.append('avatar', filefield.files[0]); fetch('https://example.com/profile/avatar', { method: 'put', body: formdata }) .then(response => response.json()) .then(result => { console.log('success:', result); }) .catch(error => { console.error('error:', error); }); uploading multiple files files can be uploaded using ...
... const formdata = new formdata(); const photos = document.queryselector('input[type="file"][multiple]'); formdata.append('title', 'my vegas vacation'); for (let i = 0; i < photos.files.length; i++) { formdata.append('photos', photos.files[i]); } fetch('https://example.com/posts', { method: 'post', body: formdata, }) .then(response => response.json()) .then(result => { console.log('success:', result); }) .catch(error => { console.error('error:', error); }); processing a text file line by line the chunks that are read from a response are not broken neatly at line boundaries and are uint8arrays, not strings.
FileReader: error event - Web APIs
bubbles no cancelable no interface progressevent event handler property filereader.onerror examples const fileinput = document.queryselector('input[type="file"]'); const reader = new filereader(); function handleselected(e) { const selectedfile = fileinput.files[0]; if (selectedfile) { reader.addeventlistener('error', () => { console.error(`error occurred reading file: ${selectedfile.name}`); }); reader.addeventlistener('load', () => { console.error(`file: ${selectedfile.name} read successfully`); }); reader.readasdataurl(selectedfile); ...
...} } fileinput.addeventlistener('change', handleselected); specifications specification status file api working draft ...
FileReader.readAsDataURL() - Web APIs
example html <input type="file" onchange="previewfile()"><br> <img src="" height="200" alt="image preview..."> javascript function previewfile() { const preview = document.queryselector('img'); const file = document.queryselector('input[type=file]').files[0]; const reader = new filereader(); reader.addeventlistener("load", function () { // convert image file to base64 string preview.src = reader.result; }, false); if (file) { reader.readasdataurl(file); } } live result example reading multiple files html <input id="browse" type="file" onchange="...
...previewfiles()" multiple> <div id="preview"></div> javascript function previewfiles() { var preview = document.queryselector('#preview'); var files = document.queryselector('input[type=file]').files; function readandpreview(file) { // make sure `file.name` matches our extensions criteria if ( /\.(jpe?g|png|gif)$/i.test(file.name) ) { var reader = new filereader(); reader.addeventlistener("load", function () { var image = new image(); image.height = 100; image.title = file.name; image.src = this.result; preview.appendchild( image ); }, false); reader.readasdataurl(file); } } if (files) { [].foreach.call(files, readandpreview); } } note: the filereader() constructor was not supported by intern...
Using the Geolocation API - Web APIs
body { padding: 20px; background-color:#ffffc9 } button { margin: .5rem 0; } html <button id = "find-me">show my location</button><br/> <p id = "status"></p> <a id = "map-link" target="_blank"></a> javascript function geofindme() { const status = document.queryselector('#status'); const maplink = document.queryselector('#map-link'); maplink.href = ''; maplink.textcontent = ''; function success(position) { const latitude = position.coords.latitude; const longitude = position.coords.longitude; status.textcontent = ''; maplink.href = `https://www.openstreetmap.org/#map=18/${latitude}/${longitude}`; maplink.textcontent = `latitude:...
... ${latitude} °, longitude: ${longitude} °`; } function error() { status.textcontent = 'unable to retrieve your location'; } if(!navigator.geolocation) { status.textcontent = 'geolocation is not supported by your browser'; } else { status.textcontent = 'locating…'; navigator.geolocation.getcurrentposition(success, error); } } document.queryselector('#find-me').addeventlistener('click', geofindme); result ...
Geolocation API - Web APIs
body { padding: 20px; background-color:#ffffc9 } button { margin: .5rem 0; } html <button id = "find-me">show my location</button><br/> <p id = "status"></p> <a id = "map-link" target="_blank"></a> javascript function geofindme() { const status = document.queryselector('#status'); const maplink = document.queryselector('#map-link'); maplink.href = ''; maplink.textcontent = ''; function success(position) { const latitude = position.coords.latitude; const longitude = position.coords.longitude; status.textcontent = ''; maplink.href = `https://www.openstreetmap.org/#map=18/${latitude}/${longitude}`; maplink.textcontent = `latitude:...
... ${latitude} °, longitude: ${longitude} °`; } function error() { status.textcontent = 'unable to retrieve your location'; } if(!navigator.geolocation) { status.textcontent = 'geolocation is not supported by your browser'; } else { status.textcontent = 'locating…'; navigator.geolocation.getcurrentposition(success, error); } } document.queryselector('#find-me').addeventlistener('click', geofindme); result specifications specification status comment geolocation api recommendation ...
GlobalEventHandlers.oninput - Web APIs
the oninput property of the globaleventhandlers mixin is an eventhandler that processes input events on the <input>, <select>, and <textarea> elements.
... html <input type="text" placeholder="type something here to see its length." size="50"> <p id="log"></p> javascript let input = document.queryselector('input'); let log = document.getelementbyid('log'); input.oninput = handleinput; function handleinput(e) { log.textcontent = `the field's value is ${e.target.value.length} character(s) long.`; } result specifications specification status comment html living standardthe definition of 'oninput' in that specification.
GlobalEventHandlers.onkeypress - Web APIs
html <input> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.onkeypress = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result filter keys with a regular expression this example filters the characters typed into a form field using a regular expression.
... html <label>enter numbers only: <input> </label> javascript function numbersonly(event) { return event.charcode === 0 || /\d/.test(string.fromcharcode(event.charcode)); } const input = document.queryselector('input'); input.onkeypress = numbersonly; // prevent pasting (since pasted content might include non-number characters) input.onpaste = event => false; result capture the typing of a hidden word the following javascript function will do something after the user types the word "exit" in any point of a page.
HTMLContentElement - Web APIs
htmlcontentelement.select is a domstring that reflects the select html attribute.
... the value is a comma-separated list of css selectors that select the content to insert in place of the <content> element.
HTMLDialogElement: cancel event - Web APIs
bubbles no cancelable yes interface event event handler oncancel examples live example html <dialog class="example-dialog"> <button class="close" type="reset">close</button> </dialog> <button class="open-dialog">open dialog</button> <div class="result"></div> css button, div { margin: .5rem; } js const result = document.queryselector('.result'); const dialog = document.queryselector('.example-dialog'); dialog.addeventlistener('cancel', (event) => { result.textcontent = 'dialog was canceled'; }); const opendialog = document.queryselector('.open-dialog'); opendialog.addeventlistener('click', () => { if (typeof dialog.showmodal === 'function') { dialog.showmodal(); result.textcontent = ''; } else { r...
...esult.textcontent = 'the dialog api is not supported by this browser'; } }); const closebutton = document.queryselector('.close'); closebutton.addeventlistener('click', () => { dialog.close(); }); result specifications specification status html living standardthe definition of 'cancel' in that specification.
HTMLDialogElement: close event - Web APIs
bubbles no cancelable no interface event event handler property onclose examples live example html <dialog class="example-dialog"> <button class="close" type="reset">close</button> </dialog> <button class="open-dialog">open dialog</button> <div class="result"></div> css button, div { margin: .5rem; } js const result = document.queryselector('.result'); const dialog = document.queryselector('.example-dialog'); dialog.addeventlistener('close', (event) => { result.textcontent = 'dialog was closed'; }); const opendialog = document.queryselector('.open-dialog'); opendialog.addeventlistener('click', () => { if (typeof dialog.showmodal === 'function') { dialog.showmodal(); result.textcontent = ''; } else { res...
...ult.textcontent = 'the dialog api is not supported by this browser'; } }); const closebutton = document.queryselector('.close'); closebutton.addeventlistener('click', () => { dialog.close(); }); result specifications specification status html living standardthe definition of 'close' in that specification.
HTMLElement: animationcancel event - Web APIs
const animated = document.queryselector('.animated'); animated.addeventlistener('animationcancel', () => { console.log('animation canceled'); }); animated.style.display = 'none'; the same, but using the onanimationcancel property instead of addeventlistener(): const animated = document.queryselector('.animated'); animated.onanimationcancel = () => { console.log('animation canceled'); }; animated.style.display = 'none'; live...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.queryselector('p.animation'); const animationeventlog = document.queryselector('.animation-example>.event-log'); const applyanimation = document.queryselector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationite...
HTMLElement: animationend event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationend examples this example gets an element that's being animated and listens for the animationend event: const animated = document.queryselector('.animated'); animated.addeventlistener('animationend', () => { console.log('animation ended'); }); the same, but using the onanimationend event handler property: const animated = document.queryselector('.animated'); animated.onanimationend = () => { console.log('animation ended'); }; live example html <div class="animation-example"> <div class="container"> <p class="anim...
... height: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { margin-left: 100%; width: 300%; } to { margin-left: 0%; width: 100%; } } js const animation = document.queryselector('p.animation'); const animationeventlog = document.queryselector('.animation-example>.event-log'); const applyanimation = document.queryselector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationite...
HTMLElement: animationiteration event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationiteration examples this code uses animationiteration to keep track of the number of iterations an animation has completed: const animated = document.queryselector('.animated'); let iterationcount = 0; animated.addeventlistener('animationiteration', () => { iterationcount++; console.log(`animation iteration count: ${iterationcount}`); }); the same, but using the onanimationiteration event handler property: const animated = document.queryselector('.animated'); let iterationcount = 0; animated.onanimationiteration = () => { iterationcount++; c...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.queryselector('p.animation'); const animationeventlog = document.queryselector('.animation-example>.event-log'); const applyanimation = document.queryselector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationite...
HTMLElement: animationstart event - Web APIs
bubbles yes cancelable no interface animationevent event handler property onanimationstart examples this listens for the animationstart event and logs a message when it is fired: const animated = document.queryselector('.animated'); animated.addeventlistener('animationstart', () => { console.log('animation started'); }); the same, but using onanimationstart: const animated = document.queryselector('.animated'); animated.onanimationstart = () => { console.log('animation started'); }; live example html <div class="animation-example"> <div class="container"> <p class="animation">you chos...
...t: 3rem; } .event-log { width: 25rem; height: 2rem; border: 1px solid black; margin: 0.2rem; padding: 0.2rem; } .animation.active { animation-duration: 2s; animation-name: slidein; animation-iteration-count: 2; } @keyframes slidein { from { transform: translatex(100%) scalex(3); } to { transform: translatex(0) scalex(1); } } js const animation = document.queryselector('p.animation'); const animationeventlog = document.queryselector('.animation-example>.event-log'); const applyanimation = document.queryselector('.animation-example>button.activate'); let iterationcount = 0; animation.addeventlistener('animationstart', () => { animationeventlog.textcontent = `${animationeventlog.textcontent}'animation started' `; }); animation.addeventlistener('animationite...
HTMLElement: beforeinput event - Web APIs
the dom beforeinput event fires when the value of an <input>, <select>, or <textarea> element is about to be modified.
... html <input placeholder="enter some text" name="name"/> <p id="values"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('values'); input.addeventlistener('beforeinput', updatevalue); function updatevalue(e) { log.textcontent = e.target.value; } result specifications specification status ui eventsthe definition of 'beforeinput event' in that specification.
inert - Web APIs
WebAPIHTMLElementinert
the boolean inert attribute, when present, may make the browser "ignore" the element from assistive technologies, page search and text selection.
... according to the spec: when a node is inert, then the user agent must act as if the node was absent for the purposes of targeting user interaction events, may ignore the node for the purposes of text search user interfaces (commonly known as "find in page"), and may prevent the user from selecting text in that node.
HTMLElement: transitioncancel event - Web APIs
bubbles yes cancelable no interface transitionevent event handler property globaleventhandlers.ontransitioncancel examples this code gets an element that has a transition defined and adds a listener to the transitioncancel event: const transition = document.queryselector('.transition'); transition.addeventlistener('transitioncancel', () => { console.log('transition canceled'); }); the same, but using the ontransitioncancel property instead of addeventlistener(): const transition = document.queryselector('.transition'); transition.ontransitioncancel = () => { console.log('transition canceled'); }; live example in the following example, we have a simpl...
... const message = document.queryselector('.message'); const el = document.queryselector('.transition'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitioncancel', function() { message.textcontent = 'transitioncancel fired'; }); el.addeventlisten...
HTMLElement: transitionend event - Web APIs
examples this code gets an element that has a transition defined and adds a listener to the transitionend event: const transition = document.queryselector('.transition'); transition.addeventlistener('transitionend', () => { console.log('transition ended'); }); the same, but using the ontransitionend: const transition = document.queryselector('.transition'); transition.ontransitionend = () => { console.log('transition ended'); }; live example in the following example, we have a simple <div> element, styled with a transition that includes...
... const message = document.queryselector('.message'); const el = document.queryselector('.transition'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitioncancel', function() { message.textcontent = 'transitioncancel fired'; }); el.addeventlisten...
HTMLFormElement - Web APIs
usage notes obtaining a form element object to obtain an htmlformelement object, you can use a css selector with queryselector(), or you can get a list of all of the forms in the document using its forms property.
... elements that are considered form controls the elements included by htmlformelement.elements and htmlformelement.length are the following: <button> <fieldset> <input> (with the exception that any whose type is "image" are omitted for historical reasons) <object> <output> <select> <textarea> no other elements are included in the list returned by elements, which makes it an excellent way to get at the elements most important when processing forms.
HTMLImageElement.crossOrigin - Web APIs
if crossorigin is an empty string (""), the anonymous mode is selected.
... const imageurl = "https://mdn.mozillademos.org/files/16797/clock-demo-400px.png"; const container = document.queryselector(".container"); function loadimage(url) { const image = new image(200, 200); image.addeventlistener("load", () => container.prepend(image) ); image.addeventlistener("error", () => { const errmsg = document.createelement("output"); errmsg.value = `error loading image at ${url}`; container.append(errmsg); }); image.crossorigin = "anonymous"; image.alt = ""; image...
HTMLImageElement.currentSrc - Web APIs
currentsrc lets you determine which image from the set of provided images was selected by the browser.
... html <img src="/files/16797/clock-demo-400px.png" alt="clock" srcset="/files/16864/clock-demo-200px.png 200w, /files/16797/clock-demo-400px.png 400w" sizes="(max-width: 400px) 50%, 90%"> javascript var clockimage = document.queryselector("img"); let p = document.createelement("p"); if (!clockimage.currentsrc.endswith("200px.png")) { p.innertext = "using the 200px image."; } else { p.innertext = "using the 400px image!"; } document.body.appendchild(p); result specifications specification status comment html living standardthe definition of 'htmlimageelement.currentsrc' in that specification...
HTMLImageElement.srcset - Web APIs
it uses the image's currentsrc property to fetch and display the url selected by the browser from the srcset.
... let box = document.queryselector(".box"); let image = box.queryselector("img"); let newelem = document.createelement("p"); newelem.innerhtml = `image: <code>${image.currentsrc}</code>`; box.appendchild(newelem); result in the displayed output below, the selected url will correspond with whether your display results in selecting the 1x or the 2x version of the image.
HTMLImageElement.x - Web APIs
let logbox = document.queryselector("pre"); let tbl = document.getelementbyid("userinfo") let log = msg => { logbox.innerhtml += `${msg}<br>`; } let cell = tbl.rows[1].cells[2]; let image = cell.queryselector("img"); log(`image's global x: ${image.x}`); log(`image's global y: ${image.y}`); this uses the <table>'s rows property to get a list of the rows in the table, from which it looks up row 1 (which, being a zero-based in...
... from there, we can get the <img> element itself from the cell by calling queryselector() on the htmltablecellelement representing that cell.
HTMLImageElement.y - Web APIs
let logbox = document.queryselector("pre"); let tbl = document.getelementbyid("userinfo") let log = msg => { logbox.innerhtml += `${msg}<br>`; } let cell = tbl.rows[1].cells[2]; let image = cell.queryselector("img"); log(`image's global x: ${image.x}`); log(`image's global y: ${image.y}`); this uses the <table>'s rows property to get a list of the rows in the table, from which it looks up row 1 (which, being a zero-based in...
... from there, we can get the <img> element itself from the cell by calling queryselector() on the htmltablecellelement representing that cell.
HTMLMediaElement: emptied event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('emptied', (event) => { console.log('uh oh.
...did you call load()?'); }); using the onemptied event handler property: const video = document.queryselector('video'); video.onemptied = (event) => { console.log('uh oh.
HTMLMediaElement: loadeddata event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('loadeddata', (event) => { console.log('yay!
... the readystate just increased to ' + 'have_current_data or greater for the first time.'); }); using the onloadeddata event handler property: const video = document.queryselector('video'); video.onloadeddata = (event) => { console.log('yay!
HTMLMediaElement: loadedmetadata event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('loadedmetadata', (event) => { console.log('the duration and dimensions ' + ' of the media and tracks are now known.
... '); }); using the onloadedmetadata event handler property: const video = document.queryselector('video'); video.onloadedmetadata = (event) => { console.log('the duration and dimensions ' + ' of the media and tracks are now known.
HTMLMediaElement: pause event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('pause', (event) => { console.log('the boolean paused property is now true.
... either the ' + 'pause() method was called or the autoplay attribute was toggled.'); }); using the onpause event handler property: const video = document.queryselector('video'); video.onpause = (event) => { console.log('the boolean paused property is now true.
HTMLMediaElement: play event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('play', (event) => { console.log('the boolean paused property is now false.
... either the ' + 'play() method was called or the autoplay attribute was toggled.'); }); using the onplay event handler property: const video = document.queryselector('video'); video.onplay = (event) => { console.log('the boolean paused property is now false.
HTMLMediaElement: timeupdate event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('timeupdate', (event) => { console.log('the currenttime attribute has been updated.
... again.'); }); using the ontimeupdate event handler property: const video = document.queryselector('video'); video.ontimeupdate = (event) => { console.log('the currenttime attribute has been updated.
HTMLOptionsCollection - Web APIs
the htmloptionscollection interface represents a collection of <option> html elements (in document order) and offers methods and properties for selecting from the list as well as optionally altering its items.
... this object is returned only by the options property of select.
IDBObjectStore - Web APIs
idbobjectstore.delete() returns an idbrequest object, and, in a separate thread, deletes the store object selected by the specified key.
... idbobjectstore.get() returns an idbrequest object, and, in a separate thread, returns the store object store selected by the specified key.
Using IndexedDB - Web APIs
d(s) missing"); return; } var year = $('#pub-year').val(); if (year != '') { // better use number.isinteger if the engine has ecmascript 6 if (isnan(year)) { displayactionfailure("invalid year"); return; } year = number(year); } else { year = null; } var file_input = $('#pub-file'); var selected_file = file_input.get(0).files[0]; console.log("selected_file:", selected_file); // keeping a reference on how to reset the file input in the ui once we // have its value, but instead of doing that we rather use a "reset" type // input in the html form.
... //file_input.val(null); var file_url = $('#pub-file-url').val(); if (selected_file) { addpublication(biblioid, title, year, selected_file); } else if (file_url) { addpublicationfromurl(biblioid, title, year, file_url); } else { addpublication(biblioid, title, year); } }); $('#delete-button').click(function(evt) { console.log("delete ..."); var biblioid = $('#pub-biblioid-to-delete').val(); var key = $('#key-to-delete').val(); if (biblioid != '') { deletepublicationfrombib(biblioid); } else if (key != '') { // better use number.isinteger if the engine has ecmascript 6 if (key == '' || isnan(key)) { displayactionfailure("invalid key"); return; }...
Locks.name - Web APIs
WebAPILockname
the name read-only property of the lock interface returns the name passed to lockmanager.request selected when the lock was requested.
...the name is selected by the developer to represent an abstract resource for which use is being coordinated across multiple tabs, workers, or other code within the origin.
MediaDevices.getUserMedia() - Web APIs
var constraints = { audio: true, video: { width: 1280, height: 720 } }; navigator.mediadevices.getusermedia(constraints) .then(function(mediastream) { var video = document.queryselector('video'); video.srcobject = mediastream; video.onloadedmetadata = function(e) { video.play(); }; }) .catch(function(err) { console.log(err.name + ": " + err.message); }); // always check for errors at the end.
...w error('getusermedia is not implemented in this browser')); } // otherwise, wrap the call to the old navigator.getusermedia with a promise return new promise(function(resolve, reject) { getusermedia.call(navigator, constraints, resolve, reject); }); } } navigator.mediadevices.getusermedia({ audio: true, video: true }) .then(function(stream) { var video = document.queryselector('video'); // older browsers may not have srcobject if ("srcobject" in video) { video.srcobject = stream; } else { // avoid using this in new browsers, as it is going away.
MediaDevices - Web APIs
getdisplaymedia() prompts the user to select a display or portion of a display (such as a window) to capture as a mediastream for sharing or recording purposes.
...var video = document.queryselector('video'); var constraints = window.constraints = { audio: false, video: true }; var errorelement = document.queryselector('#errormsg'); navigator.mediadevices.getusermedia(constraints) .then(function(stream) { var videotracks = stream.getvideotracks(); console.log('got stream with constraints:', constraints); console.log('using video device: ' + videotracks[0].label); stream.onremovetrack = fun...
MediaSource.activeSourceBuffers - Web APIs
the activesourcebuffers read-only property of the mediasource interface returns a sourcebufferlist object containing a subset of the sourcebuffer objects contained within sourcebuffers — the list of objects providing the selected video track, enabled audio tracks, and shown/hidden text tracks.
... (_) { //console.log(this.readystate); // open var mediasource = this; var sourcebuffer = mediasource.addsourcebuffer(mimecodec); fetchab(asseturl, function (buf) { sourcebuffer.addeventlistener('updateend', function (_) { mediasource.endofstream(); console.log(mediasource.activesourcebuffers); // will contain the source buffer that was added above, // as it is selected for playing in the video player video.play(); //console.log(mediasource.readystate); // ended }); sourcebuffer.appendbuffer(buf); }); }; ...
MediaSource - Web APIs
mediasource.activesourcebuffers read only returns a sourcebufferlist object containing a subset of the sourcebuffer objects contained within mediasource.sourcebuffers — the list of objects providing the selected video track, enabled audio tracks, and shown/hidden text tracks.
...this example was written by nick desaulniers and can be viewed live here (you can also download the source for further investigation.) var video = document.queryselector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource(); //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(me...
MediaStreamAudioSourceNode - Web APIs
the number of channels output by the node matches the number of tracks found in the selected audio track.
... var pre = document.queryselector('pre'); var video = document.queryselector('video'); var myscript = document.queryselector('script'); var range = document.queryselector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audi...
MediaStream Image Capture API - Web APIs
you can use the properties of the mediastreamtrack objects to select the one you need.
... let zoom = document.queryselector('#zoom'); const capabilities = track.getcapabilities(); // check whether zoom is supported or not.
MediaStream Recording API - Web APIs
var canvas = document.queryselector("canvas"); // optional frames per second argument.
... in this code snippet, enumeratedevices() is used to examine the available input devices, locate those which are audio input devices, and create <option> elements that are then added to a <select> element representing an input source picker.
MediaTrackConstraints.displaySurface - Web APIs
this is used to specify the type or types of display surfaces which getdisplaymedia() will let the user select among for sharing purposes.
... usage notes you can check the setting selected by the user agent after the display media has been created by getdisplaymedia() by calling getsettings() on the display media's video mediastreamtrack, then checking the value of the returned mediatracksettings object's displaysurface object.
Capabilities, constraints, and settings - Web APIs
the actual settings the browser selected and is using are shown in the boxes on the right.
... function keydownhandler(event) { if (event.key == "tab") { let elem = event.target; let str = elem.value; let position = elem.selectionstart; let newstr = str.substring(0, position) + " " + str.substring(position, str.length); elem.value = newstr; elem.selectionstart = elem.selectionend = position + 2; event.preventdefault(); } } videoconstrainteditor.addeventlistener("keydown", keydownhandler, false); audioconstrainteditor.addeventlistener("keydown", keydownhandler, false); show constrainable...
Using Navigation Timing - Web APIs
for example, to measure the perceived loading time for a page: window.addeventlistener("load", function() { let now = new date().gettime(); let loadingtime = now - performance.timing.navigationstart; document.queryselector(".output").innertext = loadingtime + " ms"; }, false); this code, executed when the load event occurs, subtracts from the current time the time at which the navigation whose timing was recorded began (performance.timing.navigationstart), and outputs that information to the screen by inserting it into an element.
...avigation.type_navigate: output += "navigation"; break; case performancenavigation.type_reload: output += "reload"; break; case performancenavigation.type_back_forward: output += "history"; break; default: output += "unknown"; break; } output += "<br/>redirects: " + performance.navigation.redirectcount; document.queryselector(".output").innerhtml = output; }, false); this amends the previous example by looking at the contents of the performance.navigation object.
Navigator.getUserMedia() - Web APIs
your callback can then assign the stream to the desired object (such as an <audio> or <video> element), as shown in the following example: function(stream) { var video = document.queryselector('video'); video.srcobject = stream; video.onloadedmetadata = function(e) { // do something with the video here.
... navigator.getusermedia = navigator.getusermedia || navigator.webkitgetusermedia || navigator.mozgetusermedia; if (navigator.getusermedia) { navigator.getusermedia({ audio: true, video: { width: 1280, height: 720 } }, function(stream) { var video = document.queryselector('video'); video.srcobject = stream; video.onloadedmetadata = function(e) { video.play(); }; }, function(err) { console.log("the following error occurred: " + err.name); } ); } else { console.log("getusermedia not supported"); } ...
Node.getRootNode() - Web APIs
WebAPINodegetRootNode
(see the full source code): <!-- source: https://github.com/jserz/js_piece/blob/master/dom/node/getrootnode()/demo/getrootnode.html --> <div class="js-parent"> <div class="js-child"></div> </div> <div class="js-shadowhost"></div> <script> // works on chrome 54+,opera 41+ var parent = document.queryselector('.js-parent'), child = document.queryselector('.js-child'), shadowhost = document.queryselector('.js-shadowhost'); console.log(parent.getrootnode().nodename); // #document console.log(child.getrootnode().nodename); // #document // create a shadowroot var shadowroot = shadowhost.attachshadow({mode:'open'}); shadowroot.innerhtml = '<style>div{background:#2bb8aa;}</style>' ...
... + '<div class="js-shadowchild">content</div>'; var shadowchild = shadowroot.queryselector('.js-shadowchild'); // the default value of composed is false console.log(shadowchild.getrootnode() === shadowroot); // true console.log(shadowchild.getrootnode({composed:false}) === shadowroot); // true console.log(shadowchild.getrootnode({composed:true}).nodename); // #document </script> specifications specification status comment domthe definition of 'getrootnode()' in that specification.
Payment Request API - Web APIs
it is not a new way for paying for things; rather, it's a way for users to select their preferred way of paying for things, and make that information available to a merchant.
... paymentresponse an object returned after the user selects a payment method and approves a payment request.
PublicKeyCredentialCreationOptions - Web APIs
publickeycredentialcreationoptions.authenticatorselection optional an object whose properties are criteria used to filter out the potential authenticators for the creation operation.
...{ type: "public-key", alg: cose_alg_ecdsa_w_sha256, }], // timeout after 1 minute timeout: 60000, // do not send the authenticator's origin attestation attestation: "none", extensions: { uvm: true, exts: true }, // filter out authenticators which are bound to the device authenticatorselection:{ authenticatorattachment: "cross-platform", requireresidentkey: true, userverification: "preferred" }, // exclude already existing credentials for the user excludecredentials: [ { type: "public-key", // the id for john.doe@example.com id : new uint8array(26) /* this actually is given by the se...
RTCIceCandidate.usernameFragment - Web APIs
randomization at least 24 bits of the text in the ufrag are required to be randomly selected by the ice layer at the beginning of the ice session.
...for example, a browser might choose to always use a 24-character ufrag in which bit 4 of each character is randomly selected between 0 and 1.
RTCIceCandidateInit.usernameFragment - Web APIs
randomization at least 24 bits of the text in the ufrag are required to be randomly selected by the ice layer at the beginning of the ice session.
...for example, a browser might choose to always use a 24-character ufrag in which bit 4 of each character is randomly selected between 0 and 1.
RTCIceCandidatePair.local - Web APIs
the rtcicecandidatepair is returned by the rtcicetransport method getselectedcandidatepair().
... var candidatepair = pc.getsenders()[0].transport.transport.getselectedcandidatepair(); var localcandidate = candidatepair.local; the rtcicetransport is found by getting the list of rtcrtpsender objects for the rtcpeerconnection pc.
RTCIceCandidatePair.remote - Web APIs
the rtcicecandidatepair is returned by the rtcicetransport method getselectedcandidatepair().
... var candidatepair = pc.getsenders()[0].transport.transport.getselectedcandidatepair(); var remotecandidate = candidatepair.remote; the rtcicetransport is found by getting the list of rtcrtpsender objects for the rtcpeerconnection pc.
RTCIceCandidateStats.address - Web APIs
when a domain name is specified, the first ip address selected for that address is used, even if the domain name maps to multiple ip addresses.
...if multiple ip addresses are returned in response to the query, the user agent selects one, which is then used for the duration of ice processing.
Range() - Web APIs
WebAPIRangeRange
we then select the range using window.getselection() and selection.addrange().
... html <p>first paragraph.</p> <p>second paragraph.</p> <p>third paragraph.</p> <p>fourth paragraph.</p> javascript const paragraphs = document.queryselectorall('p'); // create new range const range = new range(); // start range at second paragraph range.setstartbefore(paragraphs[1]); // end range at third paragraph range.setendafter(paragraphs[2]); // get window selection const selection = window.getselection(); // add range to window selection selection.addrange(range); result specification specification status comment domthe definition of 'range.range()' in that specification.
Range.cloneContents() - Web APIs
partially selected nodes include the parent tags necessary to make the document fragment valid.
... syntax documentfragment = range.clonecontents(); example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); documentfragment = range.clonecontents(); document.body.appendchild(documentfragment); specifications specification status comment domthe definition of 'range.clonecontents()' in that specification.
Range.createContextualFragment() - Web APIs
the range.createcontextualfragment() method returns a documentfragment by invoking the html fragment parsing algorithm or the xml fragment parsing algorithm with the start of the range (the parent of the selected node) as the context node.
... example var tagstring = "<div>i am a div node</div>"; var range = document.createrange(); // make the parent of the first div in the document becomes the context node range.selectnode(document.getelementsbytagname("div").item(0)); var documentfragment = range.createcontextualfragment(tagstring); document.body.appendchild(documentfragment); specification specification status comment dom parsing and serializationthe definition of 'range.createcontextualfragment()' in that specification.
Range.getBoundingClientRect() - Web APIs
this method is useful for determining the viewport coordinates of the cursor or selection inside a text box.
...the bounding client rectangle contains everything selected in the range.</p> css #highlight { background: yellow; position: absolute; z-index: -1; } p { width: 200px; } javascript const range = document.createrange(); range.setstartbefore(document.getelementsbytagname('b').item(0), 0); range.setendafter(document.getelementsbytagname('b').item(1), 0); const clientrect = range.getboundingclientrect(); const highlight = document.getelementbyid('highlight')...
Range.surroundContents() - Web APIs
that is, unlike the alternative above, if there are partially selected nodes, they will not be cloned and instead the operation will fail.
... example html <span class="header-text">put this in a headline</span> javascript const range = document.createrange(); const newparent = document.createelement('h1'); range.selectnode(document.queryselector('.header-text')); range.surroundcontents(newparent); result specifications specification status comment domthe definition of 'range.surroundcontents()' in that specification.
Request() - Web APIs
WebAPIRequestRequest
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { return response.blob(); }).then(function(response) { var objecturl = url.createobjecturl(response); myimage.src = objecturl; }); in our fetch request with init example (see fetch request init live) we do the same thing except that we pass in an init object when we invoke fetch(): var myimage...
... = document.queryselector('img'); var myheaders = new headers(); myheaders.append('content-type', 'image/jpeg'); var myinit = { method: 'get', headers: myheaders, mode: 'cors', cache: 'default' }; var myrequest = new request('flowers.jpg',myinit); fetch(myrequest).then(function(response) { ...
SVGFEDisplacementMapElement - Web APIs
svgfedisplacementmapelement.xchannelselector read only an svganimatedenumeration corresponding to the xchannelselect attribute of the given element.
... svgfedisplacementmapelement.ychannelselector read only an svganimatedenumeration corresponding to the ychannelselect attribute of the given element.
SVGGraphicsElement: copy event - Web APIs
bubbles yes cancelable yes interface clipboardevent event handler property oncopy the event's default action is to copy the selection (if any) to the clipboard.
..."20" width="90" height="20"> <input xmlns="http://www.w3.org/1999/xhtml" placeholder="paste it here"/> </foreignobject> </svg> css input { font-size: 10px; width: 100%; height: 90%; box-sizing: border-box; border: 1px solid black; } javascript document.getelementsbytagname("text")[0].addeventlistener("copy", evt => { evt.clipboarddata.setdata('text/plain', document.getselection().tostring().touppercase()); evt.preventdefault(); }); result specifications specification status comment scalable vector graphics (svg) 2 candidate recommendation definition that the clipboard events apply to svg elements.
SVGGraphicsElement: cut event - Web APIs
bubbles yes cancelable yes interface clipboardevent event handler property oncut the eventʼs default action is to copy the current selection (if any) to the system clipboard and remove it from the document.
...so an event handler which wants to emulate the default action for "cut" while modifying the clipboard must also manually remove the selection from the document.
SpeechSynthesis: voiceschanged event - Web APIs
synth = window.speechsynthesis; synth.addeventlistener('voiceschanged', function() { var voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } }); or use the onvoiceschanged event handler property: synth.onvoiceschanged = function() { var voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; option.setattribute('data-lang', voices[i].lang); option.setattribute('data-...
...name', voices[i].name); voiceselect.appendchild(option); } } specifications specification status comment web speech apithe definition of 'speech synthesis events' in that specification.
SpeechSynthesisErrorEvent.error - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onerror = function(event) { console.error('an error has occurred with the speech synthesis: ' + event.error); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'error' in that specification.
SpeechSynthesisErrorEvent - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onerror = function(event) { console.log('an error has occurred with the speech synthesis: ' + event.error); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesiserrorevent' in that specification.
SpeechSynthesisUtterance.SpeechSynthesisUtterance() - Web APIs
var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesisutterance()' in that specification.
SpeechSynthesisUtterance.lang - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.lang = 'en-us'; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'lang' in that specification.
SpeechSynthesisUtterance.onboundary - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onboundary = function(event) { console.log(event.name + ' boundary reached after ' + event.elapsedtime + ' milliseconds.'); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onboundary' in that specification.
SpeechSynthesisUtterance.onend - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onend = function(event) { console.log('utterance has finished being spoken after ' + event.elapsedtime + ' milliseconds.'); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onend' in that specification.
SpeechSynthesisUtterance.onerror - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onerror = function(event) { console.log('an error has occurred with the speech synthesis: ' + event.error); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onerror' in that specification.
SpeechSynthesisUtterance.onmark - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onmark = function(event) { console.log('a mark was reached: ' + event.name); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onmark' in that specification.
SpeechSynthesisUtterance.onpause - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onpause = function(event) { console.log('speech paused after ' + event.elapsedtime + ' milliseconds.'); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onpause' in that specification.
SpeechSynthesisUtterance.onresume - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onresume = function(event) { console.log('speech resumed after ' + event.elapsedtime + ' milliseconds.'); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onresume' in that specification.
SpeechSynthesisUtterance.onstart - Web APIs
}; examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); utterthis.onstart = function(event) { console.log('we have started uttering this speech: ' + event.utterance.text); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'onstart' in that specification.
SpeechSynthesisUtterance.pitch - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.pitch = 1.5; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'pitch' in that specification.
SpeechSynthesisUtterance.rate - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.rate = 1.5; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'rate' in that specification.
SpeechSynthesisUtterance.text - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } console.log(utterthis.text); synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'text' in that specification.
SpeechSynthesisUtterance.voice - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'voice' in that specification.
SpeechSynthesisUtterance.volume - Web APIs
examples var synth = window.speechsynthesis; var inputform = document.queryselector('form'); var inputtxt = document.queryselector('input'); var voiceselect = document.queryselector('select'); var voices = synth.getvoices(); ...
... inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.volume = 0.5; synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'volume' in that specification.
SpeechSynthesisVoice - Web APIs
celist() { voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } } populatevoicelist(); if (speechsynthesis.onvoiceschanged !== undefined) { speechsynthesis.onvoiceschanged = populatevoicelist; } inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.leng...
...th ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } utterthis.pitch = pitch.value; utterthis.rate = rate.value; synth.speak(utterthis); utterthis.onpause = function(event) { var char = event.utterance.text.charat(event.charindex); console.log('speech paused at character ' + event.charindex + ' of "' + event.utterance.text + '", which is "' + char + '".'); } inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speechsynthesisvoice' in that specification.
SubtleCrypto.deriveKey() - Web APIs
let encryptbutton = document.queryselector(".ecdh .encrypt-button"); encryptbutton.addeventlistener("click", () => { encrypt(alicessecretkey); }); // bob can use his copy to decrypt the message.
... let decryptbutton = document.queryselector(".ecdh .decrypt-button"); decryptbutton.addeventlistener("click", () => { decrypt(bobssecretkey); }); } pbkdf2 in this example we ask the user for a password, then use it to derive an aes key using pbkdf2, then use the aes key to encrypt a message.
TextTrackList.length - Web APIs
example this snippet gets the number of text tracks in the first media element found in the dom by queryselector().
... var mediaelem = document.queryselector("video, audio"); var numtexttracks = 0; if (mediaelem.texttracks) { numtexttracks = mediaelem.texttracks.length; } note that this sample checks to be sure htmlmediaelement.texttracks is defined, to avoid failing on browsers without support for texttrack.
USB.requestDevice() - Web APIs
WebAPIUSBrequestDevice
this triggers a user-agent flow that prompts the user to select a device for pairing.
... only the selected device is passed to then().
USBInterface - Web APIs
usbinterface.alternateread only returns the currently selected alternative configuration of this interface.
...it can be changed by calling usbdevice.selectalternateinterface() with any other value found in alternates.
VideoTrackList.length - Web APIs
example this snippet gets the number of video tracks in the first <video> element found in the dom by queryselector().
... var videoelem = document.queryselector("video"); var numvideotracks = 0; if (videoelem.videotracks) { numvideotracks = videoelem.videotracks.length; } note that this sample checks to be sure htmlmediaelement.videotracks is defined, to avoid failing on browsers without support for videotrack.
VideoTrackList.onchange - Web APIs
to determine the new state of media's tracks, you'll have to look at their videotrack.selected flags.
... var tracklist = document.queryselector("video").videotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackselectedbutton(track.id, track.selected); }); }; the updatetrackselectedbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's selected flag to dete...
WebGLRenderingContext - Web APIs
state information webglrenderingcontext.activetexture() selects the active texture unit.
... firstcanvas = document.getelementsbytagname("canvas")[0], secondcanvas = document.getelementsbytagname("canvas")[1]; firstcanvas.width = firstcanvas.clientwidth; firstcanvas.height = firstcanvas.clientheight; [firstcanvas, secondcanvas].foreach(function(canvas) { var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.queryselector("p").innerhtml = "failed to get webgl context.
Color masking - Web APIs
: inherit; font-weight : 900; color : white; margin : auto; padding : 0.6em 1.2em; } #red-toggle { background-color : red; } #green-toggle { background-color : green; } #blue-toggle { background-color : blue; } window.addeventlistener("load", function setupanimation (evt) { "use strict" window.removeeventlistener(evt.type, setupanimation, false); var canvas = document.queryselector("canvas"); var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.queryselector("p").innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return; } gl.viewport(0, 0, gl.drawingbufferwidth, gl.drawingbufferheight); var timer = setinterval(drawanimation, 1000); var mas...
...k = [true, true, true]; var redtoggle = document.queryselector("#red-toggle"), greentoggle = document.queryselector("#green-toggle"), bluetoggle = document.queryselector("#blue-toggle"); redtoggle.addeventlistener("click", setcolormask, false); greentoggle.addeventlistener("click", setcolormask, false); bluetoggle.addeventlistener("click", setcolormask, false); function setcolormask(evt) { var index = evt.target === greentoggle && 1 || evt.target === bluetoggle && 2 || 0; mask[index] = !mask[index]; if (mask[index] === true) evt.target.innerhtml="on"; else evt.target.innerhtml="off"; gl.colormask(mask[0], mask[1], mask[2], true); drawanimation(); }; function drawanimation () { var color = getrandomcolor(); gl.c...
Raining rectangles - Web APIs
"use strict" window.addeventlistener("load", setupanimation, false); var gl, timer, rainingrect, scoredisplay, missesdisplay; function setupanimation (evt) { window.removeeventlistener(evt.type, setupanimation, false); if (!(gl = getrenderingcontext())) return; gl.enable(gl.scissor_test); rainingrect = new rectangle(); timer = settimeout(drawanimation, 17); document.queryselector("canvas") .addeventlistener("click", playerclick, false); var displays = document.queryselectorall("strong"); scoredisplay = displays[0]; missesdisplay = displays[1]; } var score = 0, misses = 0; function drawanimation () { gl.scissor(rainingrect.position[0], rainingrect.position[1], rainingrect.size[0] , rainingrect.size[1]); gl.clear(gl.color_buffer_bit); rainingrec...
...ion = [ randnums[2]*(gl.drawingbufferwidth - rect.size[0]), gl.drawingbufferheight ]; rect.velocity = 1.0 + 6.0*math.random(); rect.color = getrandomvector(); gl.clearcolor(rect.color[0], rect.color[1], rect.color[2], 1.0); function getrandomvector() { return [math.random(), math.random(), math.random()]; } } function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.
WebRTC connectivity - Web APIs
choosing a candidate pair the ice layer selects one of the two peers to serve as the controlling agent.
... the controlling agent not only takes responsibility for making the final decision as to which candidate pair to use, but also for signaling that selection to the controlled agent by using stun and an updated offer, if necessary.
Establishing a connection: The WebRTC perfect negotiation pattern - Web APIs
const constraints = { audio: true, video: true }; const config = { iceservers: [{ urls: "stun:stun.mystunserver.tld" }] }; const selfvideo = document.queryselector("video.selfview"); const remotevideo = document.queryselector("video.remoteview"); const signaler = new signalingchannel(); const pc = new rtcpeerconnection(config); this code also gets the <video> elements using the classes "selfview" and "remoteview"; these will contain, respectively, the local user's self-view and the view of the incoming stream from the remote peer.
... if the newly-set remote description is an offer, we ask webrtc to select an appropriate local configuration by calling the rtcpeerconnection method setlocaldescription() without parameters.
Using DTMF with WebRTC - Web APIs
once the track is selected, you can obtain from its rtcrtpsender the rtcdtmfsender object you'll use for sending dtmf.
... window.addeventlistener("load", function() { logelement = document.queryselector(".log"); dialbutton = document.queryselector("#dial"); dialbutton.addeventlistener("click", connectanddial, false); }); starting the connection process when the dial button is clicked, connectanddial() is called.
WebRTC API - Web APIs
included are interfaces representing peer media connections, data channels, and interfaces used when exchanging information on the capabilities of each peer in order to select the best possible configuration for a two-way media connection.
... selectedcandidatepairchange the currently-selected pair of ice candidates has changed for the rtcicetransport on which the event is fired.
WebSocket - Web APIs
WebAPIWebSocket
websocket.extensions read only the extensions selected by the server.
... websocket.protocol read only the sub-protocol selected by the server.
Geometry and reference spaces in WebXR - Web APIs
xrreferencespace the remainder of this guide explores how to select the right reference space for your app's needs.
... selecting the reference space type straight off, let's state the simplest step in the process of deciding which reference type to use: the reference spaces you're most likely to use are local, local-floor, unbounded, or bounded-floor.
Movement, orientation, and motion: A WebXR example - Web APIs
window.addeventlistener("load", onload); function onload() { xrbutton = document.queryselector("#enter-xr"); xrbutton.addeventlistener("click", onxrbuttonclick); projectionmatrixout = document.queryselector("#projection-matrix div"); modelmatrixout = document.queryselector("#model-view-matrix div"); cameramatrixout = document.queryselector("#camera-matrix div"); mousematrixout = document.queryselector("#mouse-matrix div"); if (!navigator.xr || enableforcepolyfill) { con...
... function sessionstarted(session) { let refspacetype; xrsession = session; xrbutton.innertext = "exit webxr"; xrsession.addeventlistener("end", sessionended); let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); if (allowmouserotation) { canvas.addeventlistener("pointermove", handlepointermove); canvas.addeventlistener("contextmenu", (event) => { event.preventdefault(); }); } if (allowkeyboardmotion) { document.addeventlistener("keydown", handlekeydown); } shaderprogram = initshaderprogram(gl, vssource, fssou...
Web Audio API best practices - Web APIs
here is a simple example of creating the context from inside a click event: const button = document.queryselector('button'); button.addeventlistener('click', function() { const audioctx = new audiocontext(); }, false); if however, you create the context outside of a user gesture, its state will be set to suspended and it will need to be started after user interaction.
... const audioctx = new audiocontext(); const button = document.queryselector('button'); button.addeventlistener('click', function() { // check if context is in suspended state (autoplay policy) if (audioctx.state === 'suspended') { audioctx.resume(); } }, false); you might instead be working with an offlineaudiocontext, in which case you can resume the suspended audio context with the startrendering() method.
Controlling multiple parameters with ConstantSourceNode - Web APIs
ge" min="0.0" max="1.0" step="0.01" value="0.8" name="volume" id="volumecontrol"> </div> </div> <p>use the button above to start and stop the tones, and the volume control to change the volume of the notes e and g in the chord.</p> css .controls { width: 400px; position: relative; vertical-align: middle; height: 44px; } .button { font-size: 32px; cursor: pointer; user-select: none; -moz-user-select: none; -webkit-user-select: none; -ms-user-select: none; -o-user-select: none; } .right { width: 50%; font: 14px "open sans", "lucida grande", "arial", sans-serif; position: absolute; right: 0; display: table-cell; vertical-align: middle; } .right span { vertical-align: middle; } .right input { vertical-align: baseline; } .left { width: 50%; ...
... function setup() { context = new (window.audiocontext || window.webkitaudiocontext)(); playbutton = document.queryselector("#playbutton"); volumecontrol = document.queryselector("#volumecontrol"); playbutton.addeventlistener("click", toggleplay, false); volumecontrol.addeventlistener("input", changevolume, false); gainnode1 = context.creategain(); gainnode1.gain.value = 0.5; gainnode2 = context.creategain(); gainnode3 = context.creategain(); gainnode2.gain.value = gainnode1.gain.value; gainnode...
Using Web Workers - Web APIs
var ofragm = document.createdocumentfragment(); ofragm.appendchild(document.createtextnode(smsg)); ofragm.appendchild(document.createelement('br')); document.queryselector('#logdisplay').appendchild(ofragm); } </script> <script type="text/js-worker"> // this script won't be parsed by js engines because its mime type is text/js-worker.
... // in the past...: // blob builder existed // ...but now we use blob...: var blob = new blob(array.prototype.map.call(document.queryselectorall('script[type=\'text\/js-worker\']'), function (oscript) { return oscript.textcontent; }),{type: 'text/javascript'}); // creating a new document.worker property containing all our "text/js-worker" scripts.
Window.getDefaultComputedStyle() - Web APIs
<style> h3:after { content: ' rocks!'; } </style> <h3>generated content</h3> <script> var h3 = document.queryselector('h3'), result = getdefaultcomputedstyle(h3, ':after').content; console.log('the generated content is: ', result); // returns 'none' </script> notes the returned value is, in certain known cases, expressly incorrect by deliberate intent.
... in particular, to avoid the so called css history leak security issue, browsers may expressly "lie" about the used value for a link and always return values as if a user has never visited the linked site, and/or limit the styles that can be applied using the :visited pseudo-selector.
window.location - Web APIs
WebAPIWindowlocation
rty: <!doctype html> <html> <head> <meta charset="utf-8"/> <title>mdn example</title> <script> function shownode (onode) { document.documentelement.scrolltop = onode.offsettop; document.documentelement.scrollleft = onode.offsetleft; } function showbookmark (sbookmark, busehash) { if (arguments.length === 1 || busehash) { location.hash = sbookmark; return; } var obookmark = document.queryselector(sbookmark); if (obookmark) { shownode(obookmark); } } </script> <style> span.intlink { cursor: pointer; color: #0000ff; text-decoration: underline; } </style> </head> <body> <p>lorem ipsum dolor sit amet, consectetur adipiscing elit.
... _itframe++; } function _chkowner () { if (_isbot) { _isbot = false; return; } if (_scrollid > -1) { clearinterval(_scrollid); _scrollid = -1; } } if (window.addeventlistener) { window.addeventlistener("scroll", _chkowner, false); } else if (window.attachevent) { window.attachevent("onscroll", _chkowner); } return function (sbookmark, busehash) { var onode = document.queryselector(sbookmark); _scrolly = document.documentelement.scrolltop; _scrollx = document.documentelement.scrollleft; _bookmark = sbookmark; _usehash = busehash === true; _nodex = onode.offsetleft; _nodey = onode.offsettop; _itframe = 1; if (_scrollid === -1) { _scrollid = setinterval(_next, math.round(nduration / nframes)); } }; })(); specifications specification stat...
Window - Web APIs
WebAPIWindow
window.getselection() returns the selection object representing the selected item(s).
...if the resource fully fits in the window, then this event cannot be invoked globaleventhandlers.onwheel called when the mouse wheel is rotated around any axis globaleventhandlers.onselect called after text in an input field is selected globaleventhandlers.onselectionchange is an eventhandler representing the code to be called when the selectionchange event is raised.
WindowOrWorkerGlobalScope.fetch() - Web APIs
const myimage = document.queryselector('img'); let myrequest = new request('flowers.jpg'); fetch(myrequest) .then(function(response) { if (!response.ok) { throw new error(`http error!
... status: ${response.status}`); } return response.blob(); }) .then(function(response) { let objecturl = url.createobjecturl(response); myimage.src = objecturl; }); in the fetch with init then request example (see fetch request init live), we do the same thing except that we pass in an init object when we invoke fetch(): const myimage = document.queryselector('img'); let myheaders = new headers(); myheaders.append('content-type', 'image/jpeg'); const myinit = { method: 'get', headers: myheaders, mode: 'cors', cache: 'default' }; let myrequest = new request('flowers.jpg'); fetch(myrequest, myinit).then(function(response) { // ...
Using XMLHttpRequest - Web APIs
/> last name: <input type="text" name="lastname" /><br /> sex: <input id="sex_male" type="radio" name="sex" value="male" /> <label for="sex_male">male</label> <input id="sex_female" type="radio" name="sex" value="female" /> <label for="sex_female">female</label><br /> password: <input type="password" name="secret" /><br /> what do you prefer: <select name="image_type"> <option>books</option> <option>cinema</option> <option>tv</option> </select> </p> <p> post your photos: <input type="file" multiple name="photos[]"> </p> <p> <input id="vehicle_bike" type="checkbox" name="vehicle[]" value="bike" /> <label for="vehicle_bike">i have a bike</label><br /> <input id="vehicle...
.../> last name: <input type="text" name="lastname" /><br /> sex: <input id="sex_male" type="radio" name="sex" value="male" /> <label for="sex_male">male</label> <input id="sex_female" type="radio" name="sex" value="female" /> <label for="sex_female">female</label><br /> password: <input type="password" name="secret" /><br /> what do you prefer: <select name="image_type"> <option>books</option> <option>cinema</option> <option>tv</option> </select> </p> <p> post your photos: <input type="file" multiple name="photos[]"> </p> <p> <input id="vehicle_bike" type="checkbox" name="vehicle[]" value="bike" /> <label for="vehicle_bike">i have a bike</label><br /> <input id="vehicle...
XRInputSourceEvent.inputSource - Web APIs
example the snippet below shows a handler for the select event which looks specifically for events which happen on gaze input devices.
... xrsession.onselect = event => { let source = event.inputsource; if (source.targetraymode == "gaze") { /* handle selection using a gaze input */ } }; specifications specification status comment webxr device apithe definition of 'xrinputsourceevent.inputsource' in that specification.
XRInputSourceEventInit.frame - Web APIs
examples this example creates a new select event and sends it to the xrsession.
... let event = new xrinputsourceevent("select", { frame: eventframe, inputsource: source }; if (event) { xrsession.dispatchevent(event); } specifications specification status comment webxr device apithe definition of 'xrinputsourceeventinit.frame' in that specification.
XRInputSourceEventInit.inputSource - Web APIs
examples this example creates a new select event and sends it to the xrsession.
... let event = new xrinputsourceevent("select", { frame: eventframe, inputsource: source }; if (event) { xrsession.dispatchevent(event); } specifications specification status comment webxr device apithe definition of 'xrinputsourceeventinit.inputsource' in that specification.
XRPose.transform - Web APIs
WebAPIXRPosetransform
example this handler for the xrsession event select handles events for tracked pointers.
... xrsession.addeventlistener("select", event => { let source = event.inputsource; let frame = event.frame; let targetraypose = frame.getpose(source.targetrayspace, myrefspace); let targetobject = findtargetusingray(targetray.transform.matrix); if (source.targetraymode == "tracked-pointer") { if (source.handedness == user.handedness) { targetobject.primaryaction(); } else { targetobject.offhandaction();...
Web APIs
WebAPI
lement htmlmarqueeelement htmlmediaelement htmlmenuelement htmlmenuitemelement htmlmetaelement htmlmeterelement htmlmodelement htmlolistelement htmlobjectelement htmloptgroupelement htmloptionelement htmloptionscollection htmlorforeignelement htmloutputelement htmlparagraphelement htmlparamelement htmlpictureelement htmlpreelement htmlprogresselement htmlquoteelement htmlscriptelement htmlselectelement htmlshadowelement htmlslotelement htmlsourceelement htmlspanelement htmlstyleelement htmltablecaptionelement htmltablecellelement htmltablecolelement htmltableelement htmltablerowelement htmltablesectionelement htmltemplateelement htmltextareaelement htmltimeelement htmltitleelement htmltrackelement htmlulistelement htmlunknownelement htmlvideoelement hashchangeevent headers history hk...
...itchelement svgsymbolelement svgtrefelement svgtspanelement svgtests svgtextcontentelement svgtextelement svgtextpathelement svgtextpositioningelement svgtitleelement svgtransform svgtransformlist svgtransformable svgurireference svgunittypes svguseelement svgvkernelement svgviewelement svgzoomandpan screen screenorientation scriptprocessornode scrolltooptions securitypolicyviolationevent selection sensor sensorerrorevent serviceworker serviceworkercontainer serviceworkerglobalscope serviceworkermessageevent serviceworkerregistration serviceworkerstate shadowroot sharedworker sharedworkerglobalscope slottable sourcebuffer sourcebufferlist speechgrammar speechgrammarlist speechrecognition speechrecognitionalternative speechrecognitionerror speechrecognitionerrorevent s...
ARIA: form role - Accessibility
even if you are using the form landmark instead of <form>, you are encouraged to use native html form controls like button, input, select, and textarea associated wai-aria roles, states, and properties no role specific states or properties.
... inputs are not forms you do not need to declare role="form" on every form element (inputs, text areas, selects, etc.).
ARIA: switch role - Accessibility
document.queryselectorall(".switch").foreach(function(theswitch) { theswitch.addeventlistener("click", handleclickevent, false); }); function handleclickevent(evt) { let el = evt.target; if (el.getattribute("aria-checked") == "true") { el.setattribute("aria-checked", "false"); } else { el.setattribute("aria-checked", "true"); } } css the purpose of the css is to establish a look and feel for...
... { padding: 0 4px; pointer-events: none; } [role="switch"][aria-checked="false"] :first-child, [role="switch"][aria-checked="true"] :last-child { background: #262; color: #eef; } [role="switch"][aria-checked="false"] :last-child, [role="switch"][aria-checked="true"] :first-child { color: #bbd; } label.switch { font: 16px "open sans", "arial", sans-serif; line-height: 20px; user-select: none; vertical-align: middle; -moz-user-select: none; -ms-user-select: none; -webkit-user-select: none; -o-user-select: none; } the most interesting part is probably the use of attribute selectors and the :first-child and :last-child pseudo-classes to do all the heavy lifting of changing the appearance of the switch based on whether it's on or off.
WAI-ARIA Roles - Accessibility
it is normally used in conjunction with the listitem role, which is used to identify a list item contained inside the list.aria: listbox rolethe listbox role is used for lists from which a user may select one or more items which are static and, unlike html <select> elements, may contain images.aria: listitem rolethe aria listitem role can be used to identify an item inside a list of items.
...stelle) complementary composite definition directory feed gridcell (eric e) group input landmark link - old page listbox log - old page marquee math menu menubar menuitem menuitemcheckbox menuitemradio none note option presentation progressbar - old page radio - old page radiogroup range region roletype rowheader(estelle) scrollbar searchbox section sectionhead select separator slider - old page spinbutton status - old page structure tab tablist (michiel) tabpanel (michiel) term timer toolbar tooltip tree treegrid treeitem widget window ...
Accessibility: What users can do to browse more safely - Accessibility
ve (desktop, in windows 10) according to eric bailey, in his april 30, 2019 article revisiting prefers-reduced-motion, the reduced motion media query, "while microsoft edge does not have support for prefers-reduced-motion, it will become chrome under the hood soon." safari 10.1 and above (desktop) do not enable auto-play (does not work for gifs) ios safari 10.3 and above (mobile and tablet) select the "reduce motion option" in os accessibility settings for apple (image source: developers.google.com from thomas steiner's article "move ya!
...in the screenshot below, you can see an example of windows 10 accessibility settings allowing for color filters to be selected.
Accessibility Information for Web Authors - Accessibility
the output data report is displayed in a clear and well structured table where each and all checkpoints are identified and described (along with an helpful clickable link to the related reference guideline) into logical groups and according to measurable results: passed, warning, failed for automated verification, warning for manual verification, not selected, not available, not related, etc.
...it not only checks and reports possible markup errors and warnings (based on w3c tidy and/or based on true sgml validation) but it can also report accessibility errors and warnings according to selectable accessibility guidelines (section 508, wcag priorities 1, 2 or 3).
Web Accessibility: Understanding Colors and Luminance - Accessibility
luckily, css media queries level 5 will be a game-changer in accessibility initiatives, because it will allow users to select settings that accomodate their needs best.
... a great example of a tool that converts colors for you is tom jewett's "mini color selector" with hsl, rgb, hex options for checking contrast in the browser.
-webkit-box-reflect - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
:-moz-only-whitespace - CSS: Cascading Style Sheets
note: in selectors level 4 the :empty selector was changed to act like :-moz-only-whitespace, but no browser currently supports this yet.
... examples html <div> </div> css :root { overflow: hidden; max-width: 100vw; max-height: 100vh; } div { background-color: #ccc; box-sizing: border-box; height: 100vh; min-height: 16px; min-height: 1rem; } div { border: 4px solid red; } :-moz-only-whitespace { border-color: lime; } result specifications briefly defined as :blank in selectors level 4, but then the functionality was merged into :empty and :blank redefined to mean empty <input>.
::cue-region - CSS: Cascading Style Sheets
the ::cue-region css pseudo-element matches webvtt cues within a selected element.
... syntax ::cue-region | ::cue-region( <selector> ) permitted properties rules whose selectors include this element may only use the following css properties: background background-attachment background-clip background-color background-image background-origin background-position background-repeat background-size color font font-family font-size font-stretch font-style font-variant font-weight line-height opacity outli...
::cue - CSS: Cascading Style Sheets
WebCSS::cue
the ::cue css pseudo-element matches webvtt cues within a selected element.
... syntax ::cue | ::cue( <selector> ) permitted properties rules whose selectors include this element may only use the following css properties: background background-attachment background-clip background-color background-image background-origin background-position background-repeat background-size color font font-family font-size font-stretch font-style font-variant font-weight line-height opacity outli...
::first-letter (:first-letter) - CSS: Cascading Style Sheets
/* selects the first letter of a <p> */ p::first-letter { font-size: 130%; } the first letter of an element is not always trivial to identify: punctuation that precedes or immediately follows the first letter is included in the match.
... selectors level 3the definition of '::first-letter' in that specification.
::first-line (:first-line) - CSS: Cascading Style Sheets
/* selects the first line of a <p> */ p::first-line { color: red; } css3 introduced the ::first-line notation (with two colons) to distinguish pseudo-classes from pseudo-elements.
... selectors level 3the definition of '::first-line' in that specification.
::marker - CSS: Cascading Style Sheets
WebCSS::marker
the ::marker css pseudo-element selects the marker box of a list item, which typically contains a bullet or number.
... ::marker { color: blue; font-size: 1.2em; } allowable properties only certain css properties can be used in a rule with ::marker as a selector: all font properties the white-space property color text-combine-upright, unicode-bidi and direction properties the content property all animation and transition properties the specification states that additional css properties may be supported in future.
:any-link - CSS: Cascading Style Sheets
WebCSS:any-link
the :any-link css pseudo-class selector represents an element that acts as the source anchor of a hyperlink, independent of whether it has been visited.
... /* selects any element that would be matched by :link or :visited */ :any-link { color: green; } syntax :any-link examples html <a href="https://example.com">external link</a><br> <a href="#">internal target link</a><br> <a>placeholder link (won't get styled)</a> css a:any-link { border: 1px solid blue; color: orange; } /* webkit browsers */ a:-webkit-any-link { border: 1px solid blue; color: orange; } result specifications specification status comment selectors level 4the definition of ':any-link' in that specification.
:first - CSS: Cascading Style Sheets
WebCSS:first
(see :first-child for general first element of a node.) /* selects the first page when printing */ @page :first { margin-left: 50%; margin-top: 50%; } note: you can't change all css properties with this pseudo-class.
... syntax :first examples html <p>first page.</p> <p>second page.</p> <button>print!</button> css @page :first { margin-left: 50%; margin-top: 50%; } p { page-break-after: always; } javascript document.queryselector("button").addeventlistener('click', () => { window.print(); }); result press the "print!" button to print the example.
:focus-within - CSS: Cascading Style Sheets
(this includes descendants in shadow trees.) /* selects a <div> when one of its descendants is focused */ div:focus-within { background: cyan; } this selector is useful, to take a common example, for highlighting an entire <form> container when the user focuses on one of its <input> fields.
...e">given name:</label> <input id="given_name" type="text"> <br> <label for="family_name">family name:</label> <input id="family_name" type="text"> </form> css form { border: 1px solid; color: gray; padding: 4px; } form:focus-within { background: #ff8; color: black; } input { margin: 4px; } result specifications specification status comment selectors level 4the definition of ':focus-within' in that specification.
:in-range - CSS: Cascading Style Sheets
WebCSS:in-range
/* selects any <input>, but only when it has a range specified, and its value is inside that range */ input:in-range { background-color: rgba(0, 255, 0, 0.25); } this pseudo-class is useful for giving the user a visual indication that a field's current value is within the permitted limits.
... selectors level 4the definition of ':in-range' in that specification.
:indeterminate - CSS: Cascading Style Sheets
/* selects any <input> whose state is indeterminate */ input:indeterminate { background: lime; } elements targeted by this selector are: <input type="checkbox"> elements whose indeterminate property is set to true by javascript <input type="radio"> elements, when all radio buttons with the same name value in the form are unchecked <progress> elements in an indeterminate state syntax :indeterminate examples checkbox & radio button this example applies special styles to the labels associated...
... selectors level 4the definition of ':indeterminate' in that specification.
:out-of-range - CSS: Cascading Style Sheets
/* selects any <input>, but only when it has a range specified, and its value is outside that range */ input:out-of-range { background-color: rgba(255, 0, 0, 0.25); } this pseudo-class is useful for giving the user a visual indication that a field's current value is outside the permitted limits.
... selectors level 4the definition of ':out-of-range' in that specification.
:placeholder-shown - CSS: Cascading Style Sheets
/* selects any element with an active placeholder */ :placeholder-shown { border: 2px solid silver; } syntax :placeholder-shown examples basic example this example applies special font and border styles when the placeholder is shown.
...input type="number" pattern="[0-9]{8}" title="8 digit id" id="sid" class="studentid" placeholder="8 digit id"/> </p> <input type="submit"/> </form> css input { background-color: #e8e8e8; color: black; } input.studentid:placeholder-shown { background-color: yellow; color: red; font-style: italic; } result specifications specification status comment selectors level 4the definition of ':placeholder-shown' in that specification.
:read-only - CSS: Cascading Style Sheets
input:-moz-read-only, textarea:-moz-read-only, input:read-only, textarea:read-only { border: 0; box-shadow: none; background-color: white; } textarea:-moz-read-write, textarea:read-write { box-shadow: inset 1px 1px 3px #ccc; border-radius: 5px; } you can find the full source code at readonly-confirmation.html; this renders like so: styling read-only non-form controls this selector doesn't just select <input>/<textarea> elements — it will select any element that cannot be edited by the user.
... selectors level 4the definition of ':read-only' in that specification.
:read-write - CSS: Cascading Style Sheets
input:-moz-read-only, textarea:-moz-read-only, input:read-only, textarea:read-only { border: 0; box-shadow: none; background-color: white; } textarea:-moz-read-write, textarea:read-write { box-shadow: inset 1px 1px 3px #ccc; border-radius: 5px; } you can find the full source code at readonly-confirmation.html; this renders like so: styling read-write non-form controls this selector doesn't just select <input>/<textarea> elements — it will select any element that can be edited by the user, such as a <p> element with contenteditable set on it.
... selectors level 4the definition of ':read-write' in that specification.
:state() - CSS: Cascading Style Sheets
WebCSS:state
examples fill in a simple example that nicely shows a typical usage of the selector, then perhaps some more complex examples.
... my code block and/or include a list of links to useful code samples that live elsewhere: x y z specifications specification status comment unknownthe definition of 'the :state() selector' in that specification.
:valid - CSS: Cascading Style Sheets
WebCSS:valid
/* selects any valid <input> */ input:valid { background-color: powderblue; } this pseudo-class is useful for highlighting correct fields for the user.
... selectors level 4the definition of ':valid' in that specification.
additive-symbols - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
negative - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
pad - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
prefix - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
suffix - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
symbols - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
@font-face - CSS: Cascading Style Sheets
to provide the browser with a hint as to what format a font resource is — so it can select a suitable one — it is possible to include a format type inside a format() function: src: url(ideal-sans-serif.woff) format("woff"), url(basic-sans-serif.ttf) format("truetype"); the available types are: "woff", "woff2", "truetype", "opentype", "embedded-opentype", and "svg".
... @font-face cannot be declared within a css selector.
@keyframes - CSS: Cascading Style Sheets
each @keyframes rule contains a style list of keyframe selectors, which specify percentages along the animation when the keyframe occurs, and a block containing the styles for that keyframe.
...to { margin-top: 100px; } } @keyframes important2 { from { margin-top: 50px; margin-bottom: 100px; } to { margin-top: 150px !important; /* ignored */ margin-bottom: 50px; } } formal syntax @keyframes <keyframes-name> { <keyframe-block-list> }where <keyframes-name> = <custom-ident> | <string><keyframe-block-list> = <keyframe-block>+where <keyframe-block> = <keyframe-selector># { <declaration-list> }where <keyframe-selector> = from | to | <percentage> examples css animation examples see using css animations for examples.
-ms-high-contrast - CSS: Cascading Style Sheets
highlighttext: controls the color of selected text.
... highlight: controls the background color of selected text.
Coordinate systems - CSS: Cascading Style Sheets
let inner = document.queryselector(".inner"); let log = document.queryselector(".log"); function setcoords(e, type) { let idx = type + "x"; let idy = type + "y"; document.getelementbyid(idx).innertext = e[idx]; document.getelementbyid(idy).innertext = e[idy]; } a reference to the <div> inside the inner box which contains the paragraphs that will show the coordinate information is fetched into log.
... .outer { width: 1000px; height: 200px; background-color: red; } .inner { position: relative; width: 500px; height: 150px; top: 25px; left: 100px; background-color: blue; color: white; cursor: crosshair; user-select: none; -moz-user-select: none; -ms-user-select: none; -webkit-user-select: none; } .log { position: relative; width: 100%; text-align: center; } result here you can see the results in action.
CSS Animations tips and tricks - CSS: Cascading Style Sheets
function play() { document.queryselector(".box").classname = "box"; window.requestanimationframe(function(time) { window.requestanimationframe(function(time) { document.queryselector(".box").classname = "box changing"; }); }); } this looks weird, doesn't it?
... of course, we also need to add an event handler to our "run" button so it'll actually do something: document.queryselector(".runbutton").addeventlistener("click", play, false); result stopping an animation simply removing the animation-name applied to an element will make it jump or cut to its next state.
Aligning Items in a Flex Container - CSS: Cascading Style Sheets
i have targeted the first item using a first-child selector and set that item to align-self: stretch; another item has been selected using its class of selected and given align-self: center.
... you can switch them to display in the block direction for the language of your document by selecting flex-direction: column.
Breadcrumb Navigation - CSS: Cascading Style Sheets
recipe download this example note: the example above uses two selectors to insert content before every li except the first one.
... this could also be achieved using one selector only: .breadcrumb li:not(:first-child)::before { content: "→"; } this solution uses a more complex selector, but requires less rules.
Shorthand properties - CSS: Cascading Style Sheets
inherit sets the property value applied to a selected element to be the same as that of its parent element.
... initial sets the property value applied to a selected element to the initial value of that property.
Using CSS custom properties (variables) - CSS: Cascading Style Sheets
like any other property, this is written inside a ruleset, like so: element { --main-bg-color: brown; } note that the selector given to the ruleset defines the scope that the custom property can be used in.
...the property is only set for the matching selector and its descendants, like any normal css.
background-blend-mode - CSS: Cascading Style Sheets
it also applies to ::first-letter and ::first-line.inheritednocomputed valueas specifiedanimation typediscrete formal syntax <blend-mode>#where <blend-mode> = normal | multiply | screen | overlay | darken | lighten | color-dodge | color-burn | hard-light | soft-light | difference | exclusion | hue | saturation | color | luminosity examples <div id="div"></div> <select id="select"> <option>normal</option> <option>multiply</option> <option selected>screen</option> <option>overlay</option> <option>darken</option> <option>lighten</option> <option>color-dodge</option> <option>color-burn</option> <option>hard-light</option> <option>soft-light</option> <option>difference</option> <option>exclusion</option> <option>h...
...ue</option> <option>saturation</option> <option>color</option> <option>luminosity</option> </select> #div { width: 300px; height: 300px; background: url('https://mdn.mozillademos.org/files/8543/br.png'),url('https://mdn.mozillademos.org/files/8545/tr.png'); background-blend-mode: screen; } document.getelementbyid("select").onchange = function(event) { document.getelementbyid("div").style.backgroundblendmode = document.getelementbyid("select").selectedoptions[0].innerhtml; } console.log(document.getelementbyid('div')); specifications specification status comment compositing and blending level 1the definition of 'background-blend-mode' in that specification.
background-image - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
background - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
border-image-source - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
clip-path - CSS: Cascading Style Sheets
WebCSSclip-path
img id="clipped" src="https://udn.realityripple.com/samples/db/4f9fbd7dfb.svg" alt="mdn logo"> <svg height="0" width="0"> <defs> <clippath id="cross"> <rect y="110" x="137" width="90" height="90"/> <rect x="0" y="110" width="90" height="90"/> <rect x="137" y="0" width="90" height="90"/> <rect x="0" y="0" width="90" height="90"/> </clippath> </defs> </svg> <select id="clippath"> <option value="none">none</option> <option value="circle(100px at 110px 100px)">circle</option> <option value="url(#cross)" selected>cross</option> <option value="inset(20px round 20px)">inset</option> <option value="path('m 0 200 l 0,110 a 110,90 0,0,1 240,100 l 200 340 z')">path</option> </select> css #clipped { margin-bottom: 20px; clip-path: url(#cross); } j...
...avascript const clippathselect = document.getelementbyid("clippath"); clippathselect.addeventlistener("change", function (evt) { document.getelementbyid("clipped").style.clippath = evt.target.value; }); result specifications specification status comment css masking module level 1the definition of 'clip-path' in that specification.
content - CSS: Cascading Style Sheets
WebCSScontent
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<leader-type> = dotted | solid | space | <string>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
cross-fade() - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)where <image-tags> = ltr | rtl<image-src> = <url> | <string><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><linear-gradient()> = linear-gradient( [ <angle> | to <side-or-corner> ]?
hyphens - CSS: Cascading Style Sheets
WebCSShyphens
however, suggested line break opportunities (see suggesting line break opportunities below) will override automatic break point selection when present.
... note: the auto setting's behavior depends on the language being properly tagged to select the appropriate hyphenation rules.
<image> - CSS: Cascading Style Sheets
WebCSSimage
a selection of images chosed based on resolution defined by the image-set() function.
...*/ image-set('test.jpg' 1x, 'test-2x.jpg' 2x) /* a selection of images with varying resolutions */ invalid images nourl.jpg /* an image file must be defined using the url() function.
justify-content - CSS: Cascading Style Sheets
ition> = center | start | end | flex-start | flex-end examples setting flex item distribution css #container { display: flex; justify-content: space-between; /* can be changed in the live sample */ } #container > div { width: 100px; height: 100px; background: linear-gradient(-45deg, #788cff, #b4c8ff); } html <div id="container"> <div></div> <div></div> <div></div> </div> <select id="justifycontent"> <option value="start">start</option> <option value="end">end</option> <option value="flex-start">flex-start</option> <option value="flex-end">flex-end</option> <option value="center">center</option> <option value="left">left</option> <option value="right">right</option> <option value="baseline">baseline</option> <option value="first baseline">first baseline<...
.../option> <option value="last baseline">last baseline</option> <option value="space-between" selected>space-between</option> <option value="space-around">space-around</option> <option value="space-evenly">space-evenly</option> <option value="stretch">stretch</option> </select> javascript var justifycontent = document.getelementbyid("justifycontent"); justifycontent.addeventlistener("change", function (evt) { document.getelementbyid("container").style.justifycontent = evt.target.value; }); result specifications specification status comment css box alignment module level 3the definition of 'justify-content' in that specification.
mask-border-source - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
mask-clip - CSS: Cascading Style Sheets
WebCSSmask-clip
g-box | content-box examples clipping a mask to the border box css #masked { width: 100px; height: 100px; background-color: #8cffa0; margin: 20px; border: 20px solid #8ca0ff; padding: 20px; mask-image: url(https://mdn.mozillademos.org/files/12668/mdn.svg); mask-size: 100% 100%; mask-clip: border-box; /* can be changed in the live sample */ } html <div id="masked"> </div> <select id="clipbox"> <option value="content-box">content-box</option> <option value="padding-box">padding-box</option> <option value="border-box" selected>border-box</option> <option value="margin-box">margin-box</option> <option value="fill-box">fill-box</option> <option value="stroke-box">stroke-box</option> <option value="view-box">view-box</option> <option value="no-clip">no-clip</op...
...tion> </select> javascript var clipbox = document.getelementbyid("clipbox"); clipbox.addeventlistener("change", function (evt) { document.getelementbyid("masked").style.maskclip = evt.target.value; }); result specifications specification status comment css masking module level 1the definition of 'mask-clip' in that specification.
mask-image - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...)<gradient> = <linear-gradient()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()>where <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
mask - CSS: Cascading Style Sheets
WebCSSmask
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...nt()> | <repeating-linear-gradient()> | <radial-gradient()> | <repeating-radial-gradient()> | <conic-gradient()><box> = border-box | padding-box | content-boxwhere <image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
revert - CSS: Cascading Style Sheets
WebCSSrevert
in contrast, user-agent stylesheets set default values on the basis of css selectors.
... h3 { font-weight: normal; color: blue; border-bottom: 1px solid grey; } <h3>this will have custom styles</h3> <p>just some text</p> <h3 style="all: revert">this should be reverted to browser/user defaults</h3> <p>just some text</p> revert on a parent reverting effectively removes the value for the element you select with some rule and only for that element.
shape-outside - CSS: Cascading Style Sheets
)<image-set()> = image-set( <image-set-option># )<element()> = element( <id-selector> )<paint()> = paint( <ident>, <declaration-value>?
...| [ [ left | right ] <length-percentage> ] && [ [ top | bottom ] <length-percentage> ] ]<fill-rule> = nonzero | evenodd<image-tags> = ltr | rtl<image-src> = <url> | <string><color> = <rgb()> | <rgba()> | <hsl()> | <hsla()> | <hex-color> | <named-color> | currentcolor | <deprecated-system-color><image-set-option> = [ <image> | <string> ] <resolution><id-selector> = <hash-token><cf-mixing-image> = <percentage>?
transition-timing-function - CSS: Cascading Style Sheets
m: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration: 7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration: 2s; } function updatetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .ease { transition-timing-function: ease; } .easein { transition-timing-function: ease-in; } .easeout { transition-timing-function: ease-out; } .easeinout { transition-timing-function: ease-in-out; } ...
...tom: 4px; background-color: black; border: 1px solid red; color: white; transition-property: all; transition-duration:7s; } .parent > div.box1{ width: 90vw; min-width: 24em; background-color: magenta; color: yellow; border: 1px solid orange; transition-property: all; transition-duration:2s; } function updatetransition() { var els = document.queryselectorall(".parent > div[class]"); for(var c = els.length, i = 0; i < c; i++) { els[i].classlist.toggle("box1"); } } var intervalid = window.setinterval(updatetransition, 10000); .jump-start { transition-timing-function: steps(5, jump-start); } .jump-end { transition-timing-function: steps(5, jump-end); } .jump-none { transition-timing-function: steps(5, jump-none); } .jump-both ...
white-space - CSS: Cascading Style Sheets
itedyescomputed valueas specifiedanimation typediscrete formal syntax normal | pre | nowrap | pre-wrap | pre-line | break-spaces examples basic example code { white-space: pre; } line breaks inside <pre> elements pre { word-wrap: break-word; /* ie 5.5-7 */ white-space: pre-wrap; /* modern browsers */ } in action html <div id="css-code" class="box"> p { white-space: <select> <option>normal</option> <option>nowrap</option> <option>pre</option> <option>pre-wrap</option> <option>pre-line</option> <option>break-spaces</option> </select> } </div> <div id="results" class="box"> <p> lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua.
... excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum.</p> </div> .box { width: 300px; padding: 16px; border-radius: 10px; } #css-code { background-color: rgb(220, 220, 220); font-size: 16px; font-family: monospace; } #css-code select { font-family: inherit; } #results { background-color: rgb(230, 230, 230); overflow-x: scroll; height: 400px; white-space: normal; font-size: 14px; } var select = document.queryselector("#css-code select"); var results = document.queryselector("#results p"); select.addeventlistener("change", function(e) { results.setattribute("style", "white-space: "+e.target.value); }) <p> lor...
Adding captions and subtitles to HTML5 video - Developer guides
ng="es" src="captions/vtt/sintel-es.vtt"> </video> as you can see, each <track> element has the following attributes set: kind is given a value of subtitles, indicating the type of content the files contain label is given a value indicating which language that subtitle set is for — for example english or deutsch — these labels will appear in the user interface to allow the user to easily select which subtitle language they want to see.
... the default attribute is set on the english <track> element, indicating to the browser that this is the default subtitle file definition to use when subtitles have been turned on and the user has not made a specific selection.
Creating and triggering events - Developer guides
elem.dispatchevent(event); event bubbling it is often desirable to trigger an event from a child element, and have an ancestor catch it; optionally, with data: <form> <textarea></textarea> </form> const form = document.queryselector('form'); const textarea = document.queryselector('textarea'); // create a new event, allow bubbling, and provide any data you want to pass to the "detail" property const eventawesome = new customevent('awesome', { bubbles: true, detail: { text: () => textarea.value } }); // the form element listens for the custom "awesome" event and then consoles the output of the passed text() method for...
...ail.text())); // as the user types, the textarea inside the form dispatches/triggers the event to fire, and uses itself as the starting point textarea.addeventlistener('input', e => e.target.dispatchevent(eventawesome)); creating and dispatching events dynamically elements can listen for events that haven't been created yet: <form> <textarea></textarea> </form> const form = document.queryselector('form'); const textarea = document.queryselector('textarea'); form.addeventlistener('awesome', e => console.log(e.detail.text())); textarea.addeventlistener('input', function() { // create and dispatch/trigger an event on the fly // note: optionally, we've also leveraged the "function expression" (instead of the "arrow function expression") so "this" will represent the element this.disp...
DOM onevent handlers - Developer guides
you can specify an on<…> event handler for a particular event (such as click) for a given object in different ways: adding an html attribute named on<eventtype>: <button onclick="handleclick()">, or by setting the corresponding property from javascript: document.queryselector("button").onclick = function(event) { … }.
... let logelement = document.queryselector('div'); let el = document.queryselector("a"); function log(msg) { logelement.innerhtml += `${msg}<br>` }; function anchoronclick(event) { log("changed onclick handler") }; // original handler log(`element's onclick as a javascript property: <code> ${el.onclick.tostring()} </code>`); //changing handler using .onclick log('<br>changing onclick handler using <strong> onclick property </strong> ...
HTML5 - Developer guides
WebGuideHTMLHTML5
using files from web applications support for the new html5 file api has been added to gecko, making it possible for web applications to access local files selected by the user.
... this includes support for selecting multiple files using the <input> of type file html element's new multiple attribute.
HTML attribute: required - HTML: Hypertext Markup Language
the required attribute is supported by text, search, url, tel, email, password, date, month, week, time, datetime-local, number, checkbox, radio, file, <input> types along with the <select> and <textarea> form control elements.
... usability when including the required attribute, provide a visible indication near the control informing the user that the input, select or textarea is required.
<a>: The Anchor element - HTML: Hypertext Markup Language
WebHTMLElementa
<a href="" download="my_painting.png">download my painting</a> </p> <canvas width="300" height="300"></canvas> css html { font-family: sans-serif; } canvas { background: #fff; border: 1px dashed; } a { display: inline-block; background: #69c; color: #fff; padding: 5px 10px; } javascript var canvas = document.queryselector('canvas'), c = canvas.getcontext('2d'); c.fillstyle = 'hotpink'; function draw(x, y) { if (isdrawing) { c.beginpath(); c.arc(x, y, 10, 0, math.pi*2); c.closepath(); c.fill(); } } canvas.addeventlistener('mousemove', event => draw(event.offsetx, event.offsety) ); canvas.addeventlistener('mousedown', () => isdrawing = true); canvas.addeventlistener('mouseup', () => isd...
...rawing = false); document.queryselector('a').addeventlistener('click', event => event.target.href = canvas.todataurl() ); result security and privacy <a> elements can have consequences for users’ security and privacy.
<code>: The Inline Code element - HTML: Hypertext Markup Language
WebHTMLElementcode
example a paragraph of text that includes <code>: <p>the function <code>selectall()</code> highlights all the text in the input field so the user can, for example, copy or delete the text.</p> the output generated by this html looks like this: notes to represent multiple lines of code, wrap the <code> element within a <pre> element.
... a css rule can be defined for the code selector to override the browser's default font face.
<dialog>: The Dialog element - HTML: Hypertext Markup Language
WebHTMLElementdialog
html <!-- simple pop-up dialog box containing a form --> <dialog id="favdialog"> <form method="dialog"> <p><label>favorite animal: <select> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button value="cancel">cancel</button> <button id="confirmbtn" value="default">confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu> <outpu...
...t aria-live="polite"></output> javascript var updatebutton = document.getelementbyid('updatedetails'); var favdialog = document.getelementbyid('favdialog'); var outputbox = document.queryselector('output'); var selectel = document.queryselector('select'); var confirmbtn = document.getelementbyid('confirmbtn'); // "update details" button opens the <dialog> modally updatebutton.addeventlistener('click', function onopen() { if (typeof favdialog.showmodal === "function") { favdialog.showmodal(); } else { alert("the <dialog> api is not supported by this browser"); } }); // "favorite animal" input sets the value of the submit button selectel.addeventlistener('change', function onselect(e) { confirmbtn.value = selectel.value; }); // "confirm" button of form triggers "close" on dialo...
<input type="search"> - HTML: Hypertext Markup Language
WebHTMLElementinputsearch
idl attributes value methods select(), setrangetext(), setselectionrange().
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
<input type="text"> - HTML: Hypertext Markup Language
WebHTMLElementinputtext
events change and input supported common attributes autocomplete, list, maxlength, minlength, pattern, placeholder, readonly, required and size idl attributes list, value methods select(), setrangetext() and setselectionrange().
...the values provided are suggestions, not requirements: users can select from this predefined list or provide a different value.
<kbd>: The Keyboard Input element - HTML: Hypertext Markup Language
WebHTMLElementkbd
you can define a custom style to override the browser's default font selection for the <kbd> element, although the user's preferences may potentially override your css.
...then, inside that, both the menu and menu item names are contained within both <kbd> and <samp>, indicating an input which is selected from a screen widget.
<nextid>: The NeXT ID element (Obsolete) - HTML: Hypertext Markup Language
WebHTMLElementnextid
html "1.m" - version 1 (second release) in the next published draft of html, <nextid> <nextid> can be individually deselected for display with a simple sgml command.
...<form>, <input>, <textarea>, <select>, and <option> html version 2 strict level 1 this is like regular level 1 but it also excludes these depreciated elements, along with such constructs as nesting a header (<h*> element) within a link (<a> element) html version 2 level 2 this is the default and includes and permits all html level 2 functions and elements and attributes html version 2 strict level 2 this excludes these depreciated elements and also forbids such constructs as nesting a header (<h*> element) within a link (<a> element), or having a forms <input> element which is not within a block level element such as <p> html version 3.2 <nextid> has vanished altogether, never to be h...
<template>: The Content Template element - HTML: Hypertext Markup Language
WebHTMLElementtemplate
if ('content' in document.createelement('template')) { // instantiate the table with the existing html tbody // and the row with the template var tbody = document.queryselector("tbody"); var template = document.queryselector('#productrow'); // clone the new row and insert it into the table var clone = template.content.clonenode(true); var td = clone.queryselectorall("td"); td[0].textcontent = "1235646565"; td[1].textcontent = "stuff"; tbody.appendchild(clone); // clone the new row and insert it into the table var clone2 = templat...
...e.content.clonenode(true); td = clone2.queryselectorall("td"); td[0].textcontent = "0384928528"; td[1].textcontent = "acme kidney beans 2"; tbody.appendchild(clone2); } else { // find another way to add the rows to the table because // the html template element is not supported.
<video>: The Video Embed element - HTML: Hypertext Markup Language
WebHTMLElementvideo
controlslist the controlslist attribute, when specified, helps the browser select what controls to show on the media element whenever the browser shows its own set of controls (e.g.
... for example, to detect when audio tracks are added to or removed from a <video> element, you can use code like this: var elem = document.queryselector("video"); elem.audiotracklist.onaddtrack = function(event) { trackeditor.addtrack(event.track); }; elem.audiotracklist.onremovetrack = function(event) { trackeditor.removetrack(event.track); }; this code watches for audio tracks to be added to and removed from the element, and calls a hypothetical function on a track editor to register and remove the track from the editor's list of avai...
tabindex - HTML: Hypertext Markup Language
the content should be semantically described using interactive elements (<a>, <button>, <details>, <input>, <select>, <textarea>, etc.) instead.
... recommendation only supported on <a>, <area>, <button>, <input>, <object>, <select>, and <textarea>.
Link types - HTML: Hypertext Markup Language
if there are multiple <link rel="icon">s, the browser uses their media, type, and sizes attributes to select the most appropriate icon.
... note: apple's ios does not use this link type, nor the sizes attribute, like others mobile browsers do, to select a webpage icon for web clip or a start-up placeholder.
HTTP headers - HTTP
WebHTTPHeaders
content-dpr a number that indicates the ratio between physical pixels over css pixels of the selected image response.
...this is a hint and is not necessarily under the full control of the user: the server should always pay attention not to override an explicit user choice (like selecting a language from a dropdown).
Intl.PluralRules() constructor - JavaScript
var pr = new intl.pluralrules(); pr.select(0); // → 'other' if in us english locale pr.select(1); // → 'one' if in us english locale pr.select(2); // → 'other' if in us english locale using options the results can be customized using the options argument, which has one property called type which you can set to ordinal.
... var pr = new intl.pluralrules('en-us', { type: 'ordinal' }); pr.select(0); // → 'other' pr.select(1); // → 'one' pr.select(2); // → 'two' pr.select(3); // → 'few' pr.select(4); // → 'other' pr.select(42); // → 'two' specifications specification ecmascript internationalization api (ecma-402)the definition of 'intl.pluralrules() constructor' in that specification.
Intl.PluralRules - JavaScript
intl.pluralrules.prototype.select() returns a string indicating which plural rule to use for locale-aware formatting.
...in order to get the format of the language used in the user interface of your application, make sure to specify that language (and possibly some fallback languages) using the locales argument: // arabic has different plural rules new intl.pluralrules('ar-eg').select(0); // → 'zero' new intl.pluralrules('ar-eg').select(1); // → 'one' new intl.pluralrules('ar-eg').select(2); // → 'two' new intl.pluralrules('ar-eg').select(6); // → 'few' new intl.pluralrules('ar-eg').select(18); // → 'many' specifications specification ecmascript internationalization api (ecma-402)the definition of 'intl.pluralrules' in that specification.
Proxy - JavaScript
let view = new proxy({ selected: null }, { set: function(obj, prop, newval) { let oldval = obj[prop]; if (prop === 'selected') { if (oldval) { oldval.setattribute('aria-selected', 'false'); } if (newval) { newval.setattribute('aria-selected', 'true'); } } // the default behavior to store the value obj[prop] = newval; // indicate success return true; } ...
...}); let i1 = view.selected = document.getelementbyid('item-1'); //giving error here, i1 is null console.log(i1.getattribute('aria-selected')); // 'true' let i2 = view.selected = document.getelementbyid('item-2'); console.log(i1.getattribute('aria-selected')); // 'false' console.log(i2.getattribute('aria-selected')); // 'true' note: even if selected: !null, then giving oldval.setattribute is not a function value correction and an extra property the products proxy object evaluates the passed value and converts it to an array if needed.
The "codecs" parameter in common media types - Web media technologies
mc the two-digit matrix_coefficients constant selects the matrix coefficients used to convert the red, blue, and green channels into luma and chroma signals.
...firstly, you can use it with the <source> element when creating an <audio> or <video> element, in order to establish a group of options for the browser to choose from when selecting the format of the media to present to the user in the element.
Critical rendering path - Web Performance
in terms of selector performance, less specific selectors are faster than more specific ones.
...when it comes to css, selector performance optimization, improvements will only be in microseconds.
Privacy, permissions, and information security
privacy exceptions may be granted to specific sites or applications, but it may also be granted conditionally, such as by permitting only a select group of people to access it, or only allowing the information to be accessed and used for a limited period of time.
... and auditing certificates, creating a database of public logs that can be used to help identify incorrect or malicious certificates content security policy provides the ability to define the extent to which a document's content can be accessed by other devices over the web; used in particular to prevent or mitigate attacks on the server feature policy lets web developers selectively enable, disable, and modify the behavior of certain features and apis both for a document and for subdocuments loaded in <iframe>s <iframe>'s allow attribute technically part of feature policy, the allow attribute on an <iframe> specifies which web features the document in the frame should be allowed to access http public key pinning (hpkp) hpkp is used by servers to ...
Progressive loading - Progressive web apps (PWAs)
placeholder image instead of having all the screenshots of games referenced in <img> element src attributes, which will force the browser to download them automatically, we can do it selectively via javascript.
... loading via javascript the app.js file processes the data-src attributes like so: let imagestoload = document.queryselectorall('img[data-src]'); const loadimages = (image) => { image.setattribute('src', image.getattribute('data-src')); image.onload = () => { image.removeattribute('data-src'); }; }; the imagestoload variable contains references to all the images, while the loadimages function moves the path from data-src to src.
Responsive Navigation Patterns - Progressive web apps (PWAs)
the user can flip the menu open and select from the rest of the navigation items.
... you could select the items that remain on the bottom.
SVG Attribute reference - SVG: Scalable Vector Graphics
WebSVGAttribute
to transform transform-origin type u u1 u2 underline-position underline-thickness unicode unicode-bidi unicode-range units-per-em v v-alphabetic v-hanging v-ideographic v-mathematical values vector-effect version vert-adv-y vert-origin-x vert-origin-y viewbox viewtarget visibility w width widths word-spacing writing-mode x x x-height x1 x2 xchannelselector xlink:actuate xlink:arcrole xlink:href xlink:role xlink:show xlink:title xlink:type xml:base xml:lang xml:space y y y1 y2 ychannelselector z z zoomandpan svg attributes by category generic attributes core attributes id, lang, tabindex, xml:base, xml:lang, xml:space style attributes class, style conditional processing attributes externalresourcesrequired, requir...
...agover, ondragstart, ondrop, ondurationchange, onemptied, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting graphical event attributes onactivate, onfocusin, onfocusout ...
mimeTypes.rdf corruption - SVG: Scalable Vector Graphics
try and open a local .svg file using mozilla and when the "opening ..." dialog comes up, select the "open with" radio button and choose any .exe except firefox.exe/mozilla.exe.
...select the svg entry, click the remove action button and then click close to close the download actions window.
translate - XPath
example <xsl:value-of select="translate('the quick brown fox.', 'abcdefghijklmnopqrstuvwxyz', 'abcdefghijklmnopqrstuvwxyz')" /> output the quick brown fox.
... example <xsl:value-of select="translate('the quick brown fox.', 'brown', 'red')" /> output the quick red fdx.
XPath
xpath is mainly used in xslt, but can also be used as a much more powerful way of navigating through the dom of any xml-like language document using xpathexpression, such as html and svg, instead of relying on the document.getelementbyid() or parentnode.queryselectorall() methods, the node.childnodes properties, and other dom core features.
... related topics xslt, xquery, xml, dom, jxon, jsonpath comparison of css selectors and xpath ...
<xsl:copy-of> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementcopy-of
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes the <xsl:copy-of> element makes a deep copy (including descendant nodes) of whatever the select attribute specifies to the output document.
... syntax <xsl:copy-of select=expression /> required attributes select uses an xpath expression that specifies what is to be copied.
<xsl:for-each> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementfor-each
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes the <xsl:for-each> element selects a set of nodes and processes each of them in the same way.
... syntax <xsl:for-each select=expression> <xsl:sort> [optional] template </xsl:for-each> required attributes select uses an xpath expression to select nodes to be processed.
<xsl:param> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementparam
syntax <xsl:param name=name select=expression> template </xsl:param> required attributes name names the parameter.
... optional attributes select uses an xpath expression to provide a default value if none is specified.
<xsl:variable> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementvariable
because xslt permits no side-effects, once the value of the variable has been established, it remains the same until the variable goes out of scope syntax <xsl:variable name=name select=expression > template </xsl:variable> required attributes name gives the variable a name.
... optional attributes select defines the value of the variable through an xpath expression.
<xsl:with-param> - XSLT: Extensible Stylesheet Language Transformations
syntax <xsl:with-param name=name select=expression> template </xsl:with-param> required attributes name gives this parameter a name.
... optional attributes select defines the value of the parameter through an xpath expression.
Basic Example - XSLT: Extensible Stylesheet Language Transformations
</myns:body> </myns:article> figure 5 : xslt stylesheet <?xml version="1.0"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/xsl/transform" xmlns:myns="http://devedge.netscape.com/2002/de"> <xsl:output method="html" /> <xsl:template match="/"> <html> <head> <title> <xsl:value-of select="/myns:article/myns:title"/> </title> <style type="text/css"> .mybox {margin:10px 155px 0 50px; border: 1px dotted #639ace; padding:0 5px 0 5px;} </style> </head> <body> <p class="mybox"> <span class="title"> <xsl:value-of select="/myns:article/myns:title"/> </span> <br /> authors: <br /> ...
... <xsl:apply-templates select="/myns:article/myns:authors/myns:author"/> </p> <p class="mybox"> <xsl:apply-templates select="//myns:body"/> </p> </body> </html> </xsl:template> <xsl:template match="myns:author"> -- <xsl:value-of select="." /> <xsl:if test="@company"> :: <b> <xsl:value-of select="@company" /> </b> </xsl:if> <br /> </xsl:template> <xsl:template match="myns:body"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:template> <xsl:template match="@*|node()"> <xsl:copy> <xsl:apply-templates select="@*|node()"/> </xsl:copy> </xsl:template> </xsl:stylesheet> the example loads using synchronous xmlhttprequest both the .xsl (xslstyleshee...
Content Scripts - Archive of obsolete content
+ ' window.alert("the context menu was clicked on url:\\n" + href);' + '};' + 'window.addeventlistener("myaddonid-contextmenu-clicked",' + ' function(event){contextmenualert(event.detail);});' }); let cm = require("sdk/context-menu"); cm.item({ label: "alert url", context: [ cm.urlcontext(["*.mozilla.org"]), cm.selectorcontext("a[href]") ], contentscript: 'self.on("click", function (node, data) {' + ' var event = new customevent("myaddonid-contextmenu-clicked",' + ' {detail:node.href});' + ' window.dispatchevent(event);' + '});' }); cross-domain content scripts by default, content scripts don't ha...
Porting the Library Detector - Archive of obsolete content
finally, it listens to gbrowser's tabselect event, to update the contents of the box for that window.
XUL Migration Guide - Archive of obsolete content
this simple example modifies the selected tab's css to enable the user to highlight the selected tab: function highlightactivetab() { var window = require("sdk/window/utils").getmostrecentbrowserwindow(); var tab = require("sdk/tabs/utils").getactivetab(window); if (tab.style.getpropertyvalue('background-color')) { tab.style.setproperty('background-color','','important'); } else { tab.style.setproperty('background-co...
page-worker - Archive of obsolete content
for example, this add-on loads a page from wikipedia, and runs a content script in it to send all the headers back to the main add-on code: var pageworkers = require("sdk/page-worker"); // this content script sends header titles from the page to the add-on: var script = "var elements = document.queryselectorall('h2 > span'); " + "for (var i = 0; i < elements.length; i++) { " + " postmessage(elements[i].textcontent) " + "}"; // create a page worker that loads wikipedia: pageworkers.page({ contenturl: "http://en.wikipedia.org/wiki/internet", contentscript: script, contentscriptwhen: "ready", onmessage: function(message) { console.log(message); } ...
private-browsing - Archive of obsolete content
onents will not be displayed in private browser windows any menus or menu items created using the context-menu will not be shown in context menus that belong to private browser windows the page-mod module will not attach content scripts to documents belonging to private browser windows any panel objects will not be shown if the active window is a private browser window the selection module will not include any selections made in private browser windows add-ons that have opted in will see private windows, so they will need to use the private-browsing module to check whether objects are private, so as to avoid storing data derived from such objects.
High-Level APIs - Archive of obsolete content
selection get and set text and html selections in the current web page.
Displaying annotations - Archive of obsolete content
like the selector, the matcher also listens for the window's unload event and on unload sends a detach message to the main module, so the add-on can clean it up.
Overview - Archive of obsolete content
the selector enables the user to choose an element to annotate.
Annotator - Archive of obsolete content
the add-on is an annotator: it enables the user to select elements of web pages and enter notes (annotations) associated with them.
Developing for Firefox Mobile - Archive of obsolete content
ontext-menu not supported hotkeys supported indexed-db supported l10n supported notifications supported page-mod supported page-worker supported panel not supported passwords supported private-browsing not supported querystring supported request supported selection not supported self supported simple-prefs supported simple-storage supported system supported tabs supported timers supported ui not supported url supported widget not supported windows supported low-level apis /loader supported chrome suppo...
Using third-party modules (jpm) - Archive of obsolete content
to show the menu bar, click on the open menu icon and select "customize".
Dialogs and Prompts - Archive of obsolete content
displaying the standard "open file"/"save file"/"select folder" dialogs nsifilepicker prompts and the prompt service now that you understand dialogs, let's examine prompts.
Progress Listeners - Archive of obsolete content
firefox 3.5 includes a way to set up a listener for all tabs, selected and not: listening to events on all tabs.
Tabbox - Archive of obsolete content
handling onclosetab event assuming the tabbox, tabs, and tabpanels widgets with id's the same as their nodename, this function will correctly remove the current tab and tab panel for the onclosetab tabs event: function removetab(){ var tabbox = document.getelementbyid("tabbox"); var currentindex = tabbox.selectedindex; if(currentindex>=0){ var tabs=document.getelementbyid("tabs"); var tabpanels=document.getelementbyid("tabpanels"); tabpanels.removechild(tabpanels.childnodes[currentindex]); tabs.removeitemat(currentindex); /*work around if last tab is removed, widget fails to advance to next tab*/ if(-1 == tabbox.selectedindex && tabs.childnodes.length>0){ tabbox.selec...
XPath - Archive of obsolete content
xhr = new ajax('post','demo.xml',parsexml,'xml'); //ajax is a class written by javascript which return responsexml object to parsexml function function parsexml(obj)//obj is the returnxml object now { if(!obj.documentelement) { alert("your browser does't support this script!"); return; } var fields = [];//store the results if(window.activexobject) { var tobj = obj.documentelement.selectnodes("/root/field/item"); for(var i=0;i<tobj.length; i++) { fields.push(tobj[i].text); } } else { var tobj = obj.evaluate("/root/field/item",obj.documentelement,null, xpathresult.any_type, null); var tmp = tobj.iteratenext(); while(tmp) { fields.push(tmp.textcontent); tmp = tobj.iteratenext(); } } alert(fields); } //here is the demo xml file for xpath <?xml ver...
Creating custom Firefox extensions with the Mozilla build system - Archive of obsolete content
(if something goes wrong, figure out what, fix it and then come back here and add it to this article.) to make sure that the build really finished, launch firefox and check that your extension is listed when you select tools/extensions.
Extension Theming Guidelines - Archive of obsolete content
css selectors when writing stylesheet rules for windows that you are overlaying always try to be specific with the css selector.
Install Manifests - Archive of obsolete content
if this property is specified, when the extension is selected in the extensions list, the options button is enabled and will show this.
Adding windows and dialogs - Archive of obsolete content
attribute persistence user actions can change the state of your windows, such as selecting an option in a listbox, or entering text in a textbox.
Connecting to Remote Content - Archive of obsolete content
<?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/xsl/transform" xmlns:xul="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <xsl:template match="/data"> <xul:vbox> <xsl:for-each select="shops/name"> <xul:hbox> <xul:label value="name:" /> <xul:label> <xsl:value-of select="." /> </xul:label> </xul:hbox> </xsl:for-each> <xul:hbox> <xul:label value="total:" /> <xul:label> <xsl:value-of select="total" /> </xul:label> </xul:hbox> </xul:vbox> </xsl:template> </xsl:styles...
Custom XUL Elements with XBL - Archive of obsolete content
you can use the -moz-binding property with any css selector.
The Box Model - Archive of obsolete content
select toolbar buttons, menu items, textboxes, etc.
Signing an XPI - Archive of obsolete content
to find the name, in mozilla firefox navigate to the certificate manager (described in step 11), choose your certificates, select the new certificate, press view, choose details and look at the first entry in the certificate fields tree-view.
List of Mozilla-Based Applications - Archive of obsolete content
qsos xul editor tool for the qsos method qsos stands for qualification and selection of opensource software qtrax music client based on songbird quickstaf gui client for software testing automation framework uses xulrunner qutecom phone software previously named openwengo redcar text editor seems to use xulrunner red hat directory server server product uses nss red hat certificate system ser...
MMgc - Archive of obsolete content
now that we know when we start marking there are two conflicting goals to achieve in selecting the marking time slice: maintain the frame rate make sure the collector gets to the sweep stage soon enough to avoid too much heap expansion if we don't maintain the frame rate the movie will appear to pause and if we don't mark fast enough the mutator could get ahread of the collector and allocate memory so fast that the collection never finishes and memory grows unbounded.
Creating a Web based tone generator - Archive of obsolete content
var frequency = 0, currentsoundsample; var samplerate = 44100; function requestsounddata(sounddata) { if (!frequency) { return; // no sound selected } var k = 2* math.pi * frequency / samplerate; for (var i=0, size=sounddata.length; i<size; i++) { sounddata[i] = math.sin(k * currentsoundsample++); } } var audiodestination = new audiodatadestination(samplerate, requestsounddata); function start() { currentsoundsample = 0; frequency = parsefloat(document.getelement...
Installing plugins to Gecko embedding browsers on Windows - Archive of obsolete content
this information is written by a select group of installers, as mentioned above.
MCD, Mission Control Desktop, AKA AutoConfig - Archive of obsolete content
, dc=fr" cn -lll dn: ou=browser,ou=information,dc=int-evry,dc=fr dn: sn=http_server,ou=browser,ou=information,dc=int-evry, dc=fr cn: web1.int-evry.fr cn: web2.int-evry.fr dn: sn=http_unix_file, ou=browser,ou=information,dc=int-evry, dc=fr cn: /browser/config_file_unix.jsc dn: sn=http_win_file, ou=browser,ou=information,dc=int-evry, dc=fr cn: /browser/config_file_win.jsc netscape.cfg here we select an operational ldap server simply by testing a ldap query, to make sure that our ldap queries for setting preferences will be answered.
Creating a Mozilla Extension - Archive of obsolete content
a mozilla extension is an installable enhancement to the mozilla browser that provides additional functionality (for example linky, which adds an item to the context menu for opening multiple links in a document or selection).
Getting Started - Archive of obsolete content
this section defines the normal button in its basic state (there is no mouse over it, it's not disabled, and it's not selected).
FAQ - Archive of obsolete content
c will select classic and m will select modern.
Creating a Skin for Firefox/Getting Started - Archive of obsolete content
this section defines the normal button in its basic state (there is no mouse over it, it's not disabled, and it's not selected).
Download Manager preferences - Archive of obsolete content
preference description browser.download.dir a local folder the user may have selected for downloaded files to be saved.
Layout FAQ - Archive of obsolete content
you can work around it by removing display:table in the style rule with the "#main" selector or adding clear:both to it.
Layout System Overview - Archive of obsolete content
the presentation shell also receives notifications about changes in cursor and focus states, whereby the selection and caret updates can be made visible.
JavaScript crypto - Archive of obsolete content
do not select this value unless you can show that your random number generator is secure.
Jetpack Snippets - Archive of obsolete content
('script'); firebug.setattribute('src','http://getfirebug.com/releases/lite/1.2/firebug-lite-compressed.js'); document.body.appendchild(firebug); (function(){if(window.firebug.version){firebug.init();}else{settimeout(arguments.callee);}})();void(firebug); ]]></script> </body></html>, width: 800, //wide enough to use firebug onselect: function(slide) { slide.slide(800, true); }}); calling into a slidebar from the global jetpack scope jetpack.slidebar.append({ onready: function (slide) { // call out to a global function, passing the slidebar object exinitslidebar(slide); }, ...});function exinitslidebar(aslidebar) { // this variable will now be global slider = aslidebar;} // then, accessing the sl...
slideBar - Archive of obsolete content
when a slidebar feature is selected, its contents will be revealed from behind the current web page.
UI - Archive of obsolete content
ing entries and access elements into the toolbar panel a movable, expandable, and custom styled content element to display jetpack content tabs adding events and interacting with browser tabs and their contained documents statusbar low-level functions and basic calls notifications a system for alerting users via provided ui mechanisms selection interacting with user-selected content window mitigates and eases interactions between different browser windows ...
Microsummary XML grammar reference - Archive of obsolete content
example the microsummary generator created in the creating a microsummary tutorial: <?xml version="1.0" encoding="utf-8"?> <generator xmlns="http://www.mozilla.org/microsummaries/0.1" name="firefox download count"> <template> <transform xmlns="http://www.w3.org/1999/xsl/transform" version="1.0"> <output method="text"/> <template match="/"> <value-of select="id('download-count')"/> <text> fx downloads</text> </template> </transform> </template> <pages> <include>http://(www\.)?spreadfirefox\.com/(index\.php)?</include> </pages> </generator> namespace the namespace uri for microsummary generator xml documents is: http://www.mozilla.org/microsummaries/0.1 all elements in a microsummary generator document should be in this ...
Microsummary topics - Archive of obsolete content
<?xml version="1.0" encoding="utf-8"?> \ <generator xmlns="http://www.mozilla.org/microsummaries/0.1" \ name="firefox download count" \ uri="urn:{835daeb3-6760-47fa-8f4f-8e4fdea1fb16}"> \ <template> \ <transform xmlns="http://www.w3.org/1999/xsl/transform" version="1.0"> \ <output method="text"/> \ <template match="/"> \ <value-of select="id(\'download-count\')"/> \ <text> fx downloads</text> \ </template> \ </transform> \ </template> \ <pages> <include>http://(www\.)?spreadfirefox\.com/(index\.php)?</include> </pages> </generator> \ '; var domparser = components.classes["@mozilla.org/xmlextras/domparser;1"].
Plug-n-Hack Phase1 - Archive of obsolete content
so if you select the “zap scan” command then you will be prompted to select a site from the list of sites currently known to zap.
Extensions - Archive of obsolete content
then install the extension by either dragging and dropping the extension onto the dialog, or by clicking the “install…” button, navigating to the extension and selecting it for installation.
Installer - Archive of obsolete content
one interesting side effect is that after this change, you can select a link to a .webapp file in a web page and you get it run by prism - in ie this runs anywhere, but this won't work in firefox unless the webapp is being issued with an appropriate mime type on the server: application/x-webapp works (see an example ).
RDF Datasource How-To - Archive of obsolete content
if you take this approach, you won't be able to selectively implement methods of the nsirdfdatasource interface; instead, all of the methods will be "forwarded" to the in-memory datasource.
Remotely debugging Firefox for Metro - Archive of obsolete content
connecting on the desktop on the desktop, open the web developer menu and select "connect...".
Running Tamarin performance tests - Archive of obsolete content
other tests may be specified by selecting ./runtests.py -c [misc,scimark,jsbench].
Writing textual data - Archive of obsolete content
unsupported characters you can specify what should happen with characters that are not supported by the selected character encoding.
XBL 1.0 Reference - Archive of obsolete content
he nsidomdocumentxbl interface anonymous content introduction scoping and access using the dom content generation rules for generation attribute forwarding insertion points <children> handling dom changes event flow and targeting flow and targeting across scopes focus and blur events mouseover and mouseout events anonymous content and css selectors and scopes binding stylesheets binding implementations introduction methods properties inheritance of implementations event handlers example - sticky notes updated and adjusted for the current firefox implementation.
Mac stub installer - Archive of obsolete content
then add the componentx into the appropriate setup types so the installer module installs when users select the setup types you choose it to be in.
Unix stub installer - Archive of obsolete content
then add the componentx into the appropriate setup types so the installer module installs it when users select the setup types you choose it to be in.
Windows stub installer - Archive of obsolete content
then add the component <component> into the appropriate setup types so the installer module installs it when users select the setup types you choose it to be in.
A XUL Bestiary - Archive of obsolete content
i selected items for this group because they seemed to be either shrouded in mystery, misused as concepts or terms, or underestimated according to their role in xul and cross-platform development.
allowevents - Archive of obsolete content
this means that elements placed inside a listitem do not respond to events, and instead clicking the mouse simply selects that item within the list.
autofill - Archive of obsolete content
if false, the default, the value will not be filled in until the user selects an item.
browser.type - Archive of obsolete content
this is the preferred value for any browser element in an application, which will use multiple browsers of equal privileges, and is unselected at the moment.
colorpicker.type - Archive of obsolete content
when the user clicks the button, a popup appears for the user to select a color.
commandupdater - Archive of obsolete content
for example, since the cut command is only valid when something is selected, a command updater might be used when the select event occurs.
completedefaultindex - Archive of obsolete content
if set to false or omitted, the value must be selected from the list.
current - Archive of obsolete content
to change the currently selected item in a listbox, use the listbox property selecteditem.
disableKeyNavigation - Archive of obsolete content
this is done incrementally, so typing more letters with select more specific items.
editable - Archive of obsolete content
the user may enter text into the textbox or select one of the choices by clicking from the drop-down.
events - Archive of obsolete content
select: occurs when the selected text changed.
forcecomplete - Archive of obsolete content
if false, it will only be filled in when the user selects an item.
group - Archive of obsolete content
if the user selects one the buttons, the others in the group are unchecked.
icon - Archive of obsolete content
ArchiveMozillaXULAttributeicon
possible values include: accept, cancel, help, open, save, find, clear, yes, no, apply, close, print, add, remove, refresh, go-forward, go-back, properties, select-font, select-color, network.
label - Archive of obsolete content
for an editable menuitem element the value of this attribute is copied to the menulist.value property upon user selection of the menuitem.
menuactive - Archive of obsolete content
a dommenuitemactive event will be sent to the item when the item is hovered over, and a dommenuiteminactive event will be sent to the item when the selection moves away.
onchange - Archive of obsolete content
a change event is fired in different ways for different xul input elements as listed below: onchange type: script code textbox when enter key is pressed radio/check box when the state is changed select list when the selected item is changed what is accessible the script context at this point can only access the following things: global values/functions i.e.
oncommand - Archive of obsolete content
this occurs when a user selects a menu item or presses a keyboard shortcut attached to the command.
onerrorcommand - Archive of obsolete content
« xul reference home onerrorcommand type: script code this event handler is called when an error occurs when selecting a result from the popup.
ontextcommand - Archive of obsolete content
« xul reference home ontextcommand obsolete since gecko 1.9.1 type: script code note: applies to: thunderbird, seamonkeythis event handler is called when a result is selected for the textbox.
ontextentered - Archive of obsolete content
« xul reference home ontextentered new in thunderbird 3requires seamonkey 2.0 type: script code this event handler is called when a result is selected for the textbox.
pending - Archive of obsolete content
if the user has turned on the "don't load tabs until selected" preference, the pending attribute is set on tabs until they get loaded.
primary - Archive of obsolete content
the attribute also controls whether the column picker allows the user to deselect this column.
textbox.autoFill - Archive of obsolete content
if false, the default, the value will not be filled in until the user selects an item.
textbox.forceComplete - Archive of obsolete content
if false, it will only be filled in when the user selects an item.
command - Archive of obsolete content
ArchiveMozillaXULEventscommand
menus can be activated by selecting them with the mouse or by pressing a shortcut key.
Uploading and Downloading Files - Archive of obsolete content
when the user selects a file, it can be uploaded to a server.
IO - Archive of obsolete content
ArchiveMozillaXULFileGuideIO
open and save dialogs you can show a dialog to the user to allow them to select a file to open or enter a filename for saving.
Menus - Archive of obsolete content
send page to device context-sendpage send page in an email context-viewbgimage views a background image context-undo undo editable text context-cut cuts to clipboard editable text context-copy copies to clipboard context-paste pastes from clipboard editable text context-delete deletes selection editable text context-selectall selects all context-searchselect selected text is searched context-viewpartialsource-selection views the selection source selection context-viewpartialsource-mathml views the mathml source mathml context-viewsource views the source context-viewinfo views the page info...
startFind - Archive of obsolete content
this opens the findbar, focuses the edit field for the search term, and selects its contents.
appendItem - Archive of obsolete content
example <script language="javascript"> function additemstolist(){ var list = document.getelementbyid('mymenulist'); // add item with just the label list.appenditem('one'); // add item with label and value list.appenditem('two', 999); // select the first item list.selectedindex = 0; } </script> <button label="add items" oncommand="additemstolist()"/> <menulist id="mymenulist"> <menupopup/> </menulist> see also insertitemat() removeitemat() ...
getElementsByAttribute - Archive of obsolete content
note that like most nodelists (but unlike the nodelist returned by queryselectorall), the nodelist returned by this method is live.
goDown - Archive of obsolete content
ArchiveMozillaXULMethodgoDown
« xul reference home godown() return type: no return value move the selection down by one item.
goUp - Archive of obsolete content
ArchiveMozillaXULMethodgoUp
« xul reference home goup() return type: no return value move the selection up by one item.
loadOneTab - Archive of obsolete content
parameters inbackground if true the tab will be loaded in the background, if false the tab will be the newly selected tab.
removeItemAt - Archive of obsolete content
<script language="javascript"> function removeselecteditem(){ var mylistbox = document.getelementbyid('mylistbox'); if(mylistbox.selectedindex == -1){ return; // no item selected so return }else{ mylistbox.removeitemat(mylistbox.selectedindex); } } function removeallitems(){ var mylistbox = document.getelementbyid('mylistbox'); var count = mylistbox.itemcount; while(count-- > 0){ mylistbox.removeitemat(0); } } </script> <button label="remove selected item" oncommand="removeselecteditem()"/> <button label="remove all items" oncommand="remov...
Panels - Archive of obsolete content
it is used when supporting temporary popup displays for selecting or entering data.
Positioning - Archive of obsolete content
if a context menu was opened via the keyboard only, the menu will appear at the top left corner of the document, or underneath the currently selected item if a list is focused.
controllers - Archive of obsolete content
="controller-example" title="controller example" onload="init();" xmlns="http://www.mozilla.org/keymaster/gatekeeper/there.is.only.xul"> <script> function init() { var list = document.getelementbyid("thelist"); var listcontroller = { supportscommand : function(cmd){ return (cmd == "cmd_delete"); }, iscommandenabled : function(cmd){ if (cmd == "cmd_delete") return (list.selecteditem != null); return false; }, docommand : function(cmd){ list.removeitemat(list.selectedindex); }, onevent : function(evt){ } }; list.controllers.appendcontroller(listcontroller); } </script> <listbox id="thelist"> <listitem label="ocean"/> <listitem label="desert"/> <listitem label="jungle"/> <listitem label="swamp"/> </listbox> </window> ...
currentItem - Archive of obsolete content
« xul reference currentitem type: listitem element returns the currently focused item in the list box, which is only useful in a multiple selection list box.
dateValue - Archive of obsolete content
« xul reference datevalue type: date the date that is currently entered or selected in the datepicker as a date object.
description - Archive of obsolete content
« xul reference description type: string set to the description of the currently selected menuitem.
focusedItem - Archive of obsolete content
« xul reference focuseditem type: radio element holds the currently focused item in the radiogroup, which may or may not be the same as the selected item.
menulist.image - Archive of obsolete content
« xul reference image type: image url the image associated with the currently selected item.
Building Trees - Archive of obsolete content
here is an example of a tree using an sqlite datasource: <tree datasources="profile:messages.sqlite" ref="*" querytype="storage" flags="dont-build-content"> <treecols> <treecol id="subject" label="subject" flex="3"/> <treecol id="sender" label="sender" flex="2"/> <treecol id="date" label="date" flex="1"/> </treecols> <template> <query> select subject, sender, date from messages </query> <action> <treechildren> <treeitem uri="?"> <treerow> <treecell label="?subject"/> <treecell label="?sender"/> <treecell label="?date"/> </treerow> </treeitem> </treechildren> </action> </template> </tree> features of the tree builder besides the label of ...
Multiple Rules - Archive of obsolete content
rs" expr="string-length(@name) - 1"/> </query> <rule> <where subject="?name" rel="contains" value=" "/> <action> <label uri="?" value="?name has two names for a total length of ?letters"/> </action> </rule> </template> </vbox> this example contains only one rule with a condition which checks for names that contain a space character, which has the effect of selecting only those people with multiple names.
Static Content - Archive of obsolete content
<radiogroup datasources="template-guide-photos4.rdf" ref="http://www.daml.org/2001/09/countries/country-ont#country" onselect="applyfilter(event.target.value);"> <radio label="all" selected="true"/> <template> <query> <content uri="?start"/> <triple subject="?country" predicate="http://www.w3.org/1999/02/22-rdf-syntax-ns#type" object="?start"/> <triple subject="?country" predicate="http://purl.org/dc/elements/1.1/title" object="?countrytit...
Complete - Archive of obsolete content
the css stylesheet uses the corresponding selector #all-custom-1 to provide the appropriate image: button-1.png file structure in the new file structure, there is a skin directory for all the themes.
SeaMonkey - making custom toolbar (SM ver. 1.x) - Archive of obsolete content
for a selection of code samples that you can copy and paste, and customize without any knowledge of programming, see this page: code samples your changes take effect when you restart the application.
Custom toolbar button - Archive of obsolete content
for a selection of code samples that you can copy and paste, and customize without any knowledge of programming, see this page: code samples your changes take effect when you restart the application.
Tree Widget Changes - Archive of obsolete content
some specific changes you should now get the tree selection object from the view, not the box object, meaning use tree.view.selection instead of tree.treeboxobject.selection.
Anonymous Content - Archive of obsolete content
this also applies to css selector rules.
Creating a Window - Archive of obsolete content
in this case, the all-important global.css file is selected.
Document Object Model - Archive of obsolete content
we could add additional code to get the selections from the drop-down boxes too.
Introduction - Archive of obsolete content
it is still possible to enable this for selected sites to let legacy apps to continue working, but for new remote applications you should use html to create your user interface instead; most of the features you used to have to use xul for are available in html5.
More Button Features - Archive of obsolete content
note that selecting one of these menu items does not change the label on the button, unlike a menulist.
More Wizards - Archive of obsolete content
in some cases however, you may want to have different pages of the wizard appear depending on what the user selects in earlier pages.
The Box Model - Archive of obsolete content
<vbox flex="1"> <description> enter your search criteria below and select the find button to begin the search.
XPCOM Examples - Archive of obsolete content
ame=window-mediator"].getservice(); mediator.queryinterface(components.interfaces.nsiwindowdatasource); var resource = elem.getattribute('id'); switchwindow = mediator.getwindowforresource(resource); if (switchwindow){ switchwindow.focus(); } } </script> a command handler was added to the menu element which calls the function switchfocus() with a parameter of the element that was selected from the menu.
XUL Tutorial - Archive of obsolete content
del the box model element positioning box model details groupboxes adding more elements more layout elements stacks and decks stack positioning tabboxes grids content panels splitters toolbars and menus toolbars simple menu bars more menu features popup menus scrolling menus events and scripts adding event handlers more event handlers keyboard shortcuts focus and selection commands updating commands broadcasters and observers document object model document object model modifying a xul interface manipulating lists box objects xpcom interfaces xpcom examples trees trees more tree features tree selection custom tree views tree view details tree box objects rdf and templates introduction to rdf templates trees and templates rdf datasou...
XUL accessibility guidelines - Archive of obsolete content
in a tabbed dialog, focus should normally start on the first control in the selected tab.
XUL accessibility tool - Archive of obsolete content
once the tool window has loaded, select either a local file, web url, or currently open window from the file menu to generate a xul report for that document.
The Implementation of the Application Object Model - Archive of obsolete content
one subtree nested inside another subtree can specify a different value for the persistent attribute, thus allowing the xul writer to specify a default for the whole window, but to still selectively override it for certain subtrees.
action - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
arrowscrollbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
assign - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
bbox - Archive of obsolete content
ArchiveMozillaXULbbox
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
binding - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related tbd ...
bindings - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related tbd ...
box - Archive of obsolete content
ArchiveMozillaXULbox
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements vbox, hbox ...
broadcaster - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
broadcasterset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
column - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, rows, row ...
columns - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, column, rows, row.
conditions - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
content - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata relacionados tbd ...
description - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes header a class used for headings.
dialogheader - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements dialog, window ...
dropmarker - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
grippy - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
groupbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
hbox - Archive of obsolete content
ArchiveMozillaXULhbox
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements box, vbox ...
image - Archive of obsolete content
ArchiveMozillaXULimage
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes alert-icon class that adds an alert icon.
keyset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
listcol - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcols, listhead, listheader, listitem ...
listcols - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listhead, listheader, listitem ...
listhead - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements listbox, listcell, listcol, listcols, listheader, listitem ...
member - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
menubar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements menu, menuitem, menulist, menupopup, menuseparator interfaces nsiaccessibleprovider ...
menupopup - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
notificationbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appendnotification( label , value , image , priority , buttons, eventcallback ) return type: element create a new notification and display it.
observes - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
page - Archive of obsolete content
ArchiveMozillaXULpage
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
panel - Archive of obsolete content
ArchiveMozillaXULpanel
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata hidepopup() return type: no return value closes the popup immediately.
param - Archive of obsolete content
ArchiveMozillaXULparam
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
popupset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements popup, menupopup ...
preferences - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related preferences system documentation: introduction: getting started | examples | troubleshooting reference: prefwindow | prefpane | preferences | pre...
progressmeter - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related interfaces nsiaccessibleprovider ...
query - Archive of obsolete content
ArchiveMozillaXULquery
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
queryset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
resizer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
row - Archive of obsolete content
ArchiveMozillaXULrow
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, column, rows.
rows - Archive of obsolete content
ArchiveMozillaXULrows
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements grid, columns, column, row.
rule - Archive of obsolete content
ArchiveMozillaXULrule
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
script - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scrollbox - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
scrollcorner - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
spacer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements separator, splitter ...
spinbuttons - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
stack - Archive of obsolete content
ArchiveMozillaXULstack
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related deck ...
statusbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements statusbarpanel interfaces nsiaccessibleprovider ...
stringbundle - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related xul property files ...
stringbundleset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
tabpanel - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tabbox, tabs, tab, tabpanels.
template - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
textnode - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
titlebar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
toolbar - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata style classes chromeclass-toolbar when this class is used, the toolbar will be hidden when a window is opened by setting the toolbar option to no in t...
toolbargrippy - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox interfaces nsiacc...
toolbarpalette - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarseparator, toolbarset, toolbarspacer, toolbarspring, toolbox ...
toolbarseparator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarset, toolbarspacer, toolbarspring, toolbox ...
toolbarset - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarspacer, toolbox ...
toolbarspacer - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspring, toolbox interfaces nsiacc...
toolbarspring - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements toolbar, toolbarbutton, toolbargrippy, toolbaritem, toolbarpalette, toolbarseparator, toolbarset, toolbarspacer, toolbox int...
toolbox - Archive of obsolete content
, getattributens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata appendcustomtoolbar( name, currentset ) firefox only return type: element adds a custom toolbar to the toolbox with the given name.
treechildren - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata example <tree flex="1"> <treecols> <treecol id="sender" label="sender" flex="1"/> <treecol id="subject" label="subject" flex="2"/> </treecols> <tre...
treecols - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecol, treechildren, treeitem, treerow, treecell and treeseparator.
treerow - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treecell and treeseparator.
treeseparator - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements tree, treecols, treecol, treechildren, treeitem, treerow and treecell.
triple - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
vbox - Archive of obsolete content
ArchiveMozillaXULvbox
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata related elements box, hbox ...
where - Archive of obsolete content
ArchiveMozillaXULwhere
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata ...
window - Archive of obsolete content
tens(), getboundingclientrect(), getclientrects(), getelementsbyattribute, getelementsbyattributens, getelementsbyclassname(), getelementsbytagname(), getelementsbytagnamens(), getfeature, getuserdata, hasattribute(), hasattributens(), hasattributes(), haschildnodes(), insertbefore(), isdefaultnamespace(), isequalnode, issamenode, issupported(), lookupnamespaceuri, lookupprefix, normalize(), queryselector(), queryselectorall(), removeattribute(), removeattributenode(), removeattributens(), removechild(), removeeventlistener(), replacechild(), setattribute(), setattributenode(), setattributenodens(), setattributens(), setuserdata see also: dom window object methods note the error message "xml parsing error: undefined entity...<window" can be caused by a missing or unreachable dtd file ref...
Dialogs in XULRunner - Archive of obsolete content
ondialogaccept="return dosave();" buttonlabelcancel="cancel" buttonaccesskeycancel="n" ondialogcancel="return docancel();"> <script> function dosave(){ //dosomething() return true; } function docancel(){ return true; } </script> <dialogheader title="my dialog" description="example dialog"/> <groupbox flex="1"> <caption label="select favorite fruit"/> <radiogroup> <radio id="1" label="oranges because they are fruity"/> <radio id="2" selected="true" label="strawberries because of color"/> <radio id="3" label="bananna because it pre packaged"/> </radiogroup> </groupbox> </dialog> xul window elements have a special method to open dialogs, called window.opendialog().
reftest opportunities files - Archive of obsolete content
est/parsing4 http://dbaron.org/css/test/parsing5 http://dbaron.org/css/test/parsing6 http://dbaron.org/css/test/sec040102 http://dbaron.org/css/test/casesens http://dbaron.org/css/test/xmltypesel http://dbaron.org/css/test/unitless http://dbaron.org/css/test/exunit http://dbaron.org/css/test/emunit http://dbaron.org/css/test/sec040310 http://dbaron.org/css/test/parsing3 http://dbaron.org/css/test/selector_confusion http://dbaron.org/css/test/univsel http://dbaron.org/css/test/childsel http://dbaron.org/css/test/sibsel http://dbaron.org/css/test/attrsel http://dbaron.org/css/test/twoclass http://dbaron.org/css/test/xmlid http://dbaron.org/css/test/pseudos http://dbaron.org/css/test/pseudos2 http://dbaron.org/css/test/pseudos3 http://dbaron.org/css/test/firstchild http://dbaron.org/css/test/sec051...
Archived Mozilla and build documentation - Archive of obsolete content
creating a mozilla extension a mozilla extension is an installable enhancement to the mozilla browser that provides additional functionality (for example linky, which adds an item to the context menu for opening multiple links in a document or selection).
2006-10-13 - Archive of obsolete content
(no responses as of yet) selected tab looks too close to unselected tab discussion about how to change the colour of a selected tab and an unselected tab.
Extentsions FAQ - Archive of obsolete content
var tab = gbrowser.addtab( url ); // and if you want it to load in the foreground: gbrowser.selectedtab = tab; is it possible to read the html-code of the current url/site?
2006-09-22 - Archive of obsolete content
thai issue for 2.0 timeframe arabic support & uniscribe: details nstextframe: re-design and impact on i18n native unicode converter editing and selection: should editing and selection operate on grapheme clusters?
2006-12-01 - Archive of obsolete content
peter wilson's reply was to add a method that does the deleting with a native implementation that releases the resources held by the object as seen in this database interface: var mydbase = new pgsqlconnection; mydbase.connect("database"); mydbase.exec("select * from mytable where ..."); // use the result data - (native implementation function) mydbase.close() spidermonkey for server side inquiry about why javascript hasn't caught on for general server-side scripting.
2006-11-10 - Archive of obsolete content
the idea of using a single sheet and the per-site selectors that dbaron implemented would allow for a quick proof of concept.
NPN_GetValueForURL - Archive of obsolete content
variable selects the type of information to be retrieved (npnurlvcookie or npnurlvproxy) url the url for which to fetch information.
NPN_SetValueForURL - Archive of obsolete content
variable selects the type of information to be changed.
Atomic RSS - Archive of obsolete content
ArchiveRSSModuleAtom
documentation selected articles atomic rss tim bray talks about using atom 1.0 as a micro format and extension module for rss 2.0; keeping rss 2.0 as your sydication format but bringing in and using selected atom 1.0 elements.
Content - Archive of obsolete content
documentation selected articles why rss content module is popular - including html contents charles iliya krempeaux talks about the rss content module, why it is popular among some, and how it is used to include html contents.
Slash - Archive of obsolete content
ArchiveRSSModuleSlash
documentation selected articles up to 10 why rss slash is popular: counting your comments charles iliya krempeaux talks about the rss slash module, why it is popular among some, and how it is used to give a count for your comments (2005-08-22).
Well-Formed Web - Archive of obsolete content
documentation selected articles why well-formed web rss module is popular - syndicating your comments charles iliya krempeaux talks about the rss well-formed web module, why it is popular among some, and how it is used to link to your comments (2005-08-22).
RSS - Archive of obsolete content
atomic rss tim bray talks about using atom 1.0 as a micro format and extension module for rss 2.0; keeping rss 2.0 as your sydication format but bringing in and using selected atom 1.0 elements.
Introduction to SSL - Archive of obsolete content
allow the client and server to select the cryptographic algorithms, or ciphers, that they both support.
TCP/IP Security - Archive of obsolete content
another good source of information is nist sp 800-52, guidelines on the selection and use of transport layer security, available from https://csrc.nist.gov/publications/nistpubs/.) the use of tls typically requires each application to support tls; however, unlike application layer controls, which typically involve extensive customization of the application, transport layer controls such as tls are much less intrusive because they do not need to understand the application’...
-ms-accelerator - Archive of obsolete content
an access key is a single character used as a keyboard shortcut for selecting an object.
-ms-content-zoom-limit-max - Archive of obsolete content
the -ms-content-zoom-limit-max css property is a microsoft extension that specifies the selected elements' maximum zoom factor.
-ms-content-zoom-snap-type - Archive of obsolete content
the snap-point that is selected is the one that is closest to where the content zoom factor would normally stop.
-ms-filter - Archive of obsolete content
;" src="sphere.jpg" alt="sphere"> <div id="filterto" style="position: absolute; width: 200px; height: 250px; top: 20px; left: 20px; background: white; visibility: hidden;"> </div> </div> <script type="text/javascript"> let filterimg = document.queryselector('#filterfrom'); filterimg.addeventlistener('click', dofilter); function dofilter () { filterfrom.filters.item(0).apply(); // 12 is the dissolve filter.
-ms-scroll-snap-x - Archive of obsolete content
the two selectors in the following example have the same effect.
-ms-scroll-snap-y - Archive of obsolete content
the two selectors in the following example have the same effect.
:-moz-system-metric(images-in-menus) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(mac-graphite-theme) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(scrollbar-end-backward) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(scrollbar-end-forward) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(scrollbar-start-backward) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(scrollbar-start-forward) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(scrollbar-thumb-proportional) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
:-moz-system-metric(windows-default-theme) - Archive of obsolete content
this selector is intended for use mainly by theme developers.
::-ms-check - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-check in its selector.
::-ms-clear - Archive of obsolete content
such inputs include: <input type="color"> <input type="date"> <input type="datetime"> <input type="datetime-local"> <input type="email"> <input type="month"> <input type="number"> <input type="search"> <input type="tel"> <input type="time"> <input type="url"> <input type="week"> allowable properties only the following css properties can be used in a rule with ::-ms-clear in its selector.
::-ms-reveal - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-reveal in its selector.
::-ms-thumb - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-thumb in its selector.
::-ms-ticks-after - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-ticks-after in its selector.
::-ms-ticks-before - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-ticks-before in its selector.
::-ms-tooltip - Archive of obsolete content
allowable properties only the following css properties can be used in a rule with ::-ms-tooltip in its selector.
Processing XML with E4X - Archive of obsolete content
cent updates: var languages = <languages> <lang>javascript</lang> <lang>python</lang> </languages>; var lang = languages.lang; alert(lang.length()); // alerts 2 languages.lang += <lang>ruby</lang>; alert(lang.length()); // still alerts 2 lang = languages.lang; // re-create the xmllist alert(lang.length()); // alerts 3 searching and filtering e4x provides special operators for selecting nodes within a document that match specific criteria.
Accessing XML children - Archive of obsolete content
var a = <foo> some text <bar>not text</bar> more text </foo>; var list = a.text(); list.length(); // returns 2 list[0]; // returns " some text " list[1]; // returns " more text " you can similarly access comment nodes: xml.ignorecomments = false; var a = <foo> some <!-- abc --> text </foo>; var comments = a.comments(); alert(comments[0]); // returns <!-- abc --> the * selector will return all child nodes in an xml list.
RFE to the XForms API - Archive of obsolete content
ArchiveWebXFormsRFEXForms API
reflect attributes to properties for the elements that can contain the incremental or selection attributes, it makes sense to expose analogous properties.
XForms Alert Element - Archive of obsolete content
introduction this message will be shown when the form control cannot properly bind to instance data or when the instance data value is invalid or out of the specified range of selectable values (see the spec).
Anatomy of a video game - Game development
this could occur when the user unselects your tab and the browser sleeps (or slows) its requestanimationframe callback interval.
Building up a basic demo with A-Frame - Game development
add a new <script> element at the end of the <body> element, just after the <a-scene> element, then add the following javascript code inside it: var scene = document.queryselector('a-scene'); var cylinder = document.createelement('a-cylinder'); cylinder.setattribute('color', '#ff9500'); cylinder.setattribute('height', '2'); cylinder.setattribute('radius', '0.75'); cylinder.setattribute('position', '3 1 0'); scene.appendchild(cylinder); we're getting a reference to the scene handler first, then we create the cylinder element as an a-frame entity.
Plug-in Development Overview - Gecko Plugin API Reference
the plug-in can select one of these transmission modes: normal mode: the browser sends the stream data sequentially to the plug-in as the data becomes available.
CSS Object Model (CSSOM) - MDN Web Docs Glossary: Definitions of Web-related terms
the css object model (cssom) is a map of all css selectors and relevant properties for each selector in the form of a tree, with a root node, sibling, descendant, child, and other relationship.
CSS preprocessor - MDN Web Docs Glossary: Definitions of Web-related terms
there are many css preprocessors to choose from, however most css preprocessors will add some features that don't exist in pure css, such as mixin, nesting selector, inheritance selector, and so on.
IDL - MDN Web Docs Glossary: Definitions of Web-related terms
html specifications try to make this as developer-friendly as possible, but for various reasons (mostly historical), some attributes behave oddly (select.size, for example) and you should read the specifications to understand how exactly they behave.
Pseudo-element - MDN Web Docs Glossary: Definitions of Web-related terms
in css, a pseudo-element selector applies styles to parts of your document content in scenarios where there isn't a specific html element to select.
Semantics - MDN Web Docs Glossary: Definitions of Web-related terms
would you know what part of the dom is being selected with div > ul > li, or .fruits__item?
Property (CSS) - MDN Web Docs Glossary: Definitions of Web-related terms
here's an example of a css rule: /* "div" is a selector indicating that all the div elements */ /* in the document will be styled by that rule */ div { /* the property "color" with the value "black" indicates */ /* that the text will have the color black */ color: black; /* the property "background-color" with the value "white" indicates */ /* that the background color of the elements will be white */ background-color: white; } learn more general knowledge learn css technical reference the css reference on mdn the css working group current work ...
MDN Web Docs Glossary: Definitions of Web-related terms
ol) and srtp (secure rtp) rtsp: real-time streaming protocol ruby s safe same-origin policy scm scope screen reader script-supporting element scroll container scrollport sctp sdp search engine second-level domain secure sockets layer (ssl) selector (css) self-executing anonymous function semantics seo serialization server server timing session hijacking sgml shadow tree shim signature signature (functions) signature (security) simd simple header simple response header sisd site ...
Assessment: Accessibility troubleshooting - Learn web development
note: you'll need to update the css rule selectors that style the tags to their proper equivalents for the semantic headings.
Backgrounds and borders - Learn web development
previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Handling different text directions - Learn web development
previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Test your skills: Images and Form elements - Learn web development
your task is to make the following changes to the way this form looks: use attribute selectors to target the search field and button inside .myform.
Sizing items in CSS - Learn web development
previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
CSS values and units - Learn web development
previous overview: building blocks next in this module cascade and inheritance css selectors type, class, and id selectors attribute selectors pseudo-classes and pseudo-elements combinators the box model backgrounds and borders handling different text directions overflowing content values and units sizing items in css images, media, and form elements styling tables debugging css organizing your css ...
Using your new knowledge - Learn web development
font-family color border-bottom font-weight font-size text-decoration i have used a mixture of selectors, styling elements such as h1 and h2, but also creating a class for the job title and styling that.
Using CSS generated content - Learn web development
to specify this, make a rule and add ::before or ::after to the selector.
Typesetting a community school homepage - Learn web development
don't worry if some of the selectors are repetitious; we'll let you off in this instance.
Learn to style HTML using CSS - Learn web development
this module looks at the cascade and inheritance, all the selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
Basic native form controls - Learn web development
the user is allowed to select multiple files in this case.
HTML forms in legacy browsers - Learn web development
mycolor" name="color"> </label> supported not supported form buttons there are two ways to define buttons within html forms: the <input> element with its attribute type set to the values button, submit, reset or image the <button> element <input> the <input> element can make things a little difficult if you want to apply some css by using the element selector: <input type="button" value="click me"> if we remove the border on all inputs, can we restore the default appearance on input buttons only?
Example - Learn web development
input type="email" id="mail" name="usermail"> </p> <p> <label for="pwd"> <span>password: </span> <strong><abbr title="required">*</abbr></strong> </label> <input type="password" id="pwd" name="password"> </p> </section> <section> <h2>payment information</h2> <p> <label for="card"> <span>card type:</span> </label> <select id="card" name="usercard"> <option value="visa">visa</option> <option value="mc">mastercard</option> <option value="amex">american express</option> </select> </p> <p> <label for="number"> <span>card number:</span> <strong><abbr title="required">*</abbr></strong> </label> <input type="tel" id="number" name="cardnumber"> </...
Test your skills: Advanced styling - Learn web development
now give the radio buttons a different style for when they are selected.
Web forms — Working with user data - Learn web development
other form controls next we take a look at all the non-<input> form controls and associated tools, such as <select>, <textarea>, <meter>, and <progress>.
Dealing with files - Learn web development
generally, you can turn this off by going to windows explorer, selecting the folder options...
The web and web standards - Learn web development
the following simple javascript will store a reference to our paragraph in memory and change the text inside it: let pelem = document.queryselector('p'); pelem.textcontent = 'we changed the text!'; in the house analogy, javascript is like the cooker, tv, microwave, or hairdryer — the things that give your house useful functionality tooling once you've learned the "raw" technologies that can be used to build web pages (such as html, css, and javascript), you'll soon start to come across various tools that can be used to make your ...
What will your website look like? - Learn web development
click the "* family selected" button in the panel at the bottom of the page ("*" depends on how many fonts you selected).
Tips for authoring fast-loading HTML pages - Learn web development
tables should use the css selector: property combination: table-layout: fixed; and should specify widths of columns using the <col> and the <colgroup> elements.
HTML table advanced features and accessibility - Learn web development
if the <tbody> and <tfoot> elements weren't in place, you'd have to write much more complicated selectors/rules to apply the same styling.
Choosing the right approach - Learn web development
single delayed operation repeating operation multiple sequential operations multiple simultaneous operations no yes no (unless it is the same one) no code example a simple animated spinner; you can find this example live on github (see the source code also): const spinner = document.queryselector('div'); let rotatecount = 0; let starttime = null; let raf; function draw(timestamp) { if(!starttime) { starttime = timestamp; } rotatecount = (timestamp - starttime) / 3; if(rotatecount > 359) { rotatecount %= 360; } spinner.style.transform = 'rotate(' + rotatecount + 'deg)'; raf = requestanimationframe(draw); } draw(); pitfalls you can't c...
General asynchronous programming concepts - Learn web development
in our simple-sync.html example (see it running live), we add a click event listener to a button so that when clicked, it runs a time-consuming operation (calculates 10 million dates then logs the final one to the console) and then adds a paragraph to the dom: const btn = document.queryselector('button'); btn.addeventlistener('click', () => { let mydate; for(let i = 0; i < 10000000; i++) { let date = new date(); mydate = date } console.log(mydate); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; document.body.appendchild(pelem); }); when running the example, open your javascript console then click the button —...
Introducing asynchronous JavaScript - Learn web development
let's look at a simple example (see it live here, and see the source): const btn = document.queryselector('button'); btn.addeventlistener('click', () => { alert('you clicked me!'); let pelem = document.createelement('p'); pelem.textcontent = 'this is a newly-added paragraph.'; document.body.appendchild(pelem); }); in this block, the lines are executed one after the other: we grab a reference to a <button> element that is already available in the dom.
Graceful asynchronous programming with Promises - Learn web development
so instead of waiting for the user, getting the chosen devices enabled, and directly returning the mediastream for the stream created from the selected sources, getusermedia() returns a promise which is resolved with the mediastream once it's available.
Functions — reusable blocks of code - Learn web development
you generally use an anonymous function along with an event handler, for example the following would run the code inside the function whenever the associated button is clicked: const mybutton = document.queryselector('button'); mybutton.onclick = function() { alert('hello'); } the above example would require there to be a <button> element available on the page to select and click.
Handling text — strings in JavaScript - Learn web development
concatenation in context let's have a look at concatenation being used in action — here's an example from earlier in the course: <button>press me</button> const button = document.queryselector('button'); button.onclick = function() { let name = prompt('what is your name?'); alert('hello ' + name + ', nice to see you!'); } here we're using a window.prompt() function in line 4, which asks the user to answer a question via a popup dialog box then stores the text they enter inside a given variable — in this case name.
Storing the information you need — Variables - Learn web development
let's look at a simple example: <button>press me</button> const button = document.queryselector('button'); button.onclick = function() { let name = prompt('what is your name?'); alert('hello ' + name + ', nice to see you!'); } in this example pressing the button runs a couple of lines of code.
Object building practice - Learn web development
the first part of the script looks like so: const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); const width = canvas.width = window.innerwidth; const height = canvas.height = window.innerheight; this script gets a reference to the <canvas> element, then calls the getcontext() method on it to give us a context on which we can start to draw.
Perceived performance - Learn web development
selecting the right fonts is an art form, and can greatly improve the user experience.
Introduction to the server side - Learn web development
this includes selecting and styling ui components, creating layouts, navigation, form validation, etc.
Server-side website programming first steps - Learn web development
we then provide an overview of some of the most popular server-side web frameworks, along with guidance on how to select the most suitable framework for creating your first site.
Server-side website programming - Learn web development
this module also outlines some of the more popular server-side web frameworks and gives guidance on how to select the best one for your site.
React interactivity: Events and state - Learn web development
for example: const btn = document.queryselector('button'); btn.addeventlistener('click', () => { alert("hi!"); }); in react, we write event handlers directly on the elements in our jsx, like this: <button type="button" onclick={() => alert("hi!")} > say hi!
Beginning our React todo list - Learn web development
rgin-bottom: 0; } ul { list-style: none; padding: 0; } button { border: none; margin: 0; padding: 0; width: auto; overflow: visible; background: transparent; color: inherit; font: inherit; line-height: normal; -webkit-font-smoothing: inherit; -moz-osx-font-smoothing: inherit; -webkit-appearance: none; } button::-moz-focus-inner { border: 0; } button, input, optgroup, select, textarea { font-family: inherit; font-size: 100%; line-height: 1.15; margin: 0; } button, input { overflow: visible; } input[type="text"] { border-radius: 0; } body { width: 100%; max-width: 68rem; margin: 0 auto; font: 1.6rem/1.25 arial, sans-serif; background-color: #f5f5f5; color: #4d4d4d; } @media screen and (min-width: 620px) { body { font-size: 1.9rem; lin...
Starting our Svelte Todo list app - Learn web development
rgin-bottom: 0; } ul { list-style: none; padding: 0; } button { border: none; margin: 0; padding: 0; width: auto; overflow: visible; background: transparent; color: inherit; font: inherit; line-height: normal; -webkit-font-smoothing: inherit; -moz-osx-font-smoothing: inherit; -webkit-appearance: none; } button::-moz-focus-inner { border: 0; } button, input, optgroup, select, textarea { font-family: inherit; font-size: 100%; line-height: 1.15; margin: 0; } button, input { overflow: visible; } input[type="text"] { border-radius: 0; } body { width: 100%; max-width: 68rem; margin: 0 auto; font: 1.6rem/1.25 arial, sans-serif; background-color: #f5f5f5; color: #4d4d4d; } @media screen and (min-width: 620px) { body { font-size: 1.9rem; lin...
Working with Svelte stores - Learn web development
for example, information about the logged in user, or whether the dark theme is selected or not.
Adding a new todo form: Vue events, methods, and models - Learn web development
v-model works across all the various input types, including check boxes, radios, and select inputs.
Deploying our app - Learn web development
select your project repository and proceed to the next step.
Package management basics - Learn web development
faced with the overwhelming choice of tooling, probably the most important lesson is to learn what the tool you select is capable of.
Accessibility/LiveRegionDevGuide
an event containing an object that has state selectable is not a live region.
Mozilla accessibility architecture
gecko events (or callback) event type accessibility event focus, select standard html dom event event_focus dommenuitemactive, dommenubaractive mozilla dom event_focus domnodeinserted w3c dom mutation event event_create (atk) event_reorder (msaa) domsubtreemodified w3c dom mutation event event_reorder domnoderemoved w3c dom mutation event event_...
Information for External Developers Dealing with Accessibility
mac keys: keyboard shortcuts quick reference for mac os x complete reference on keyboard for mac os x: this document list all functions of specified keys, known keyboard shortcuts, explains how to create keyboard shortcuts, explains appropriate use for the arrow keys, how to move the insertion point with keys, how to extent text selection with keys, functions of function keys, what are reserved keyboard shortcuts, how to create your own keyboard shortcuts, keyboard focus and navigation, type-ahead and key-repeat, etc.
Links and Resources
it can also report accessibility errors and warnings according to selectable accessibility guidelines (section 508, wcag priorities 1, 2 or 3).
Frequently Asked Questions for Lightweight themes
to undo the design you most recently selected, go to tools > add-ons in the menu bar and select the themes tab.
Theme concepts
updating static themes if your static theme is hosted on amo, you can upload a new version using the developer hub with the following steps: visit the product page for your theme through the developer hub select "upload new version" on the left upload your packaged file for validation or modify it using the theme generator for self-hosted static themes, a new version can be updated through amo by following the above steps or be handled by you through an updateurl or external application updates.
Adding phishing protection data providers
determining the currently-selected data provider if you need to determine the id number of the currently selected anti-phishing data provider, you can look at the current value of the preference browser.safebrowsing.dataprovider.
Command line options
in general, the syntax is as follows: application -option -option "argument" -option argument examples the following examples show the use of the "-profilemanager" command, which will open the profile manager prior to starting firefox or thunderbird: windows select run from windows start menu.
Creating a Language Pack
you have to set your selected language still.
Creating a spell check dictionary add-on
it is important to choose the right locale code, or the spell checker will not be able to match the language of your dictionary against the language of a web page in order to select the right dictionary to use.
Debugging Frame Reflow
block block br br bullet bullet button gfxbuttoncontrol hr hr framei htmlframeinner frameo htmlframeouter img image inline inline letter letter line line select select obj object page page place placeholder posinline positionedinline canvas canvas root root scroll scroll caption tablecaption cell tablecell bccell bctablecell ...
Installing headers using EXPORTS
here is an example <tt>makefile.in</tt> which has both c++ and idl headers: module = content xpidl_module = content_base exports = \ nsicontent.h \ nsidocument.h \ nsistylesheet.h \ $(null) xpidlsrcs = \ nsicontentpolicy.idl \ nsiselectioncontroller.idl \ $(null) include $(topsrcdir)/config/rules.mk ...
Interface Compatibility
if necessary, it is possible for an extension to support multiple versions by shipping multiple shared libraries (dlls) in the same extension package, and selecting the correct version using versioning flags in its chrome.manifest file.
Contributing to the Mozilla code base
in a worst case scenario, set the module owner as the reviewer, asking them in the comments to pick someone more suitable please select only one reviewer.
Developer guide
mozilla modules and module ownership this article provides information about mozilla's modules, what the role of a module owner is, and how module owners are selected.
Cross Process Object Wrappers
this means that examples like this will actually work, even in multiprocess firefox: gbrowser.selectedbrowser.contentdocument.body.innerhtml = "replaced by chrome code"; it's still important to keep in mind, though, that this is access through a cpow and not direct access to content.
Limitations of chrome scripts
for example: // chrome code gbrowser.contentwindow; // null gbrowser.contentdocument; // null gbrowser.selectedbrowser.contentwindow; // null window.content; // null content; // null as a special note, docshells live in the content process, so they are also inaccessible: gbrowser.docshell; // null gbrowser.selectedbrowser.docshell; // null with the shim the shim will give you a cpow for the content obj...
Communicating with frame scripts
// on some event var browsermm = gbrowser.selectedbrowser.messagemanager; browsermm.loadframescript("chrome://my-addon@me.org/content/frame-script.js", false); messagemanagers.push(browsermm); console.log(messagemanagers.length); we can listen for message-manager-disconnect to update the array when the message managers disconnect (for example because the user closed the tab): function myobserver() { } myobserver.prototype = { observe: func...
Message manager overview
ific message from frame scripts removemessagelistener() : stop listening to a specific message interfaces nsiprocesschecker nsiframescriptloader nsimessagelistenermanager nsimessagesender how to access the browser message manager can be accessed as a property of the xul <browser> element: // chrome script let browsermm = gbrowser.selectedbrowser.messagemanager; content process content frame message manager description there's a content frame message manager for every open tab.
Message manager overview
it's a chromemessagesender object, which implements the following interfaces: nsiprocesschecker nsiframescriptloader nsimessagelistenermanager nsimessagesender the browser message manager can be accessed as a property of the xul <browser> element: // chrome script let browsermm = gbrowser.selectedbrowser.messagemanager; process message managers process message managers correspond to process boundaries, and enable code running in different processes to communicate.
Performance best practices for Firefox front-end engineers
paint flashing tints each region being painted with a randomly selected color so that it’s more easy to see what on the screen is being painted.
Blocked: All storage access requests
the permission can be changed or removed by: going to preferences > content blocking in the custom content blocking section, selecting a value other than all cookies for the cookies item if the resource that is being blocked doesn't need authentication, you can fix the warning message by adding a crossorigin="anonymous" attribute to your element.
Storage access policy: Block cookies from trackers
the cookie policy can be enabled in other versions of firefox through the content blocking settings (these steps will vary by version; the linked documentation includes a dropdown to select the appropriate firefox version).
Security best practices for Firefox front-end engineers
we use our built-in sanitizer with the following flags: sanitizerallowstyle sanitizerallowcomments sanitizerdropforms sanitizerlogremovals the sanitizer removes all scripts (script tags, event handlers) and form elements (form, input, keygen, option, optgroup, select, button, datalist).
Firefox Operational Information Database: SQLite
in the manager, select the database you want to explore in the '(select profile database)' pulldown, click 'go', select one of the tables listed in the left column and see the current contents of the database in the 'browse & search' tab.) some databases are used by the browser itself, others are used by applications that you have installed or used; for example: content-prefs.sqlite cookies.sqlite download.sqlite formhistory.sqlite persmissions.sqlite places.sqlite search.sqlite signon...
HTMLIFrameElement.addNextPaintListener()
examples var browser = document.queryselector('iframe'); function onnextpaint() { console.log("paint has occured"); } browser.addnextpaintlistener(onnextpaint); specification not part of any specification.
HTMLIFrameElement.download()
examples var browser = document.queryselector('iframe'); var request = browser.download(foourl, { filename: 'foo.bin' }); request.onsuccess = function() { console.log("file downladed"); } request.onerror = function() { console.log("download error"); } specification not part of any specification.
HTMLIFrameElement.getActive()
example var browser = document.queryselector('iframe'); var amiactive = browser.getactive(); specification not part of any specification.
HTMLIFrameElement.getContentDimensions()
examples var browser = document.queryselector('iframe'); var request = browser.getcontentdimensions(); request.onsuccess = function() { console.log("page size:", request.result.width + "x" + request.result.height); } request.onerror = function() { console.log("download error"); } specification not part of any specification.
HTMLIFrameElement.getManifest()
examples var browser = document.queryselector('iframe'); browser.addeventlistener('mozbrowserloadend',function() { var request = browser.getmanifest().then(function(json) { console.log(json); }); }); specification not part of any specification.
HTMLIFrameElement.getMuted()
example callback version: var browser = document.queryselector('iframe'); var request = browser.getmuted(); request.onsuccess = function() { if(request.result) { console.log('the browser is muted.'); } else { console.log('the browser is unmuted.'); } } promise version: var browser = document.queryselector('iframe'); browser.getmuted().then(function(muted) { if(muted) { console.log('the browser is muted.'); } else { console.l...
HTMLIFrameElement.getScreenshot()
examples var browser = document.queryselector('iframe'); var request = browser.getscreenshot(100, 100); request.onsuccess = function() { var blob = request.result; var url = url.createobjecturl(blob); } specification not part of any specification.
HTMLIFrameElement.getStructuredData()
examples var browser = document.queryselector('iframe'); browser.addeventlistener('mozbrowserloadend',function() { var request = browser.getstructureddata(); request.onsuccess = function() { console.log(request.result); } }); running this code in a browser api app and then loading up a page that contains microdata (such as the website of british alt-country band salter cane) will result in a json object being returned, along the...
HTMLIFrameElement.getVisible()
example var browser = document.queryselector('iframe'); var request = browser.getvisible(); request.onsuccess = function() { console.log('the visible state is: ' + this.result ?
HTMLIFrameElement.getVolume()
example callback version: var browser = document.queryselector('iframe'); var request = browser.getvolume(); request.onsuccess = function() { console.log('the current browser volume is ' + request.result); } promise version: var browser = document.queryselector('iframe'); browser.getvolume().then(function(volume) { console.log('the current browser volume is ' + volume); }); specification not part of any specification.
mozbrowseractivitydone
examples var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowseractivitydone", function(event) { if(event.details.success) { console.log('activity completed successfully'); } else { console.log('activity not completed successfully'); } }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationcha...
mozbrowserasyncscroll
examples var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserasyncscroll", function( event ) { console.log("the scroll top position of the document is:" + event.details.top + "px"); }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowser...
mozbrowseraudioplaybackchange
examples var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowseraudioplaybackchange", function(event) { console.log(event.details); }); related events mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsertitlechange mozbrowserusernameandpasswordrequired ...
mozbrowserclose
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserclose", function() { console.log("browser window has been closed; iframe will be destroyed."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt moz...
mozbrowserdocumentfirstpaint
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserdocumentfirstpaint", function() { console.log("first content painted."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mo...
mozbrowsererror
re netinterrupt nettimeout cspblocked phishingblocked malwareblocked unwantedblocked offline malformeduri redirectloop unknownsockettype netreset notcached isprinting deniedportaccess proxyresolvefailure proxyconnectfailure contentencodingfailure remotexul unsafecontenttype corruptedcontenterror certerror other example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsererror", function( event ) { console.log("an error occurred:" + event.detail); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechang...
mozbrowserfindchange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserfindchange", function(event) { console.log("currently highlighted: " + event.details.activematchordinal + " out of " + event.details.numberofmatches); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrows...
mozbrowserfirstpaint
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserfirstpaint", function(event) { console.log("first content painted."); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozbr...
mozbrowsericonchange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsericonchange", function( event ) { console.log("the url of the new favicon is:" + event.details.href); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mo...
mozbrowserloadend
var browser = document.queryselector("iframe"); browser.addeventlistener('mozbrowserloadend',function(e) { stopreload.textcontent = 'r'; console.log(e.detail.backgroundcolor); controls.style.background = e.detail.backgroundcolor; }); browser.addeventlistener('mozbrowserloadend',function() { stopreload.textcontent = 'r'; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror ...
mozbrowserloadstart
var browser = document.queryselector("iframe"); browser.addeventlistener('mozbrowserloadstart',function() { stopreload.textcontent = 'x'; }); browser.addeventlistener('mozbrowserloadend',function() { stopreload.textcontent = 'r'; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserlocationchange mozbrowseropenwindow mozbro...
mozbrowserlocationchange
var browser = document.queryselector("iframe"); browser.addeventlistener('mozbrowserlocationchange', function (event) { urlbar.value = event.detail.url; }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrowsertitlechange mozbrowserusern...
mozbrowsermanifestchange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsermanifestchange", function(event) { console.log("new manifest url: " + event.details.href); }); related events mozbrowserasyncscroll mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsershowmodalprompt mozbrow...
mozbrowsermetachange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsermetachange", function(event) { console.log("a meta tag has been " + event.details.type + ".
mozbrowseropensearch
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowseropensearch", function( event ) { console.log("new search engine encountered: " + event.details.title); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbr...
mozbrowseropentab
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowseropentab", function( event ) { console.log("a new document has opened containing the content at " + event.details.url + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozbr...
mozbrowseropenwindow
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowseropenwindow", function( event ) { console.log("a new window has opened containing the content at " + event.details.url + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozb...
mozbrowserresize
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserresize", function( event ) { console.log("the new window size is " + event.details.width + " x " + event.details.height + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mo...
mozbrowserscroll
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserscroll", function( event ) { console.log("the new scroll position is " + event.details.left + " across and " + event.details.top + "down."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange m...
mozbrowserscrollareachanged
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserscrollareachanged", function( event ) { console.log("the new scroll area is " + event.details.width + " x " + event.details.height + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange moz...
mozbrowserscrollviewchange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowserscrollviewchange", function( event ) { console.log("scrolling has " + event.details.state + "."); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowsersecuritychange mozbrowsertitlechange mozbrowse...
mozbrowsersecuritychange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsersecuritychange", function( event ) { console.log("the ssl state is:" + event.details.state); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsertitlechange mozbrowserusername...
mozbrowsershowmodalprompt
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsershowmodalprompt", function( event ) { console.log("asking for prompt:" + json.stringify(event.detail)); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozb...
mozbrowsertitlechange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowsertitlechange", function( event ) { console.log("the title of the document is:" + event.detail); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuritychange mozbrowsersho...
mozbrowserusernameandpasswordrequired
example var browser = document.queryselector("iframe[mozbrowser]"); browser.addeventlistener("mozbrowserusernameandpasswordrequired", function( event ) { console.log("the auth realm is:" + event.detail.realm); }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserlocationchange mozbrowseropenwindow mozbrowsersecuri...
mozbrowservisibilitychange
example var browser = document.queryselector("iframe"); browser.addeventlistener("mozbrowservisibilitychange", function( event ) { if(event.details.visible) { console.log("the browser is visible."); } else { console.log("the browser is hidden."); } }); related events mozbrowserasyncscroll mozbrowserclose mozbrowsercontextmenu mozbrowsererror mozbrowsericonchange mozbrowserloadend mozbrowserloadstart mozbrowserloc...
HTMLIFrameElement.mute()
MozillaGeckoChromeAPIBrowser APImute
example var browser = document.queryselector('iframe'); browser.mute(); specification not in a specification.
HTMLIFrameElement.purgeHistory()
examples domrequest: var browser = document.queryselector('iframe'); var request = browser.purgehistory(); request.onsuccess = function() { console.log('history deleted!'); } request.onerror = function() { console.error(this.error.name); } promise: var browser = document.queryselector('iframe'); browser.purgehistory().then(function() { console.log('history deleted!'); }, function(error) { console.error(this.error.name); }); specificati...
HTMLIframeElement.removeNextPaintListener()
examples var browser = document.queryselector('iframe'); function onnextpaint() { console.log("paint has occured"); } browser.addnextpaintlistener(onnextpaint); browser.removenextpaintlistener(onnextpaint); specification not part of any specification.
HTMLIFrameElement.sendMouseEvent()
examples var browser = document.queryselector('iframe'); browser.sendmouseevent("mousemove", x, y, 0, 0, 0); browser.sendmouseevent("mousedown", x, y, 0, 1, 0); browser.sendmouseevent("mouseup", x, y, 0, 1, 0); specification not part of any specification.
HTMLIFrameElement.sendTouchEvent()
examples var browser = document.queryselector('iframe'); browser.sendtouchevent("touchstart", [1], [x], [y], [2], [2], [20], [0.5], 1, 0); specification not part of any specification.
HTMLIFrameElement.setActive()
example var browser = document.queryselector('iframe'); browser.setactive(); specification not part of any specification.
HTMLIFrameElement.setVisible()
examples var browser = document.queryselector('iframe'); browser.setvisible(true); specification not part of any specification.
HTMLIFrameElement.setVolume()
example var browser = document.queryselector('iframe'); browser.setvolume(0.5); specification not part of any specification.
HTMLIFrameElement.unmute()
example var browser = document.queryselector('iframe'); browser.unmute(); specification not part of any specification.
HTMLIFrameElement.zoom()
MozillaGeckoChromeAPIBrowser APIzoom
examples var browser = document.queryselector('iframe'); var zoomfactor = 1; zoomin.addeventlistener('touchend',function() { zoomfactor += 0.1; browser.zoom(zoomfactor); }); zoomout.addeventlistener('touchend',function() { zoomfactor -= 0.1; browser.zoom(zoomfactor); }); specification not part of any specification.
:-moz-lwtheme-brighttext
the :-moz-lwtheme-brighttext pseudo-class matches in chrome documents when :-moz-lwtheme is true and a lightweight theme with a bright text color is selected.
:-moz-lwtheme-darktext
the :-moz-lwtheme-darktext pseudo-class matches in chrome documents when :-moz-lwtheme is true and a lightweight theme with a dark text color is selected.
:-moz-lwtheme
the :-moz-lwtheme pseudo-class matches in chrome documents when the root element's lightweightthemes attribute is true and a theme is selected.
::-moz-tree-cell-text(hover)
this selector is intended for use mainly by theme developers.
::-moz-tree-row(hover)
this selector is intended for use mainly by theme developers.
::-moz-tree-row
the ::-moz-tree-row css pseudo-element is used to select rows and apply styles to tree rows.
overflow-clip-box-block
opqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box-block: padding-box; } javascript function scrollsomeelements() { var elms = document.queryselectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
overflow-clip-box-inline
pqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box-inline: padding-box; } javascript function scrollsomeelements() { var elms = document.queryselectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
overflow-clip-box
abcdefghijklmnopqrstuvwxyzÅÄÖ" class="scroll padding-box"> <div class="scroll padding-box"><span>abcdefghijklmnopqrstuvwxyzÅÄÖ</span></div> </div> css .scroll { overflow: auto; padding: 0 30px; width: 6em; border: 1px solid black; background: lime content-box; } .padding-box { overflow-clip-box: padding-box; } js function scrollsomeelements() { var elms = document.queryselectorall('.scroll'); for (i=0; i < elms.length; ++i) { elms[i].scrollleft=80; } } var elt = document.queryelementsbytagname('body')[0]; elt.addeventlistener("load", scrollsomeelements, false); result specifications this property has been proposed to the w3c csswg; it is not yet on the standard track but, if accepted, should appear in css overflow module level 3.
Embedding Tips
the nsicontextmenulistener::onshowcontextmenu() method will be called with the dom node that the context applies, the dom event plus some flag combinations that assist in determining what menu to display (document, link, image, selected text etc.) how do i implement tool tips?
Getting from Content to Layout
the frame constructor takes these notifications and does the following: dispatches "restyle events" which trigger the reprocessing of relevant css selectors and any restyling that needs to occur.
How to get a process dump with Windows Task Manager
right-click firefox.exe and select "create dump file".
Introduction to Layout in Mozilla
notifications passes these to the style set object, who in turn passes to the frame constructor frame constructor creates frames constructframeinternal recursively walks content tree, resolves style and creates frames either created by tag (<select>) or by display type (<p>) frame manager maintains mapping from content to frame style resolution compute stylistic information based on the style rules that apply for the frame’s content node style data broken into different structures display, visibility, font, color, background, … inherit vs.
Addon
the user is provided a ui for this in the add-ons manager and it's the add-on provider's responsibility to remember its selection.
Bootstrapping a new locale
you have to set your selected language still.
Index
you've setup up your local and remote environments, you've selected your l10n tools and projects, done some localization and even some testing!
Localization and Plurals
selecting a table entry will populate the bottom box with sample uses of the word for some numbers.
Localization content best practices
please select another.
Localizing XLIFF files for iOS
enter the command git clone https://github.com/mozilla-l10n/firefoxios-l10n/your-locale-code/ you should now see the firefox-ios project in your selected directoy with the firefox-ios.xliff file in it.
Localizing extension descriptions
the process for selecting the em:localized property to use for a given locale is as follows: if a property exists with an em:locale that matches the locale exactly, then use that.
Localizing extension metadata on addons.mozilla.org
in step 2, you'll be asked to provide the attributes listed above in the add-on's default locale (selected in step 1).
Localizing with Mercurial
in order to do so, right-click on your computer icon, choose properties > advanced > environmental variables, select path and click edit.
Translation phase
this is where you research and select the search plugins, content and protocol handlers, bookmarks, and links to recommended sites on the in-product pages that your locale's users will find in their mozilla products.
Localization sign-off reviews
in the attachment details, select the ?
Localization technical reviews
in the attachment details, select the ?
MathML Screenshots
you can get the mathml source of a formula or a selected expression.
Investigating leaks using DMD heap scan mode
moz_cc_log_directory=$logdir: this selects the location for cycle collector logs to be saved.
Leak-hunting strategies and tips
then go on to selecting a folder, then selecting a message, and then other activities one does while reading mail.
Memory Profiler
select the memoryprofiler tab.
Refcount tracing and balancing
first, you select one of three environment variables to choose what kind of logging you want.
TimerFirings logging
_shot): [content] http://widgets.outbrain.com/outbrain.js:20:330 186 fn timer (one_shot): nsbrowserstatusfilter::timeouthandler 138 fn timer (one_shot): [content] https://self-repair.mozilla.org/repair/:7:13669 118 fn timer (one_shot): [content] http://a.visualrevenue.com/vrs.js:6:9423 108 fn timer (slack): layeractivitytracker 104 fn timer (slack): nsidocument::selectorcache 104 fn timer (slack): cctimerfired ...
dtrace
the -n option combined with the mach_kernel::wakeup selects a probe point.
browser.search.context.loadInBackground
browser.search.context.loadinbackground controls whether a search from the context menu with "search <search engine> for <selected text>" opening a new tab will give focus to it and load it in the foreground or keep focus on the current tab and open it in the background.
dom.event.clipboardevents.enabled
dom.event.clipboardevents.enabled lets websites get notifications if the user copies, pastes, or cuts something from a web page, and it lets them know which part of the page had been selected.
mail.tabs.drawInTitlebar
the subject of the currently selected mail).
Preferences system
you should also be careful to specify the width of the window (in em) as appropriate using the preprocessor for each targeted platform, as well as the height (in em) for platforms where the window size does not change as the selected panel is changed (e.g.
Research and prep
your selections for default rss readers and content handlers should follow these guidelines: be translated in your language (because it makes the application unusable if it's not in your language provide for the intended user experience (e.g., minimal to no advertisements within the user experience) no more than three (if possible) choices.
NSPR Poll Method
the prototype of the poll method is print16 poll_method(prfiledesc *fd, print16 in_flags, print16 *out_flags); the purpose of the poll method is to allow a layer to modify that flags that will ultimately be used in the call to the underlying network transport's select (or equivalent) function, and to indicate that a layer is already able to make progress in the manner suggested by the polling flags.
Optimizing Applications For NSPR
the only exception to this rule is the <tt>select()</tt> and <tt>poll()</tt> system calls on unix, both of which nspr has overridden to make sure they are aware of the nspr local threads.
PR_GetDefaultIOMethods
description after using pr_getdefaultiomethods to identify the default i/o methods table, you can select elements from that table with which to build your own layer's methods table.
PR_Notify
if more than one thread is waiting, the selection of which thread gets promoted cannot be determined in advance.
PR_NotifyCondVar
if more than one thread is waiting, the selection of which thread gets promoted cannot be predicted.
PR_Poll
cross-platform applications should only set the fd field to a pointer to a prfiledesc object representing a socket or a pollable event because on windows the select function can only be used with sockets.
An overview of NSS Internals
each layer defines its own functions for the open/close/read/write/poll/select (etc.) functions.
JSS FAQ
MozillaProjectsNSSJSSJSS FAQ
sslclientcertificateselectioncallback is analogous to ssl_getclientauthdatahook.
Using JSS
MozillaProjectsNSSJSSUsing JSS
you need to select the right version of the components, based on the version of jss you are using.
NSS Key Log Format
the size of the hex-encoded secret depends on the selected cipher suite.
NSS_3.12_release_notes.html
any public header file bug 213359: enhance pk12util to extract certs from p12 file bug 329067: nss encodes cert distinguished name attributes with wrong string type bug 339906: sec_pkcs12_install_bags passes uninitialized variables to functions bug 396484: certutil doesn't truncate existing temporary files when writing them bug 251594: certificate from pkcs#12 file with colon in friendlyname not selectable for signing/encryption bug 321584: nss pkcs12 decoder fails to import bags without nicknames bug 332633: remove duplicate header files in nss/cmd/sslsample bug 335019: pk12util takes friendly name from key, not cert bug 339173: mem leak whenever secmod_handle_string_arg called in loop bug 353904: klocwork null ptr deref in secasn1d.c bug 366390: correct misleading function names in fipstest b...
NSS 3.16.1 release notes
nss 3.16.1 source distributions are available on ftp.mozilla.org for secure https download: source tarballs: https://ftp.mozilla.org/pub/mozilla.org/security/nss/releases/nss_3_16_1_rtm/src/ new in nss 3.16.1 new functionality added the "ecc" flag for modutil to select the module used for elliptic curve cryptography (ecc) operations.
NSS 3.21 release notes
sing after having been negotiated ssl_error_unexpected_extended_master_secret - error code for receiving an extended master secret when previously not negotiated in sslt.h ssl_enable_extended_master_secret - configuration to enable the tls extended master secret extension (rfc 7627) ssl_preinfo_version - used with sslpreliminarychannelinfo to indicate that a tls version has been selected ssl_preinfo_cipher_suite - used with sslpreliminarychannelinfo to indicate that a tls cipher suite has been selected ssl_preinfo_all - used with sslpreliminarychannelinfo to indicate that all preliminary information has been set notable changes in nss 3.21 nss now builds with elliptic curve ciphers enabled by default (bug 1205688) nss now builds with warnings as errors (bug 118...
NSS 3.24 release notes
the caller is no longer required to use sslkeatype explicitly to select a "slot" into which the certificate is configured (which incorrectly identifies a key agreement type rather than a certificate).
NSS 3.25.1 release notes
previously, with rare server configurations, an md5 signature algorithm might have been selected for client authentication and caused the client to abort the connection soon after.
NSS 3.26.2 release notes
previously, with rare server configurations, an md5 signature algorithm might have been selected for client authentication and caused the client to abort the connection soon after.
NSS 3.32 release notes
feedback bugs discovered should be reported by filing a bug report with bugzilla.mozilla.org (select the product 'nss').
NSS 3.33 release notes
feedback bugs discovered should be reported by filing a bug report with bugzilla.mozilla.org (select product 'nss').
NSS 3.34.1 release notes
feedback bugs discovered should be reported by filing a bug report with bugzilla.mozilla.org (select product 'nss').
NSS 3.34 release notes
feedback bugs discovered should be reported by filing a bug report with bugzilla.mozilla.org (select product 'nss').
NSS 3.47 release notes
verification not constant time bug 1578238 - handle invald tag sizes for ckm_aes_gcm bug 1576295 - check all bounds when encrypting with seed_cbc bug 1580286 - nss rejects tls 1.2 records with large padding with sha384 hmac bug 1577448 - create additional nested s/mime test messages for thunderbird bug 1399095 - allow nss-try to be used to test nspr changes bug 1267894 - libssl should allow selecting the order of cipher suites in clienthello bug 1581507 - fix unportable grep expression in test scripts bug 1234830 - [cid 1242894][cid 1242852] unused values bug 1580126 - fix build failure on aarch64_be while building freebl/gcm bug 1385039 - build nspr tests as part of nss continuous integration bug 1581391 - fix build on openbsd/arm64 after bug #1559012 bug 1581041 - mach-commands -> ...
NSS 3.56 release notes
bug 1588941 - send empty certificate message when scheme selection fails.
Overview of NSS
rsa standard that governs selected attribute types, including those used with pkcs #7, pkcs #8, and pkcs #10.
Python binding for NSS
_cache_with_opt() nss.ssl.get_max_server_cache_locks() nss.ssl.set_max_server_cache_locks() nss.ssl.shutdown_server_session_id_cache() the following constants were added nss.nss.int.pk11_dis_could_not_init_token nss.nss.int.pk11_dis_none nss.nss.int.pk11_dis_token_not_present nss.nss.int.pk11_dis_token_verify_failed nss.nss.int.pk11_dis_user_selected nss.nss.int.pkcs12_des_56 nss.nss.int.pkcs12_des_ede3_168 nss.nss.int.pkcs12_rc2_cbc_128 nss.nss.int.pkcs12_rc2_cbc_40 nss.nss.int.pkcs12_rc4_128 nss.nss.int.pkcs12_rc4_40 the following files were added test/run_tests test/test_cipher.py (replaces cipher_test.py) test/test_client_server.py test/test_digest.py (replaces digest_tes...
NSS tools : modutil
clearing the default provider has the same format: modutil -undefault "nss internal pkcs #11 module" -dbdir -mechanisms md2:md5 enabling and disabling modules and slots modules, and specific slots on modules, can be selectively enabled or disabled using modutil.
NSS tools : pk12util
if the cryptographic module does not support the requested algorithm, then the next best fit will be selected (usually the default).
NSS reference
data types based on "selected ssl types and structures" in the ssl reference.
OLD SSL Reference
ssl, pkcs #11, and the default security databases setting up the certificate and key databases setting up the ca db and certificate setting up the server db and certificate setting up the client db and certificate verifying the server and client certificates building nss programs chapter 3 selected ssl types and structures this chapter describes some of the most important types and structures used with the functions described in the rest of this document, and how to manage the memory used for them.
ssltyp.html
upgraded documentation may be found in the current nss reference selected ssl types and structures chapter 3 selected ssl types and structures this chapter describes some of the most important types and structures used with the functions described in the rest of this document, and how to manage the memory used for them.
NSS_3.12.3_release_notes.html
bug 394077: libpkix need to return revocation status of a cert bug 412468: modify certutil bug 417092: modify pkix_certselector api to return an error if cert was rejected.
NSS Tools pk12util
it may be the case that the cryptographic module does not support the requested algorithm and a best fit will be selected, likely to be the default.
NSS tools : modutil
MozillaProjectsNSStoolsmodutil
clearing the default provider has the same format: modutil -undefault "nss internal pkcs #11 module" -dbdir -mechanisms md2:md5 enabling and disabling modules and slots modules, and specific slots on modules, can be selectively enabled or disabled using modutil.
NSS tools : pk12util
if the cryptographic module does not support the requested algorithm, then the next best fit will be selected (usually the default).
Installing Pork
to tell mcpp which gcc installation to integrate itself with, place the selected gcc bin dir as the first element of your path: path=/bindir/of/my/gcc:$path if you want to use a gcc that has binaries named something other than "gcc" and "g++", or you use "ccache" for you main gcc installation and want mcpp to override a separate installation, you need to pass the options "cc=gccxxx cxx=g++xxx" to "./configure".
Rhino overview
in browser embeddings, this language version is selected using the language attribute of the script tag with values such as "javascript1.2".
Index
the javascript engine selects a prototype object for you.
Tracing JIT
only one architecture-specific variant is included into any given build of the assembler; the architecture is selected and fixed when the build is configured.
Self-hosted builtins in SpiderMonkey
a select set of c++-implemented builtins is installed via the intrinsic_functions array in selfhosting.cpp, as described below.
SpiderMonkey Internals
most of the work here is selectively enabling compiler-specific intrinsics such as gcc's __builtin_ctz, which is useful in calculating base-2 logarithms of integers.
JS_DefineFunctions
propertydefinitionbehavior is used to select if properties with jsprop_define_late flag should be defined on the object.
JS_GetGCParameter
jsgc_mode / "mode" select gc mode: jsgc_mode_global (0) the gc runs all objects are visited in a singleslice.
JS_GetParent
otherwise, if the context is running any scripts or functions, a default parent object is selected based on those.
JS_GetScopeChain
these objects represent the lexical scope of the currently executing statement or expression, not the call stack, so they include: the variable objects of any enclosing functions or let statements or expressions, and any objects selected by enclosing with statements, in order from the most-nested scope outward; lastly the global object against which the function was created.
SpiderMonkey 1.8.5
to select an alternate c++ compiler, invoke configure thus: cxx=/usr/bin/g++-4.0 /path/configure --my-configuration-options js-config the new configure-based build system does not correctly generate the js-config script on many platforms, nor when js-ctypes are enabled.
SpiderMonkey 1.8.7
to select an alternate c++ compiler, invoke configure thus: cxx=/usr/bin/g++-4.0 /path/configure --my-configuration-options js-config the new configure-based build system does not correctly generate the js-config script on many platforms, nor when js-ctypes are enabled.
Shell global objects
selectforgc(obj1, obj2, ...) schedule the given objects to be marked in the next gc slice.
Web Replay
getting started to enable web replay (macos and firefox nightly only), go to devtools settings and select "enable webreplay".
Redis Tips
node.js redis client: https://github.com/mranney/node_redis npm install redis python redis client: https://github.com/andymccurdy/redis-py there are some gotchas with the python api: https://github.com/andymccurdy/redis-py#api-reference select statement not implemented del is 'delete' in python zadd argument order is wrong setex argument order is wrong the default redis port is 6379.
Setting up an update server
if you've built your own mar, you can obtain its sha512 checksum by running the following command, which should work in linux, macos, or windows in the mozillabuild environment: shasum --algorithm 512 <filename> on windows, you can get the exact file size in bytes for your mar by right clicking on it in the file explorer and selecting properties.
Signing Mozilla apps for Mac OS X
click "create a certificate" at the top right corner select the "developer id" radio button and uncheck the "developer id installer certificate" box.
Gecko object attributes
grabbed true when the accessible object has been selected for dragging.
ROLE_CELL
interfaces nsiaccessible nsisupports nsiaccessibletext nsiaccessiblehypertext nsiaccessibleeditabletext nsiaccessiblehyperlink nsiaccessibleselectable nsiaccessiblevalue nsiaccessnode mapped to at-spi: atk_role_table_cell atk: atk_role_list_item ua: nsaccessibilitygrouprole msaa/ia2: role_system_cell used by aria: gridcell xul: <listcell/> html: <td> ...
ROLE_MENUITEM
« gecko roles page represents a menu item, which is an entry in a menu that a user can choose to carry out a command, select an option.
ROLE_OUTLINEITEM
interfaces nsiaccessibletreecache nsiaccessible nsiaccessibleselectable nsiaccessnode mapped to at-spi: role_list_item atk: atk_role_list_item ua: nsaccessibilityrowrole (use outlinerow as subrole) msaa/ia2: role_system_outlineitem used by aria: treeitem html: ??
ROLE_ROW
interfaces nsiaccessible nsisupports nsiaccessiblehyperlink nsiaccessibleselectable mapped to at-spi: role_list_item atk: atk_role_list_item ua: nsaccessibilityrowrole msaa/ia2: role_system_row used by aria: row html: <tr> xul:<listitem/> ...
XUL Accessibility
name the following rules to generate accessible name are applied: check aria-labelledby attribute, name is generated from elements pointed by aria-labelledby attribute <description id="descr1">label1</description> <description id="descr2">label2</description> <textbox aria-labelledby="descr1 descr2" /> if the element implements nsidomxullabeledcontrolelement or nsidomxulselectcontrolitemelement interface then it is used label property if the element doesn't implement nsidomxulselectcontrolelement then label attribute is used if neighbour of the element has label element pointing to this element by the control attribute, if the label element is found then use value attribute or its content.
Mork
MozillaTechMork
you pass in a file to parsefile, select the tables, and then pass in callback functions for the meta-row and row enumeration functions.
Places Developer Guide
getservice(components.interfaces.nspiplacesdatabase).dbconnection; } and then to get the a redirected visit_id from another visit_id: function getfromvisit(visit_id) { var sql = <cdata><![cdata[ select from_visit from moz_places, moz_historyvisits where moz_historyvisits.id = :visit_id and moz_places.id = moz_historyvisits.place_id; ]]></cdata>.tostring(); var sql_stmt = getplacesdbconn.createstatement(sql); sql_stmt.params.visit_id = visit_id; var from_visit; try { // here we can't use the "executeasync" method since have to return a // result right-away.
Querying Places
the current behavior does the normal query and then selects keywords from the first query and filters all the results.
Using the Places keywords API
each keyword can be associated with post data, in such a case a post action will be executed when the given url is selected from the awesomebar.
NS_ConvertASCIItoUTF16
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
NS_ConvertUTF16toUTF8
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
NS_ConvertUTF8toUTF16
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
NS_LossyConvertUTF16toASCII
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsAdoptingCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsAdoptingString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsAutoString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsCAutoString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsDependentCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsDependentString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsFixedCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsFixedString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsPromiseFlatCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsPromiseFlatString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsXPIDLCString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
nsXPIDLString
@param astring is substring to be sought in this @param aignorecase selects case sensitivity @param aoffset tells us where in this string to start searching @param acount tells us how far from the offset we are to search.
jsdIStackFrame
scripts typically select this with the "language" attribute.
mozIStoragePendingStatement
note: for read statements, such as select, once you cancel the statement, you will receive no further notifications about results.
mozIStorageStatement
sample code var statement = dbconn.createstatement( "select * " + "from table_name " + "where column_name like :userinput escape '/'" ); statement.params.userinput = statement.escapestringforlike(someuserinput, "/"); binding functions these functions are discussed in more detail with sample code in the overview document.
mozIStorageStatementParams
for example, say you create a statement like so: var statement = dbconn.createstatement("select * from table_name where id = :item_id"); this object would have one property, item_id, that you can use to bind a value to that named parameter like so: statement.params.item_id = 2; for more details on why you should bind parameters as opposed to hard-coding them into your statement, please see the overview document about binding parameters.
mozIStorageStatementRow
for example, say you create a statement like so: var statement = dbconn.createstatement("select id, name from table_name"); the object would have two properties, id and name, that can be used to get the value of the column after you have called mozistoragestatement.executestep() like so: while (statement.executestep()) { let id = statement.row.id; let name = statement.row.name; } see also storage mozistoragestatement ...
nsIAccessibilityService
accessible createhtmlimageaccessible(in nsisupports aframe); nsiaccessible createhtmllabelaccessible(in nsisupports aframe); nsiaccessible createhtmllabelaccessible(in nsidomnode anode, in nsiweakreference apresshell); nsiaccessible createhtmlobjectframeaccessible(in nsobjectframe aframe); nsiaccessible createhtmlradiobuttonaccessible(in nsisupports aframe); nsiaccessible createhtmlselectoptionaccessible(in nsidomnode anode, in nsiaccessible aaccparent, in nsiweakreference apresshell); nsiaccessible createhtmltableaccessible(in nsisupports aframe); nsiaccessible createhtmltablecellaccessible(in nsisupports aframe); nsiaccessible createhtmltableheadaccessible(in nsidomnode adomnode); nsiaccessible createhtmltextaccessible(in nsisupports aframe); nsiaccessible createh...
nsIAppStartup
the application will be restarted with an empty command line and the normal profile selection process will take place on startup.
nsIApplicationCacheChannel
see the 'cache selection algorithm' and cache_selection_reload action handling in nscontentsink.
nsIApplicationCacheService
nsiapplicationcache chooseapplicationcache( in acstring key ); parameters key the cache entry key for which to select an application cache.
nsIBrowserSearchService
if this value is false, the engine will be added to the list upon successful load, but it will not be selected as the current engine.
nsIClassInfo
nsisupports gethelperforlanguage( in pruint32 language ); parameters language this parameter selects the language mapping specific helper object to be returned.
nsIClipboardHelper
aclipboardid the id of the clipboard to copy to (for example kselectionclipboard).
nsIContentFrameMessageManager
var acfmm = gbrowser.selectedbrowser._docshell.queryinterface(ci.nsiinterfacerequestor).getinterface(ci.nsicontentframemessagemanager); get content message manager from content window window here is a html window or any window inside a tab, this code would run from a framescript.
nsIConverterInputStream
this allows reading unicode strings from a stream, automatically converting the bytes from a selected character encoding.
nsIConverterOutputStream
exceptions thrown ns_error_loss_of_significant_data if areplacementcharacter is not encodable in the selected character encoding and an attempt is made to write the character.
nsIDOMEvent
04 mouseout 0x00000008 mousemove 0x00000010 mousedrag 0x00000020 click 0x00000040 dblclick 0x00000080 keydown 0x00000100 keyup 0x00000200 keypress 0x00000400 dragdrop 0x00000800 focus 0x00001000 blur 0x00002000 select 0x00004000 change 0x00008000 reset 0x00010000 submit 0x00020000 scroll 0x00040000 load 0x00080000 unload 0x00100000 xfer_done 0x00200000 abort 0x00400000 error 0x00800000 locate 0x01000000 move 0x02000000 re...
nsIDOMFileList
the nsidomfilelist interface contains a list of nsidomfile objects describing the files selected by the user for a "file" input field on a web form.
nsIDialogCreator
introduced gecko 2.0 inherits from: nsisupports last changed in gecko 2.0 (firefox 4 / thunderbird 3.3 / seamonkey 2.1) method overview void opendialog(in unsigned long atype, in acstring aname, in acstring afeatures, in nsidialogparamblock aarguments, [optional] in nsidomelement aframeelement); constants constant value description unknown_dialog 0 generic_dialog 1 select_dialog 2 methods opendialog() void opendialog( in unsigned long atype, in acstring aname, in acstring afeatures, in nsidialogparamblock aarguments, in nsidomelement aframeelement optional ); parameters atype aname afeatures aarguments aframeelement optional ...
nsIDownloadManager
useful if, for example, you want the window to select a certain download.
nsIDownloadManagerUI
aid optional the id of the download to be preselected upon opening the download manager ui.
nsIDownloader
if null, the downloader will select a location and the resulting file will be deleted (or otherwise made invalid) when the downloader object is destroyed.
nsIFile
on win32 platforms, it is the currently selected ansi codepage (specified by cp_acp).
nsIFileView
selectedfiles nsiarray an nsiarray of selected files, which contains nsiarray instances.
nsIFocusManager
movecarettofocus() moves the selection caret within awindow to the current focus.
nsILoginManagerPrompter
note: because the caller does not know the username of the login to be changed, anewlogin.username and anewlogin.usernamefield will be set (using the user's selection) before modifylogin() is called.
nsILoginManagerStorage
the login manager will handle selecting and using the correct nsiloginmanangerstorage module.
nsIMacDockSupport
the application should call this to activate itself when one of its dock menu items are selected, since doing so does not automatically activate the application.
nsIMessenger
setdocumentcharset() redisplay the currently selected message (if any) using the given character set.
nsIMicrosummaryService
if the caller passes a bookmark id, and one of the microsummaries is the current one for the bookmark, this method will retrieve content from the datastore for that microsummary, which is useful when callers want to display a list of microsummaries for a page that isn't loaded, and they want to display the actual content of the selected microsummary immediately (rather than after the content is asynchronously loaded).
nsIMimeConverter
thunderbird provides a utility function which performs this for the currently selected message: markcurrentmessageasread().
nsIMsgCompFields
it should be initialized to true and set to false when 'send anyway' is selected by a user.
nsIMsgFolder
cansubscribe boolean readonly canfilemessages boolean readonly noselect boolean readonly: this is an imap no select folder imapshared boolean readonly: this is an imap shared folder candeletemessages boolean readonly: can't delete from imap read-only cancreatesubfolders boolean readonly: does this folder allow subfolders.
nsIMsgMessageService
e.g., header=filter return the nsiuri that gets run example for example, the next piece of code shows the selected message code on a dialog: (taken from mozillazine) var content = ""; var messageuri = getfirstselectedmessage(); var msgservice = messenger.messageservicefromuri(messageuri); var msgstream = components.classes["@mozilla.org/network/sync-stream-listener;1"].createinstance(); var consumer = msgstream.queryinterface(components.interfaces.nsiinputstream); var scriptinput = components.
nsINavHistoryResultObserver
this is especially useful when updating user interfaces, to avoid flicker or continuous selection changes, which may result in performance degradation (for example, if updating a view for each update).
nsINavHistoryResultTreeViewer
this prevents you from seeing multiple entries for things when you have selected to get visits.
nsIPrompt
checkmsg, inout boolean checkvalue); boolean promptpassword(in wstring dialogtitle, in wstring text, inout wstring password, in wstring checkmsg, inout boolean checkvalue); boolean promptusernameandpassword(in wstring dialogtitle, in wstring text, inout wstring username, inout wstring password, in wstring checkmsg, inout boolean checkvalue); boolean select(in wstring dialogtitle, in wstring text, in pruint32 count, [array, size_is(count)] in wstring selectlist, out long outselection); constants the button flags defined in nsiprompt are the same as those defined in nsipromptservice.constants.
nsIScreenManager
if the rectangle overlaps multiple screens, the screen containing the majority of the rectangle's area is selected and returned.
nsIScriptableIO
if you need to select a file in a subdirectory, you should get a reference to the directory, then use the file's append() method to navigate through the directory hierarchy to the file you really want.
nsIScriptableUnescapeHTML
this is equivalent to calling nsiparserutils::converttoplaintext(src, nsidocumentencoder::outputselectiononly | nsidocumentencoder::outputabsolutelinks, 0).
nsIScrollable
example var nsiscr = gbrowser.selectedbrowser.docshell.queryinterface(components.interfaces.nsiscrollable); var v={}; var h={}; nsiscr.getscrollbarvisibility(v,h); v.value //returns true if the vertical scrollbar is displayed h.value //returns true if the horizontal scrollbar is displayed ...
nsISearchEngine
responsetype since an engine can have several different request urls, differentiated by response types, this parameter selects a request to add parameters to.
nsIServerSocket
pass -1 to indicate no preference, and a port will be selected automatically.
nsISessionStore
if you you are working in a browser.xul overlay and want the currently selected tab, it's as simple as gbrowser.selectedtab.
nsITaskbarPreview
method overview void invalidate(); attributes attribute type description active boolean indicates whether or not the preview is marked as active (currently selected) in the taskbar.
nsIToolkitProfileService
selectedprofile nsitoolkitprofile the profile that is marked as "default=1" in the profiles.ini file.
nsITreeBoxObject
selectionregion nsiscriptableregion readonly: return the region for the visible parts of the selection, in device pixels.
nsIUserCertPicker
inherits from: nsisupports last changed in gecko 1.7 method overview nsix509cert pickbyusage(in nsiinterfacerequestor ctx, in wstring selectednickname, in long certusage, in boolean allowinvalid, in boolean allowduplicatenicknames, out boolean canceled); methods pickbyusage() nsix509cert pickbyusage( in nsiinterfacerequestor ctx, in wstring selectednickname, in long certusage, in boolean allowinvalid, in boolean allowduplicatenicknames, out boolean canceled ); parameters ctx selectednickname certusage allowinvalid allowduplicatenicknames canceled return value ...
nsIWebBrowserPersist
encode_flags_selection_only 1 output only the current selection as opposed to the whole document.
nsMsgFolderFlagType
const nsmsgfolderflagtype imapotheruser = 0x00200000; /// whether this is the template folder const nsmsgfolderflagtype templates = 0x00400000; /// this folder is one of your personal folders that is shared with other users const nsmsgfolderflagtype personalshared = 0x00800000; /// this folder is an imap \\noselect folder const nsmsgfolderflagtype imapnoselect = 0x01000000; /// this folder created offline const nsmsgfolderflagtype createdoffline = 0x02000000; /// this imap folder cannot have children :-( const nsmsgfolderflagtype imapnoinferiors = 0x04000000; /// this folder configured for offline use const nsmsgfolderflagtype offline = 0x08000000; /// this folder has off...
The Thread Manager
when you dispatch an event to the pool, the pool selects an available worker thread to process the event.
Using the clipboard
if you use kselectionclipboard instead, you will copy into the selection buffer, which is generally only available on unix systems.
XPIDL
however, the presence of the binaryname property allows the user to select another name to use in native code (to avoid conflicts with other functions).
Filelink Providers
the account setup dialog the account setup dialog allows the user to select what account type they would like to create from a menulist.
Adding items to the Folder Pane
however, the complete example file includes code to display the number selected in thunderbird's main viewing pane, when such a number is selected in the folder pane.
Detect Opening Folder
to do this you need to capture the select event of the folder [[xul:tree|tree]] whose id is (conveniently) foldertree like so: window.document.getelementbyid('foldertree').addeventlistener("select", testcolumns, false); ...
Use SQLite
storage of 2mb: var db = opendatabase('mydb', '1.0', 'test db', 2 * 1024 * 1024); var msg; db.transaction(function (tx) { tx.executesql('create table if not exists logs (id unique, log)'); tx.executesql('insert into logs (id, log) values (1, "foobar")'); tx.executesql('insert into logs (id, log) values (2, "logmsg")'); msg = '<p>log message created and row inserted.</p>'; document.queryselector('#status').innerhtml = msg; }); db.transaction(function (tx) { tx.executesql('select * from logs', [], function (tx, results) { var len = results.rows.length, i; msg = "<p>found rows: " + len + "</p>"; document.queryselector('#status').innerhtml += msg; for (i = 0; i < len; i++){ msg = "<p><b>" + results.rows.item(i).log + "</b></p>"; document.queryselector('#status')...
Styling the Folder Pane
noselect-{true, false} afolder.noselect indicates whether or not the folder is selectable.
Tips and Tricks from the newsgroups
display using css sprites messages use reminderfox to open a message in the default thunderbird message window (when messageuri, folderuri and gdbview are unknown) determine whether a message has been flagged as junk imap: getting message key of copied message by nsimsgcopyservice::copyfilemessage access the plain text content of the email body get information about attachment without selecting message repeat image display using css sprites scan for new messages at startup and manually scan a folder initiated by user force listeners to run consecutively to prevent pop messages from getting garbled during message retrieval ...
Using MAPI with Thunderbird's Windows 7 developer builds
(one way to create an elevated shell is to invoke the command prompt from the start menu, right click, and select run as administrator.) in the elevated shell, change to the objdir/mozilla/dist/bin directory and enter this command: regsvr32 mapiproxy_inuse.dll ...
Working with windows in chrome code
for example: // alerts the title of the document displayed in the content-primary widget alert(content.document.title); for example, you can use content.document in a browser.xul overlay to access the web page in the selected tab in a firefox window.
Mozilla
in the manager, select the database you want to explore in the '(select profile database)' pulldown, click 'go', select one of the tables listed in the left column and see the current contents of the database in the 'browse & search' tab.) gecko gecko is the name of the layout engine developed by the mozilla project.
Plug-in Development Overview - Plugins
the plug-in can select one of these transmission modes: normal mode: the browser sends the stream data sequentially to the plug-in as the data becomes available.
Streams - Plugins
the plug-in instance selects a transmission mode for streams produced by the browser.
Preferences System
you should also be careful to specify the width of the window (in em) as appropriate using the preprocessor for each targeted platform, as well as the height (in em) for platforms where the window size does not change as the selected panel is changed (e.g.
DOM Inspector - Firefox Developer Tools
or, build thunderbird yourself with the following options: ac_add_options --enable-extensions="default inspector" ac_add_options --enable-inspector-apis mozilla suite and seamonkey select tools > web development > dom inspector.
Application - Firefox Developer Tools
if you can’t see it there, you can enable it by going to the "three dot" menu and selecting settings (also accessible by pressing f1), then checking the application checkbox under default developer tools.
Debug worker threads - Firefox Developer Tools
inspecting worker code for example, see the selected item worker.js below — it is listed in a separate thread in the sources list, but appears in the source pane in the same way as main thread code when selected.
Ignore a source - Firefox Developer Tools
however, you can tell the debugger to ignore the details of selected sources.
Set a conditional breakpoint - Firefox Developer Tools
to set a conditional breakpoint, activate the context menu in the source pane, on the line where you want the breakpoint, and select "add conditional breakpoint".
Debugger keyboard shortcuts - Firefox Developer Tools
find next in the current file ctrl + g cmd + g ctrl + g search for scripts by name ctrl + p cmd + p ctrl + p resume execution when at a breakpoint f8 f8 1 f8 step over f10 f10 1 f10 step into f11 f11 1 f11 step out shift + f11 shift + f11 1 shift + f11 toggle breakpoint on the currently selected line ctrl + b cmd + b ctrl + b toggle conditional breakpoint on the currently selected line ctrl + shift + b cmd + shift + b ctrl + shift + b 1.
Set a logpoint - Firefox Developer Tools
(either press esc or select the elipsis menu (...) and then click show split console.) when should you use logpoints?
Set event listener breakpoints - Firefox Developer Tools
selecting this and then choosing some events to break on will mean that when you step through code, information about events fired will be logged to the console instead of the devtools breaking on each one.
Tutorial: Set a breakpoint - Firefox Developer Tools
reportdo.script.setbreakpoint(0, { hit: function (frame) { console.log('hit breakpoint in ' + frame.callee.name); console.log('what = ' + frame.eval('what').return); } }); console.log('finished setting breakpoint!'); in the scratchpad, ensure that no text is selected, and press the “run” button.
Basic operations - Firefox Developer Tools
to create a diff, click the button that looks like a venn diagram next to the camera icon (before firefox 47, this looked like a "+/-" icon): you'll be prompted to select the snapshot to use as a baseline, then the snapshot to compare.
Throttling - Firefox Developer Tools
selection download speed upload speed minimum latency (ms) gprs 50 kbps 20 kbps 500 regular 2g 250 kbps 50 kbps 300 good 2g 450 kbps 150 kbps 150 regular 3g 750 kbps 250 kbps 100 good 3g 1.5 mbps 750 kbps 40 regular 4g/lte 4 mbps 3 mbps 20 dsl 2 mbps 1 mbps 5 ...
Network monitor toolbar - Firefox Developer Tools
when you select persist logs, the log is not cleared on page load.
Examine and edit the box model - Firefox Developer Tools
viewing the box model with the select element button pressed, if you hover over an element in the page, the box model for the element is shown overlaid on the page: it's also shown overlaid if you hover over an element's markup in the html pane: if the element is inline and is split over multiple line boxes, the highlighter shows each individual line box that together make up the element: the box model view when an element's selected, you can get a detailed look at the box model in the box model view: if you hover over a value, you'll see a tooltip telling you which rule the value comes from: if you hover over part of the box model in the box model view, the corresponding part of the page is highlighted: editing the box model you can also edit the values in the box m...
Open the Inspector - Firefox Developer Tools
right-click an element on a web page and select inspect element.
How to - Firefox Developer Tools
css flexbox inspector: examine flexbox layoutscss grid inspector: examine grid layoutsedit css filtersedit shape paths in cssedit fontsexamine event listenersexamine and edit cssexamine and edit htmlexamine and edit the box modelinspect and select colorsopen the inspectorreposition elements in the pageselect an elementselect and highlight elementsuse the inspector apiuse the inspector from the web consoleview background imagesvisualize transformswork with animations ...
Page Inspector - Firefox Developer Tools
how to to find out what you can do with the inspector, see the following how to guides: open the inspector examine and edit html examine and edit the box model inspect and select colors reposition elements in the page edit fonts visualize transforms use the inspector api select an element examine and edit css examine event listeners work with animations edit css filters edit css shapes view background images use the inspector from the web console examine css grid layouts examine css flexbox layouts reference keyboard shortcuts settings ...
Frame rate - Firefox Developer Tools
if we select one of these slices of the recording, the main waterfall view underneath it is zoomed into it, and we can see the function that's causing the problem: we have a javascript function from a click event that's blocking the main thread for 170 milliseconds.
Cache Storage - Firefox Developer Tools
if you select a cache, you'll see a list of the resources it contains.
Extension Storage - Firefox Developer Tools
when selecting an extension id in the storage tree of the storage inspector, a table lists the details of all the extension storage present for the extension.
Working with iframes - Firefox Developer Tools
if you select an entry in the list, all the tools in the toolbox - the inspector, the console, the debugger and so on - will now target only that iframe, and will essentially behave as if the rest of the page does not exist.
about:debugging - Firefox Developer Tools
click the button, navigate to the directory containing the add-on and select its manifest file.
AbortController.AbortController() - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.queryselector('.download'); var abortbtn = document.queryselector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController.abort() - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.queryselector('.download'); var abortbtn = document.queryselector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController.signal - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.queryselector('.download'); var abortbtn = document.queryselector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortController - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.queryselector('.download'); var abortbtn = document.queryselector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AbortSignal - Web APIs
var controller = new abortcontroller(); var signal = controller.signal; var downloadbtn = document.queryselector('.download'); var abortbtn = document.queryselector('.abort'); downloadbtn.addeventlistener('click', fetchvideo); abortbtn.addeventlistener('click', function() { controller.abort(); console.log('download aborted'); }); function fetchvideo() { ...
AddressErrors - Web APIs
: ["credit", "debit"] } } ]; let defaultpaymentdetails = { total: {label: 'donation', amount: {currency: 'usd', value: '65.00'}}, displayitems: [ { label: 'original donation amount', amount: {currency: 'usd', value: '65.00'} } ], shippingoptions: [ { id: 'standard', label: 'standard shipping', amount: {currency: 'usd', value: '0.00'}, selected: true } ] }; supportedhandlers describes the supported payment handlers and the details for those.
Ambient Light Events - Web APIs
example if ('ondevicelight' in window) { window.addeventlistener('devicelight', function(event) { var body = document.queryselector('body'); if (event.value < 50) { body.classlist.add('darklight'); body.classlist.remove('brightlight'); } else { body.classlist.add('brightlight'); body.classlist.remove('darklight'); } }); } else { console.log('devicelight event not supported'); } specifications specification status comment ambient light sensorthe definitio...
Animation.commitStyles() - Web APIs
examples const divelem = document.queryselector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); }); specifications specification status comment web animationsthe definition of 'commitstyles()' in that specification.
Animation.onremove - Web APIs
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.queryselector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and...
Animation.persist() - Web APIs
WebAPIAnimationpersist
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.queryselector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and...
Animation.replaceState - Web APIs
examples in our simple replace indefinite animations demo, you can see the following code: const divelem = document.queryselector('div'); document.body.addeventlistener('mousemove', evt => { let anim = divelem.animate( { transform: `translate(${ evt.clientx}px, ${evt.clienty}px)` }, { duration: 500, fill: 'forwards' } ); anim.commitstyles(); //anim.persist() anim.onremove = function() { console.log('animation removed'); } console.log(anim.replacestate); }); here we have a <div> element, and...
Animation.updatePlaybackRate() - Web APIs
examples a speed selector component would benefit from smooth updating of updateplaybackrate(), as demonstrated below: speedselector.addeventlistener('input', evt => { cartoon.updateplaybackrate(parsefloat(evt.target.value)); cartoon.ready.then(() => { console.log(`playback rate set to ${cartoon.playbackrate}`); }); }); specifications specification status comment web animationsthe d...
Attr.localName - Web APIs
WebAPIAttrlocalName
html content <button id="example">click me</button> javascript content const element = document.queryselector("#example"); element.addeventlistener("click", function() { const attribute = element.attributes[0]; alert(attribute.localname); }); notes the local name of an attribute is the part of the attribute's qualified name that comes after the colon.
AudioBuffer.getChannelData() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var button = document.queryselector('button'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; // stereo var channels = 2; // create an empty two second stereo buffer at the // sample rate of the audiocontext var framecount = audioctx.samplerate * 2.0; var myarraybuffer = audioctx.createbuffer(2, framecount, audioctx.samplerate); button.onclick = fu...
AudioContext.createMediaElementSource() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and ...
AudioContext.createMediaStreamSource() - Web APIs
var pre = document.queryselector('pre'); var video = document.queryselector('video'); var myscript = document.queryselector('script'); var range = document.queryselector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audi...
AudioListener.dopplerFactor - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.forwardX - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.forwardY - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.forwardZ - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.positionX - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.positionY - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.positionZ - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.setOrientation() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.setPosition() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.speedOfSound - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.upX - Web APIs
WebAPIAudioListenerupX
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.upY - Web APIs
WebAPIAudioListenerupY
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener.upZ - Web APIs
WebAPIAudioListenerupZ
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioListener - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
AudioParam.exponentialRampToValueAtTime() - Web APIs
this is pretty useful for fade in/fade out effects: // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; var exprampplus = document.queryselector('.exp-ramp-plus'); var exprampminus = document.queryselector('.exp-ramp-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); /...
AudioParam.linearRampToValueAtTime() - Web APIs
// create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; var linearrampplus = document.queryselector('.linear-ramp-plus'); var linearrampminus = document.queryselector('.linear-ramp-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(...
AudioParam.setTargetAtTime() - Web APIs
// create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; var attimeplus = document.queryselector('.at-time-plus'); var attimeminus = document.queryselector('.at-time-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // cr...
AudioParam.setValueAtTime() - Web APIs
ttons are pressed, the currgain variable is incremented/decremented by 0.25, then the setvalueattime() method is used to set the gain value equal to currgain, one second from now (audioctx.currenttime + 1.) // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; var targetattimeplus = document.queryselector('.set-target-at-time-plus'); var targetattimeminus = document.queryselector('.set-target-at-time-minus'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createm...
AudioParam.setValueCurveAtTime() - Web APIs
ebaudio-examples repo for the source code, or view the example live.) when this button is pressed, setvaluecurveattime() is used to change the gain value between the values contained in the wavearray array: // create audio context var audiocontext = window.audiocontext || window.webkitaudiocontext; var audioctx = new audiocontext(); // set basic variables for example var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; var valuecurve = document.queryselector('.value-curve'); // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node and set it's gain value to 0.5 var gainnode ...
AudioProcessingEvent - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.queryselector('script'); var mypre = document.queryselector('pre'); var playbutton = document.queryselector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log...
AudioTrack.label - Web APIs
WebAPIAudioTracklabel
example this example returns an array of track kinds and labels for potential use in a user interface to select audio tracks for a specified media element.
AudioTrack.language - Web APIs
this could then be used to build a user interface for selecting the language the user would like to listen to while watching a movie, for example.
AudioTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.audiotracks.addeventlistener('addtrack', (event) => { console.log(`audio track: ${event.track.label} added`); }); using the onaddtrack event handler property: const videoelement = document.queryselector('video'); videoelement.audiotracks.onaddtrack = (event) => { console.log(`audio track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
AudioTrackList.onaddtrack - Web APIs
document.queryselector("video").audiotracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'audiotracklist.onaddtrack' in that specification.
AudioTrackList.onchange - Web APIs
var tracklist = document.queryselector("video").audiotracks; tracklist.onchange = function(event) { tracklist.foreach(function(track) { updatetrackenabledbutton(track.id, track.enabled); }); }; the updatetrackenabledbutton(), in this example, should be a function that finds a user interface control using the track's id (perhaps the app uses the track id as the control element's id) and the track's enabled flag to determin...
AudioTrackList.onremovetrack - Web APIs
document.queryselector("my-video").audiotracks.onremovetrack = function(event) { mytrackcount = document.queryselector("my-video").audiotracks.length; }; the current number of audio tracks remaining in the media element is obtained from audiotracklist property length.
AudioTrackList: removetrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.audiotracks.addeventlistener('removetrack', (event) => { console.log(`audio track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const videoelement = document.queryselector('video'); videoelement.audiotracks.onremovetrack = (event) => { console.log(`audio track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specification.
AudioTrackList - Web APIs
var audiotracks = document.queryselector("video").audiotracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
BaseAudioContext.createBufferSource() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var button = document.queryselector('button'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; // stereo var channels = 2; // create an empty two second stereo buffer at the // sample rate of the audiocontext var framecount = audioctx.samplerate * 2.0; var myarraybuffer = audioctx.createbuffer(2, framecount, audioctx.samplerate); button.onclick = fu...
BaseAudioContext.createGain() - Web APIs
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.queryselector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); ...
BaseAudioContext.createPanner() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
BaseAudioContext.createScriptProcessor() - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.queryselector('script'); var mypre = document.queryselector('pre'); var playbutton = document.queryselector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log...
BaseAudioContext.createStereoPanner() - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.queryselector('audio'); var pancontrol = document.queryselector('.panning-control'); var panvalue = document.queryselector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler functi...
BaseAudioContext.decodeAudioData() - Web APIs
note: you can run the example live (or view the source.) // define variables var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var source; var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); // use xhr to load an audio track, and // decodeaudiodata to decode it and stick it in a buffer.
BasicCardRequest - Web APIs
'diners', 'discover', 'mir', 'unionpay'] } }]; var details = { total: {label: 'donation', amount: {currency: 'usd', value: '65.00'}}, displayitems: [ { label: 'original donation amount', amount: {currency: 'usd', value: '65.00'} } ], shippingoptions: [ { id: 'standard', label: 'standard shipping', amount: {currency: 'usd', value: '0.00'}, selected: true } ] }; var options = {requestshipping: true}; try { var request = new paymentrequest(supportedinstruments, details, options); // add event listeners here.
BasicCardResponse - Web APIs
supportedtypes: ['credit', 'debit'] } }]; var details = { total: {label: 'donation', amount: {currency: 'usd', value: '65.00'}}, displayitems: [ { label: 'original donation amount', amount: {currency: 'usd', value: '65.00'} } ], shippingoptions: [ { id: 'standard', label: 'standard shipping', amount: {currency: 'usd', value: '0.00'}, selected: true } ] }; var options = {requestshipping: true}; try { var request = new paymentrequest(supportedinstruments, details, options); // add event listeners here.
BatteryManager.charging - Web APIs
example html content <div id="charging">(charging state unknown)</div> javascript content navigator.getbattery().then(function(battery) { var charging = battery.charging; document.queryselector('#charging').textcontent = charging ; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.chargingTime - Web APIs
example html content <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.chargingtime; document.queryselector('#chargingtime').textcontent = battery.chargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.dischargingTime - Web APIs
example html content <div id="dischargingtime">(discharging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { var time = battery.dischargingtime; document.queryselector('#dischargingtime').textcontent = battery.dischargingtime; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.level - Web APIs
example html content <div id="level">(battery level unknown)</div> javascript content navigator.getbattery().then(function(battery) { var level = battery.level; document.queryselector('#level').textcontent = level; }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onchargingchange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.onchargingchange = chargingchange(); function chargingchange() { document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onchargingtimechange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.onchargingtimechange = chargingtimechange(); function chargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.ondischargingtimechange - Web APIs
example html content <div id="level">(battery level unknown)</div> <div id="chargingtime">(charging time unknown)</div> javascript content navigator.getbattery().then(function(battery) { battery.ondischargingtimechange = dischargingtimechange; function dischargingtimechange(){ document.queryselector('#level').textcontent = battery.level; document.queryselector('#chargingtime').textcontent = battery.chargingtime; } }); specifications specification status comment battery status api candidate recommendation initial definition ...
BatteryManager.onlevelchange - Web APIs
example html <div id="level">(battery level unknown)</div> <div id="statebaterry">(charging state unknown)</div> javascript navigator.getbattery().then(function(battery) { battery.onlevelchange = function(){ document.queryselector('#level').textcontent = battery.level; if(battery.charging) { document.queryselector('#statebaterry').textcontent = "charging time: " + (battery.chargingtime / 60); } else { document.queryselector('#statebaterry').textcontent = "discharging time: " + (battery.dischargingtime / 60); } }; }); specifications specification status ...
BiquadFilterNode.getFrequencyResponse() - Web APIs
2] = 3000; myfrequencyarray[3] = 4000; myfrequencyarray[4] = 5000; var magresponseoutput = new float32array(5); var phaseresponseoutput = new float32array(5); next we create a <ul> element in our html to contain our results, and grab a reference to it in our javascript: <p>biquad filter frequency response for: </p> <ul class="freq-response-output"> </ul> var freqresponseoutput = document.queryselector('.freq-response-output'); finally, after creating our biquad filter, we use getfrequencyresponse() to generate the response data and put it in our arrays, then loop through each data set and output them in a human-readable list at the bottom of the page: var biquadfilter = audioctx.createbiquadfilter(); biquadfilter.type = "lowshelf"; biquadfilter.frequency.value = 1000; biquadfilter.gain.va...
Blob.type - Web APIs
WebAPIBlobtype
example this example asks the user to select a number of files, then checks each file to make sure it's one of a given set of image file types.
Body.blob() - Web APIs
WebAPIBodyblob
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest) .then(response => response.blob()) .then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); specifications specification status comment fetchthe definition of 'blob()' in that specification.
Body.bodyUsed - Web APIs
WebAPIBodybodyUsed
html content <img class="my-image" src="https://udn.realityripple.com/samples/46/29059a2b39.png"> js content var myimage = document.queryselector('.my-image'); fetch('https://upload.wikimedia.org/wikipedia/commons/7/77/delete_key1.jpg').then(function(response) { console.log(response.bodyused); var res = response.blob(); console.log(response.bodyused); return res; }).then(function(response) { var objecturl = url.createobjecturl(response); myimage.src = objecturl; }); specifications specification sta...
Body.json() - Web APIs
WebAPIBodyjson
const mylist = document.queryselector('ul'); const myrequest = new request('products.json'); fetch(myrequest) .then(response => response.json()) .then(data => { for (const product of data.products) { let listitem = document.createelement('li'); listitem.appendchild( document.createelement('strong') ).textcontent = product.name; listitem.append( ` can be found in ${ product.
Body.text() - Web APIs
WebAPIBodytext
let myarticle = document.queryselector('article'); let mylinks = document.queryselectorall('ul a'); for(let i = 0; i <= mylinks.length-1; i++) { mylinks[i].onclick = function(e) { e.preventdefault(); let linkdata = e.target.getattribute('data-page'); getdata(linkdata); } }; function getdata(pageid) { console.log(pageid); var myrequest = new request(pageid + '.txt'); fetch(myrequest).then(function(response) { ...
Body - Web APIs
WebAPIBody
html content <img class="my-image" src="https://udn.realityripple.com/samples/46/29059a2b39.png"> js content const myimage = document.queryselector('.my-image'); fetch('https://upload.wikimedia.org/wikipedia/commons/7/77/delete_key1.jpg') .then(res => res.blob()) .then(res => { const objecturl = url.createobjecturl(res); myimage.src = objecturl; }); specifications specification status comment fetchthe definition of 'body' in that specification.
BroadcastChannel: message event - Web APIs
1px solid black; padding: .5rem; height: 150px; font-family: "fira sans", sans-serif; } h1 { font: 1.6em "fira sans", sans-serif; margin-bottom: 1rem; } textarea { padding: .2rem; } label, br { margin: .5rem 0; } button { vertical-align: top; height: 1.5rem; } const channel = new broadcastchannel('example-channel'); const messagecontrol = document.queryselector('#message'); const broadcastmessagebutton = document.queryselector('#broadcast-message'); broadcastmessagebutton.addeventlistener('click', () => { channel.postmessage(messagecontrol.value); }) receiver 1 <h1>receiver 1</h1> <div id="received"></div> body { border: 1px solid black; padding: .5rem; height: 100px; font-family: "fira sans", sans-serif; } h1 { font: 1.
CSS - Web APIs
WebAPICSS
css.escape() can be used to escape a string mostly for use as part of a css selector.
CSSImageValue - Web APIs
we then get() the background-image from the stylemap and stringify it: // get the element const button = document.queryselector( 'button' ); // retrieve all computed styles with computedstylemap() const allcomputedstyles = button.computedstylemap(); // return the cssimagevalue example console.log( allcomputedstyles.get('background-image') ); console.log( allcomputedstyles.get('background-image').tostring() ); specifications specification status comment css typed om level 1the definition of...
CSSMathSum - Web APIs
<div>has width</div> we assign a width div { width: calc(30% - 20px); } we add the javascript const stylemap = document.queryselector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values ); // cssnumericarray {0: cssunitvalue, 1: cssunitvalue, length: 2} console.log( stylemap.get('width').values[0] ); // cssunitvalue {v...
CSSMathValue.operator - Web APIs
<div>my width has a <code>calc()</code> function</div> we assign a width with a calculation div { width: calc(50% - 0.5vw); } we add the javascript const stylemap = document.queryselector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').values ); // cssnumericarray {0: cssunitvalue, 1: cssmathnegate, length: 2} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values[1].operator ) // 'negate' ...
CSSMathValue - Web APIs
<div>has width</div> we assign a width with a calculation div { width: calc(30% - 20px); } we add the javascript const stylemap = document.queryselector('div').computedstylemap(); console.log( stylemap.get('width') ); // cssmathsum {values: cssnumericarray, operator: "sum"} console.log( stylemap.get('width').operator ); // 'sum' console.log( stylemap.get('width').values[1].value ); // -20 the cssmathvalue.operator returns 'sum' because stylemap.get('width').values[1].value ); is -20: adding a negative number.
CSSPseudoElement.element - Web APIs
examples the example below demonstrates the relationship between csspseudoelement.element and element.pseudo(): const myelement = document.queryselector('q'); const csspseudoelement = myelement.pseudo('::after'); const originatingelement = csspseudoelement.element; console.log(myelement === originatingelement); // outputs true console.log(myelement.parentelement === originatingelement); // outputs false console.log(myelement.lastelementchild === csspseudoelement); // outputs false console.log(myelement.lastchild === cssps...
CSSRule.cssText - Web APIs
WebAPICSSRulecssText
therefore, to modify it, use the stylesheet's cssrules[index] properties .selectortext and .style (or its sub-properties).
CSSRule - Web APIs
WebAPICSSRule
the relationships between these constants and the interfaces are: type value rule-specific interface comments and examples cssrule.style_rule 1 cssstylerule the most common kind of rule: selector { prop1: val1; prop2: val2; } cssrule.import_rule 3 cssimportrule an @import rule.
CSSStyleDeclaration.getPropertyPriority() - Web APIs
example the following javascript code checks whether margin is marked as important in a css selector rule: var declaration = document.stylesheets[0].cssrules[0].style; var isimportant = declaration.getpropertypriority('margin') === 'important'; specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.getpropertypriority()' in that specification.
CSSStyleDeclaration.getPropertyValue() - Web APIs
example the following javascript code queries the value of the margin property in a css selector rule: var declaration = document.stylesheets[0].cssrules[0].style; var value = declaration.getpropertyvalue('margin'); // "1px 2px" specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.getpropertyvalue()' in that specification.
CSSStyleDeclaration.parentRule - Web APIs
a cssstylerule representing the style for a css selector.
CSSStyleDeclaration.removeProperty() - Web APIs
example the following javascript code removes the background-color css property from a selector rule: var declaration = document.stylesheets[0].rules[0].style; var oldvalue = declaration.removeproperty('background-color'); specifications specification status comment css object model (cssom)the definition of 'cssstyledeclaration.removeproperty()' in that specification.
CSSStyleRule.style - Web APIs
syntax styleobj = cssrule.style example function stilo() { alert(document.stylesheets[0].cssrules[0].style.csstext); } // displays "background-color: gray;" notes the declaration block is that part of the style rule that appears within the braces and that actually provides the style definitions (for the selector, the part that comes before the braces).
CSSStyleRule - Web APIs
properties cssstylerule.selectortext returns the textual representation of the selector for this rule, e.g.
CSSStyleSheet - Web APIs
addrule() adds a new rule to the stylesheet given the selector to which the style applies and the style block to apply to the matching elements.
Using dynamic styling information - Web APIs
those interfaces contain members like insertrule, selectortext, and parentstylesheet for accessing and manipulating the individual style rules that make up a css stylesheet.
Using the CSS Painting API - Web APIs
using the paint worklet to use the paint worklet, we need to register it using addmodule() and include it in our css, ensuring the css selector matches a dom node in our html registering the worklet the setup and design of our paint worklet took place in the external script shown above.
CSS Painting API - Web APIs
li { --boxcolor: hsla(55, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 2px); } li:nth-of-type(3n) { --boxcolor: hsla(155, 90%, 60%, 1.0); background-image: paint(hollowhighlights, filled, 3px); } li:nth-of-type(3n+1) { --boxcolor: hsla(255, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 1px); } we've included a custom property in the selector block defining a boxcolor.
Cache.match() - Web APIs
WebAPICachematch
it uses a cache to supply selected data when a request fails.
CanvasRenderingContext2D.fillText() - Web APIs
however, if this value is provided, the user agent will adjust the kerning, select a more horizontally condensed font (if one is available or can be generated without loss of quality), or scale down to a smaller font size in order to fit the text in the specified width.
CanvasRenderingContext2D.getTransform() - Web APIs
html <canvas width="240"></canvas> <canvas width="240"></canvas> css canvas { border: 1px solid black; } javascript const canvases = document.queryselectorall('canvas'); const ctx1 = canvases[0].getcontext('2d'); const ctx2 = canvases[1].getcontext('2d'); ctx1.settransform(1, .2, .8, 1, 0, 0); ctx1.fillrect(25, 25, 50, 50); let storedtransform = ctx1.gettransform(); console.log(storedtransform); ctx2.settransform(storedtransform); ctx2.beginpath(); ctx2.arc(50, 50, 50, 0, 2 * math.pi); ctx2.fill(); result specifications specificat...
CanvasRenderingContext2D.setTransform() - Web APIs
html <canvas width="240"></canvas> <canvas width="240"></canvas> css canvas { border: 1px solid black; } javascript const canvases = document.queryselectorall('canvas'); const ctx1 = canvases[0].getcontext('2d'); const ctx2 = canvases[1].getcontext('2d'); ctx1.settransform(1, .2, .8, 1, 0, 0); ctx1.fillrect(25, 25, 50, 50); let storedtransform = ctx1.gettransform(); console.log(storedtransform); ctx2.settransform(storedtransform); ctx2.beginpath(); ctx2.arc(50, 50, 50, 0, 2 * math.pi); ctx2.fill(); result specifications specificat...
CanvasRenderingContext2D.strokeText() - Web APIs
however, if this value is provided, the user agent will adjust the kerning, select a more horizontally condensed font (if one is available or can be generated without loss of quality), or scale down to a smaller font size in order to fit the text in the specified width.
Using images - Web APIs
each <img> is assigned an id attribute, which makes them easy to select using document.getelementbyid().
Clipboard - Web APIs
WebAPIClipboard
a typical application accesses clipboard functionality by mapping user input such as keybindings, menu selections, etc.
Clipboard API - Web APIs
accessing the clipboard instead of creating a clipboard object through instantiation, you access the system clipboard through the navigator.clipboard global: navigator.clipboard.readtext().then( cliptext => document.queryselector(".editor").innertext += cliptext); this snippet fetches the text from the clipboard and appends it to the first element found with the class editor.
Console.table() - Web APIs
WebAPIConsoletable
you can use the optional columns parameter to select a subset of columns to display: // an array of objects, logging only firstname function person(firstname, lastname) { this.firstname = firstname; this.lastname = lastname; } var john = new person("john", "smith"); var jane = new person("jane", "doe"); var emily = new person("emily", "jones"); console.table([john, jane, emily], ["firstname"]); sorting columns you can sort the table by ...
CryptoKeyPair - Web APIs
a cryptokeypair object can be obtained using subtlecrypto.generatekey(), when the selected algorithm is one of the asymmetric algorithms: rsassa-pkcs1-v1_5, rsa-pss, rsa-oaep, ecdsa, or ecdh.
DOMMatrixReadOnly.scale() - Web APIs
ixreadonly(); const scaledmatrix = matrix.scale(0.5); let scaledmatrixwithorigin = matrix.scale(0.5, 25, 25); // if the browser has interpreted these parameters as scalex, scaley, scalez, the resulting matrix is 3d const browserexpectssixparamscale = !scaledmatrixwithorigin.is2d; if (browserexpectssixparamscale) { scaledmatrixwithorigin = matrix.scale(0.5, 0.5, 1, 25, 25, 0); } document.queryselector('#transformed').setattribute('transform', scaledmatrix.tostring()); document.queryselector('#transformedorigin').setattribute('transform', scaledmatrixwithorigin.tostring()); screenshotlive sample specifications specification status comment geometry interfaces module level 1the definition of 'dommatrixreadonly.scale()' in that specification.
DOMMatrixReadOnly.translate() - Web APIs
const matrix = new dommatrixreadonly().translate(25, 25); document.queryselector('#transformed').setattribute('transform', matrix.tostring()); screenshotlive sample specifications specification status comment geometry interfaces module level 1the definition of 'dommatrixreadonly.translate()' in that specification.
DOMParser - Web APIs
WebAPIDOMParser
there are three different results possible, selected by the mime type given.
DOMTokenList.add() - Web APIs
WebAPIDOMTokenListadd
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; classes.add("d"); span.textcontent = classes; the output looks like this: you can add multiple tokens as well: span.classlist.add("d", "e", "f"); specifications specification status comment domthe definition of 'add()' in that specification.
DOMTokenList.contains() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; let result = classes.contains("c"); if (result) { span.textcontent = "the classlist contains 'c'"; } else { span.textcontent = "the classlist does not contain 'c'"; } the output looks like this: specifications specification status comment domthe definition of 'contains()' in that specification.
DOMTokenList.entries() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; let iterator = classes.entries(); for (let value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'entries() (as iterable<node>)' in that specification.
DOMTokenList.forEach() - Web APIs
html <span class="a b c"></span> javascript let span = document.queryselector("span"); let classes = span.classlist; let iterator = classes.values(); classes.foreach( function(value, key, listobj) { span.textcontent += `${value} ${key}/${this} ++ `; }, "arg" ); result polyfill this polyfill adds compatibility to all browsers supporting es5: if (window.domtokenlist && !domtokenlist.prototype.foreach) { domtokenlist.prototype.foreach = function (callba...
DOMTokenList.item() - Web APIs
WebAPIDOMTokenListitem
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; let item = classes.item(classes.length-1); span.textcontent = item; the output looks like this: specifications specification status comment domthe definition of 'item()' in that specification.
DOMTokenList.keys() - Web APIs
WebAPIDOMTokenListkeys
first, the html: <span class="a b c"></span> now the javascript: var span = document.queryselector("span"); var classes = span.classlist; var iterator = classes.keys(); for(var value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'keys() (as iterable<node>)' in that specification.
DOMTokenList.length - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; let length = classes.length; span.textcontent = `classlist length = ${length}`; the output looks like this: specifications specification status comment domthe definition of 'length' in that specification.
DOMTokenList.remove() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; classes.remove("c"); span.textcontent = classes; the output looks like this: to remove multiple classes at once, you can supply multiple tokens.
DOMTokenList.replace() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; let result = classes.replace("c", "z"); console.log(result); if (result) { span.textcontent = classes; } else { span.textcontent = 'token not replaced successfully'; } the output looks like this: polyfill the following polyfill will add the replace method to the domtokenlist class.
DOMTokenList.toggle() - Web APIs
first, the html: <span class="a b">classlist is 'a b'</span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; span.addeventlistener('click', function() { let result = classes.toggle("c"); if (result) { span.textcontent = `'c' added; classlist is now "${classes}".`; } else { span.textcontent = `'c' removed; classlist is now "${classes}".`; } }) the output looks like this: specifications specification status comment ...
DOMTokenList.value - Web APIs
first, the html: <span class="a b c"></span> now the javascript: let span = document.queryselector("span"); let classes = span.classlist; span.textcontent = classes.value; the output looks like this: specifications specification status comment domthe definition of 'value' in that specification.
DOMTokenList.values() - Web APIs
first, the html: <span class="a b c"></span> now the javascript: var span = document.queryselector("span"); var classes = span.classlist; var iterator = classes.values(); for(var value of iterator) { span.textcontent += value + ' ++ '; } the output looks like this: specifications specification status comment domthe definition of 'values() (as iterable<node>)' in that specification.
DataTransfer.dropEffect - Web APIs
html content <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.
DataTransfer.effectAllowed - Web APIs
ct = " + ev.datatransfer.dropeffect + " ; effectallowed = " + ev.datatransfer.effectallowed); ev.preventdefault(); // set the dropeffect to move ev.datatransfer.dropeffect = "move" } </script> <body> <h1>examples <code>datatransfer</code>.{<code>dropeffect</code>, <code>effectallowed</code>} properties</h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'effectallowed' in that specification.
DataTransfer.setData() - Web APIs
ev.datatransfer.getdata("text"); ev.target.appendchild(document.getelementbyid(data)); // clear the drag data cache (for all formats/types) ev.datatransfer.cleardata(); } </script> <body> <h1>examples of <code>datatransfer</code>: <code>setdata()</code>, <code>getdata()</code>, <code>cleardata()</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'setdata()' in that specification.
DataTransfer.setDragImage() - Web APIs
(); } function drop_handler(ev) { console.log("drop"); ev.preventdefault(); // get the data, which is the id of the drop target var data = ev.datatransfer.getdata("text"); ev.target.appendchild(document.getelementbyid(data)); } </script> <body> <h1>example of <code>datatransfer.setdragimage()</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'setdragimage()' in that specification.
DataTransfer - Web APIs
properties standard properties datatransfer.dropeffect gets the type of drag-and-drop operation currently selected or sets the operation to a new type.
DataTransferItem - Web APIs
datatransferitem.webkitgetasentry() returns an object based on filesystementry representing the selected file's entry in its file system.
DataTransferItemList.DataTransferItem() - Web APIs
e.log("dragover"); ev.preventdefault(); // set the dropeffect to move ev.datatransfer.dropeffect = "move" } function dragend_handler(ev) { console.log("dragend"); var datalist = ev.datatransfer.items; // clear any remaining drag data datalist.clear(); } html <div> <p id="source" ondragstart="dragstart_handler(event);" ondragend="dragend_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> css div { margin: 0em; padding: 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } result drag and drop demo link specifications ...
DataTransferItemList.add() - Web APIs
html <div> <p id="source" ondragstart="dragstart_handler(event);" ondragend="dragend_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> css div { margin: 0em; padding: 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } javascript function dragstart_handler(ev) { console.lo...
DataTransferItemList.clear() - Web APIs
html <div> <p id="source" ondragstart="dragstart_handler(event);" ondragend="dragend_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> css div { margin: 0em; padding: 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } javascript function dragstart_ha...
DataTransferItemList.length - Web APIs
e.log("dragover"); ev.preventdefault(); // set the dropeffect to move ev.datatransfer.dropeffect = "move" } function dragend_handler(ev) { console.log("dragend"); var datalist = ev.datatransfer.items; // clear any remaining drag data datalist.clear(); } html <div> <p id="source" ondragstart="dragstart_handler(event);" ondragend="dragend_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> css div { margin: 0em; padding: 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } result drag and drop demo link specifications ...
DataTransferItemList.remove() - Web APIs
log("dragend"); var datalist = ev.datatransfer.items; for (var i = 0; i < datalist.length; i++) { datalist.remove(i); } // clear any remaining drag data datalist.clear(); } html <h1>example uses of <code>datatransferitemlist</code> methods and property</h1> <div> <p id="source" ondragstart="dragstart_handler(event);" ondragend="dragend_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> css div { margin: 0em; padding: 2em; } #source { color: blue; border: 1px solid black; } #target { border: 1px solid black; } specifications spe...
DeprecationReportBody - Web APIs
the report details are displayed via the displayreports() fuction, which takes the observer callback's reports parameter as its parameter: function displayreports(reports) { const outputelem = document.queryselector('.output'); const list = document.createelement('ul'); outputelem.appendchild(list); for(let i = 0; i < reports.length; i++) { let listitem = document.createelement('li'); let textnode = document.createtextnode('report ' + (i + 1) + ', type: ' + reports[i].type); listitem.appendchild(textnode); let innerlist = document.createelement('ul'); listitem.appendchild(innerli...
Detecting device orientation - Web APIs
, it's a tiny one), and the ball is in the center: .garden { position: relative; width : 200px; height: 200px; border: 5px solid #ccc; border-radius: 10px; } .ball { position: absolute; top : 90px; left : 90px; width : 20px; height: 20px; background: green; border-radius: 100%; } now, if we move our device, the ball will move accordingly: var ball = document.queryselector('.ball'); var garden = document.queryselector('.garden'); var output = document.queryselector('.output'); var maxx = garden.clientwidth - ball.clientwidth; var maxy = garden.clientheight - ball.clientheight; function handleorientation(event) { var x = event.beta; // in degree in the range [-180,180] var y = event.gamma; // in degree in the range [-90,90] output.innerhtml = "beta : "...
Document: DOMContentLoaded event - Web APIs
-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.queryselector('.event-log-contents'); const reload = document.queryselector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent...
Document.adoptNode() - Web APIs
example const iframe = document.queryselector('iframe'); const iframeimages = iframe.contentdocument.queryselectorall('img'); const newparent = document.getelementbyid('images'); iframeimages.foreach(function(imgel) { newparent.appendchild(document.adoptnode(imgel)); }); notes before they can be inserted into the current document, nodes from external documents should either be: cloned using document.importnode(); or adopted using...
Document.alinkColor - Web APIs
one alternative is the css selector :active.
Document: dragexit event - Web APIs
the dragexit event is fired when an element is no longer the drag operation's immediate selection target.
Document: dragleave event - Web APIs
the dragleave event is fired when a dragged element or text selection leaves a valid drop target.
Document: dragover event - Web APIs
the dragover event is fired when an element or text selection is being dragged over a valid drop target (every few hundred milliseconds).
Document: dragstart event - Web APIs
the dragstart event is fired when the user starts dragging an element or text selection.
Document: drop event - Web APIs
the drop event is fired when an element or text selection is dropped on a valid drop target.
Document.evaluate() - Web APIs
WebAPIDocumentevaluate
generally, more specific xpath selectors as in the above example usually gives a significant performance improvement, especially on very large documents.
Document.forms - Web APIs
WebAPIDocumentforms
y> <form id="robby"> <input type="button" onclick="alert(document.forms[0].id);" value="robby's form" /> </form> <form id="dave"> <input type="button" onclick="alert(document.forms[1].id);" value="dave's form" /> </form> <form id="paul"> <input type="button" onclick="alert(document.forms[2].id);" value="paul's form" /> </form> </body> </html> getting an element from within a form var selectform = document.forms[index]; var selectformelement = document.forms[index].elements[index]; named form access <!doctype html> <html lang="en"> <head> <title>document.forms example</title> </head> <body> <form name="login"> <input name="email" type="email"> <input name="password" type="password"> <button type="submit">log in</button> </form> <script> var loginform = document.forms.
Document: fullscreenerror event - Web APIs
examples const requestor = document.queryselector('div'); document.addeventlistener('fullscreenerror', (event) => { console.error('an error occurred changing into fullscreen'); console.log(event); }); requestor.requestfullscreen(); specifications specification status fullscreen api living standard ...
Document: gotpointercapture event - Web APIs
const para = document.queryselector('p'); document.addeventlistener('gotpointercapture', () => { console.log('i\'ve been captured!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, using the ongotpointercapture event handler property: const para = document.queryselector('p'); document.ongotpointercapture = () => { console.log('i\'ve been captured!') ...
Document.hasFocus() - Web APIs
WebAPIDocumenthasFocus
html <p id="log">awaiting focus check.</p> <button onclick="openwindow()">open a new window</button> javascript function checkpagefocus() { let body = document.queryselector('body'); let log = document.getelementbyid('log'); if (document.hasfocus()) { log.textcontent = 'this document has the focus.'; body.style.background = '#fff'; } else { log.textcontent = 'this document does not have the focus.'; body.style.background = '#ccc'; } } function openwindow() { window.open('https://developer.mozilla.org/', 'mdn', 'width=640,height=320,lef...
Document.head - Web APIs
WebAPIDocumenthead
example <!doctype html> <head id="my-document-head"> <title>example: using document.head</title> </head> <script> var thehead = document.head; console.log(thehead.id); // "my-document-head"; console.log( thehead === document.queryselector("head") ); // true </script> notes document.head is read-only.
Document.importNode() - Web APIs
example const iframe = document.queryselector("iframe"); const oldnode = iframe.contentwindow.document.getelementbyid("mynode"); const newnode = document.importnode(oldnode, true); document.getelementbyid("container").appendchild(newnode); notes before they can be inserted into the current document, nodes from external documents should either be: cloned using document.importnode(); or adopted using document.adoptnode().
Document: lostpointercapture event - Web APIs
const para = document.queryselector('p'); document.addeventlistener('lostpointercapture', () => { console.log('i\'ve been released!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, but using the onlostpointercapture event handler property: const para = document.queryselector('p'); document.onlostpointercapture = () => { console.log('i\'ve been relea...
Document: pointerlockerror event - Web APIs
bubbles yes cancelable no interface event event handler property onpointerlockerror examples using addeventlistener(): const para = document.queryselector('p'); document.addeventlistener('pointerlockerror', (event) => { console.log('error locking pointer'); }); using the onpointerlockerror event handler property: document.onpointerlockerror = (event) => { console.log('error locking pointer'); }; specifications specification status pointer lock candidate recommendation ...
Document.queryCommandEnabled() - Web APIs
example var flg = document.querycommandenabled("selectall"); if(flg) { document.execcommand("selectall", false, null); // command is enabled, run it } specifications specification status comment execcommand ...
Document.queryCommandSupported() - Web APIs
notes the 'paste' command return false not only if the feature is unavailable, but also if the script calling it has insufficient privileges to perform the action [1] example var flg = document.querycommandsupported("selectall"); if(flg) { // ...do something } specifications specification status comment execcommand ...
Document: readystatechange event - Web APIs
-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.queryselector('.event-log-contents'); const reload = document.queryselector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent...
Document: wheel event - Web APIs
ground: #cdf; padding: 5px; } function zoom(event) { event.preventdefault(); if (event.deltay < 0) { // zoom in scale *= event.deltay * -2; } else { // zoom out scale /= event.deltay * 2; } // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.queryselector('div'); document.onwheel = zoom; addeventlistener equivalent the event handler can also be set up using the addeventlistener() method: document.addeventlistener('wheel', zoom); specifications specification status comment ui eventsthe definition of 'wheel' in that specification.
DocumentOrShadowRoot - Web APIs
documentorshadowroot.getselection() returns a selection object representing the range of text selected by the user, or the current position of the caret.
DocumentTimeline.DocumentTimeline() - Web APIs
this bit of code would start all the cats animating 500 milliseconds into their animations: var cats = document.queryselectorall('.sharedtimelinecat'); cats = array.prototype.slice.call(cats); var sharedtimeline = new documenttimeline({ origintime: 500 }); cats.foreach(function(cat) { var catkeyframes = new keyframeeffect(cat, keyframes, timing); var catanimation = new animation(catkeyframes, sharedtimeline); catanimation.play(); }); specifications specification status comment web an...
DocumentTimeline - Web APIs
this bit of code would start all the cats animating 500 milliseconds into their animations: const cats = document.queryselectorall('.sharedtimelinecat'); const sharedtimeline = new documenttimeline({ origintime: 500 }); for (const cat of cats) { const catkeyframes = new keyframeeffect(cat, keyframes, timing); const catanimation = new animation(catkeyframes, sharedtimeline); catanimation.play(); } specifications specification status comment web animationsthe definition of 'documenttimel...
How whitespace is handled by HTML, CSS, and in the DOM - Web APIs
the text node would be selected instead of the element you want to affect.
Document Object Model (DOM) - Web APIs
datasection characterdata childnode comment customevent document documentfragment documenttype domerror domexception domimplementation domstring domtimestamp domstringlist domtokenlist element event eventtarget htmlcollection mutationobserver mutationrecord namednodemap node nodefilter nodeiterator nodelist nondocumenttypechildnode parentnode processinginstruction selection range text textdecoder textencoder timeranges treewalker url window worker xmldocument obsolete dom interfaces the document object model has been highly simplified.
Element: auxclick event - Web APIs
javascript let button = document.queryselector('button'); let html = document.queryselector('html'); function random(number) { return math.floor(math.random() * number); } function randomcolor() { return `rgb(${random(255)}, ${random(255)}, ${random(255)})`; } button.onclick = function() { button.style.backgroundcolor = randomcolor(); }; button.onauxclick = function(e) { e.preventdefault(); button.style.color = randomcolor()...
Element: blur event - Web APIs
bubbles no cancelable no interface focusevent event handler property onblur sync / async sync composed yes examples simple example html <form id="form"> <input type="text" placeholder="text input"> <input type="password" placeholder="password"> </form> javascript const password = document.queryselector('input[type="password"]'); password.addeventlistener('focus', (event) => { event.target.style.background = 'pink'; }); password.addeventlistener('blur', (event) => { event.target.style.background = ''; }); result event delegation there are two ways of implementing event delegation for this event: by using the focusout event, or by setting the usecapture parameter of addeventlistener(...
Element: click event - Web APIs
html <button>click</button> javascript const button = document.queryselector('button'); button.addeventlistener('click', event => { button.innerhtml = `click count: ${event.detail}`; }); result try making rapid, repeated clicks on the button to increase the click count.
Element.computedStyleMap() - Web APIs
// get the element const myelement = document.queryselector('a'); // get the <dl> we'll be populating const styleslist = document.queryselector('#regurgitation'); // retrieve all computed styles with computedstylemap() const allcomputedstyles = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of allcomputedstyles) { // properties const cssproperty = docume...
Element: dblclick event - Web APIs
javascript const card = document.queryselector('aside'); card.addeventlistener('dblclick', function (e) { card.classlist.toggle('large'); }); html <aside> <h3>my card</h3> <p>double click to resize this object.</p> </aside> css aside { background: #fe9; border-radius: 1em; display: inline-block; padding: 1em; transform: scale(.9); transform-origin: 0 0; transition: transform .6s; } .large { transform: scale(1.3);...
Element: error event - Web APIs
css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } button { height: 2rem; margin: .5rem; } img { width: 0; height: 0; } js const log = document.queryselector('.event-log-contents'); const badimg = document.queryselector('.bad-img'); badimg.addeventlistener('error', (event) => { log.textcontent = log.textcontent + `${event.type}: loading image\n`; console.log(event) }); const imgerror = document.queryselector('#img-error'); imgerror.addeventlistener('click', () => { badimg.setattribute('src', 'i-dont-exist'); }); result specificati...
Element: focus event - Web APIs
bubbles no cancelable no interface focusevent event handler property onfocus sync / async sync composed yes examples simple example html <form id="form"> <input type="text" placeholder="text input"> <input type="password" placeholder="password"> </form> javascript const password = document.queryselector('input[type="password"]'); password.addeventlistener('focus', (event) => { event.target.style.background = 'pink'; }); password.addeventlistener('blur', (event) => { event.target.style.background = ''; }); result event delegation there are two ways of implementing event delegation for this event: by using the focusin event, or by setting the usecapture parameter of addeventlistener()...
Element: fullscreenerror event - Web APIs
examples const requestor = document.queryselector('div'); requestor.addeventlistener('fullscreenerror', (event) => { console.error('an error occurred changing into fullscreen'); console.log(event); }); requestor.requestfullscreen(); specifications specification status fullscreen api living standard ...
Element.getAttribute() - Web APIs
retrieving nonce values for security reasons, csp nonces from non-script sources, such as css selectors, and .getattribute("nonce") calls are hidden.
Element.getBoundingClientRect() - Web APIs
<div></div> div { width: 400px; height: 200px; padding: 20px; margin: 50px auto; background: purple; } let elem = document.queryselector('div'); let rect = elem.getboundingclientrect(); for (var key in rect) { if(typeof rect[key] !== 'function') { let para = document.createelement('p'); para.textcontent = `${ key } : ${ rect[key] }`; document.body.appendchild(para); } } notice how the width/height are equal to the equal to its width/height + padding.
Element.id - Web APIs
WebAPIElementid
another common case is to use an element's id as a selector when styling the document with css.
Element.insertAdjacentElement() - Web APIs
when one is clicked, it becomes selected and you can then press the insert before and insert after buttons to insert new divs before or after the selected element using insertadjacentelement().
Element: keydown event - Web APIs
<input placeholder="click here, then press down a key." size="40"> <p id="log"></p> const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.addeventlistener('keydown', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeydown equivalent input.onkeydown = logkey; specifications specification status ui events working draft ...
Element: keypress event - Web APIs
<div> <label for="sample">focus the input and type something:</label> <input type="text" name="text" id="sample"> </div> <p id="log"></p> const log = document.getelementbyid('log'); const input = document.queryselector('input'); input.addeventlistener('keypress', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeypress equivalent input.onkeypress = logkey; specifications specification status ui events working draft ...
Element: keyup event - Web APIs
<input placeholder="click here, then press and release a key." size="40"> <p id="log"></p> const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.addeventlistener('keyup', logkey); function logkey(e) { log.textcontent += ` ${e.code}`; } onkeyup equivalent input.onkeyup = logkey; specifications specification status ui events working draft ...
Element.name - Web APIs
WebAPIElementname
it only applies to the following elements: <a>, <applet>, <button>, <form>, <frame>, <iframe>, <img>, <input>, <map>, <meta>, <object>, <param>, <select>, and <textarea>.
Element.onfullscreenchange - Web APIs
function togglefullscreen() { let elem = document.queryselector("video"); elem.onfullscreenchange = handlefullscreenchange; if (!document.fullscreenelement) { elem.requestfullscreen().then({}).catch(err => { alert(`error attempting to enable full-screen mode: ${err.message} (${err.name})`); }); } else { document.exitfullscreen(); } } function handlefullscreenchange(event) { let elem = event.target; let isfullscreen = document...
Element.onfullscreenerror - Web APIs
since full-screen mode changes are only permitted in response to a user input, this causes an error to occur, which triggers the delivery of the fullscreenerror event to the error handler, let elem = document.queryselector("video")}} elem.onfullscreenerror = function ( event ) { displaywarning("unable to switch into full-screen mode."); }; //....
Element: paste event - Web APIs
examples live example html <div class="source" contenteditable="true">try copying text from this box...</div> <div class="target" contenteditable="true">...and pasting it into this one</div> css div.source, div.target { border: 1px solid gray; margin: .5rem; padding: .5rem; height: 1rem; background-color: #e9eef1; } js const target = document.queryselector('div.target'); target.addeventlistener('paste', (event) => { let paste = (event.clipboarddata || window.clipboarddata).getdata('text'); paste = paste.touppercase(); const selection = window.getselection(); if (!selection.rangecount) return false; selection.deletefromdocument(); selection.getrangeat(0).insertnode(document.createtextnode(paste)); event.preventdefaul...
Element.requestFullscreen() - Web APIs
function togglefullscreen() { let elem = document.queryselector("video"); if (!document.fullscreenelement) { elem.requestfullscreen().catch(err => { alert(`error attempting to enable full-screen mode: ${err.message} (${err.name})`); }); } else { document.exitfullscreen(); } } if the document isn't already in full-screen mode—detected by looking to see if document.fullscreenelement has a value—we call the video's requestfullscre...
Element.setAttribute() - Web APIs
html <button>hello world</button> javascript var b = document.queryselector("button"); b.setattribute("name", "hellobutton"); b.setattribute("disabled", ""); this demonstrates two things: the first call to setattribute() above shows changing the name attribute's value to "hellobutton".
Element.slot - Web APIs
WebAPIElementslot
let slottedspan = document.queryselector('my-paragraph span') console.log(slottedspan.slot); // logs 'my-text' specifications specification status comment domthe definition of 'slot' in that specification.
Element.toggleAttribute() - Web APIs
html <input value="text"> <button>toggleattribute("readonly")</button> javascript var button = document.queryselector("button"); var input = document.queryselector("input"); button.addeventlistener("click", function(){ input.toggleattribute("readonly"); }); result dom methods dealing with element's attributes: not namespace-aware, most commonly used methods namespace-aware variants (dom level 2) dom level 1 methods for dealing with attr nodes directly (seldom used) dom level 2 namespace-aware method...
Element: wheel event - Web APIs
flex; align-items: center; justify-content: center; } div { width: 105px; height: 105px; background: #cdf; padding: 5px; } function zoom(event) { event.preventdefault(); scale += event.deltay * -0.01; // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.queryselector('div'); el.onwheel = zoom; addeventlistener equivalent the event handler can also be set up using the addeventlistener() method: el.addeventlistener('wheel', zoom); specifications specification status comment ui eventsthe definition of 'wheel' in that specification.
Event.composed - Web APIs
WebAPIEventcomposed
pelem.textcontent = this.getattribute('text'); let shadowroot = this.attachshadow({mode: 'open'}) .appendchild(pelem); } }); we then insert one of each element into our page: <open-shadow text="i have an open shadow root"></open-shadow> <closed-shadow text="i have a closed shadow root"></closed-shadow> then include a click event listener on the <html> element: document.queryselector('html').addeventlistener('click',function(e) { console.log(e.composed); console.log(e.composedpath()); }); when you click on the <open-shadow> element and then the <closed-shadow> element, you'll notice two things.
Event.composedPath() - Web APIs
pelem.textcontent = this.getattribute('text'); let shadowroot = this.attachshadow({mode: 'open'}) .appendchild(pelem); } }); we then insert one of each element into our page: <open-shadow text="i have an open shadow root"></open-shadow> <closed-shadow text="i have a closed shadow root"></closed-shadow> then include a click event listener on the <html> element: document.queryselector('html').addeventlistener('click',function(e) { console.log(e.composed); console.log(e.composedpath()); }); when you click on the <open-shadow> element and then the <closed-shadow> element, you'll notice two things.
Event.preventDefault() - Web APIs
this example demonstrates how to prevent that from happening: javascript document.queryselector("#id-checkbox").addeventlistener("click", function(event) { document.getelementbyid("output-box").innerhtml += "sorry!
EventSource() - Web APIs
examples var evtsource = new eventsource('sse.php'); var eventlist = document.queryselector('ul'); evtsource.onmessage = function(e) { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); } note: you can find a full example on github — see simple sse demo using php.
EventSource.close() - Web APIs
WebAPIEventSourceclose
examples var button = document.queryselector('button'); var evtsource = new eventsource('sse.php'); button.onclick = function() { console.log('connection closed'); evtsource.close(); } note: you can find a full example on github — see simple sse demo using php.
EventSource: message event - Web APIs
var evtsource = new eventsource('sse.php'); var eventlist = document.queryselector('ul'); evtsource.addeventlistener('message', (e) => { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); }); onmessage equivalent evtsource.onmessage = (e) => { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); }; specific...
EventSource - Web APIs
var evtsource = new eventsource('sse.php'); var eventlist = document.queryselector('ul'); evtsource.onmessage = function(e) { var newelement = document.createelement("li"); newelement.textcontent = "message: " + e.data; eventlist.appendchild(newelement); } each received event causes our eventsource object's onmessage event handler to be run.
EventTarget.addEventListener() - Web APIs
> </div> css .outer, .middle, .inner1, .inner2 { display: block; width: 520px; padding: 15px; margin: 15px; text-decoration: none; } .outer { border: 1px solid red; color: red; } .middle { border: 1px solid green; color: green; width: 460px; } .inner1, .inner2 { border: 1px solid purple; color: purple; width: 400px; } javascript const outer = document.queryselector('.outer'); const middle = document.queryselector('.middle'); const inner1 = document.queryselector('.inner1'); const inner2 = document.queryselector('.inner2'); const capture = { capture : true }; const nonecapture = { capture : false }; const once = { once : true }; const noneonce = { once : false }; const passive = { passive : true }; const nonepassive = { passive : false }; out...
EventTarget.removeEventListener() - Web APIs
const body = document.queryselector('body') const clicktarget = document.getelementbyid('click-target') const mouseovertarget = document.getelementbyid('mouse-over-target') let toggle = false; function makebackgroundyellow() { if (toggle) { body.style.backgroundcolor = 'white'; } else { body.style.backgroundcolor = 'yellow'; } toggle = !toggle; } clicktarget.addeventlistener('click', makebac...
File.getAsDataURL() - Web APIs
WebAPIFilegetAsDataURL
fileinput is a htmlinputelement: <input type="file" id="myfileinput" multiple> var fileinput = document.getelementbyid("myfileinput"); // files is a filelist object (similar to nodelist) var files = fileinput.files; // array with acceptable file types var accept = ["image/png"]; // img is a htmlimgelement: <img id="myimg"> var img = document.getelementbyid("myimg"); // if we accept the first selected file type if (accept.indexof(files[0].mediatype) > -1) { // display the image // same as <img src="data:image/png,<imagedata>"> img.src = files[0].getasdataurl(); } specification not part of any specification.
File.lastModified - Web APIs
WebAPIFilelastModified
example reading from file input <input type="file" multiple id="fileinput"> const fileinput = document.queryselector('#fileinput'); fileinput.addeventlistener('change', (event) => { // files is a filelist object (similar to nodelist) const files = event.target.files; for (let file of files) { const date = new date(file.lastmodified); console.log(`${file.name} has a last modified date of ${date}`); } }); try the results out below: dynamically created files if a file is created dynamicall...
File.name - Web APIs
WebAPIFilename
example <input type="file" multiple onchange="processselectedfiles(this)"> function processselectedfiles(fileinput) { var files = fileinput.files; for (var i = 0; i < files.length; i++) { alert("filename " + files[i].name); } } try the results out below: specifications specification status comment file apithe definition of 'name' in that specification.
File - Web APIs
WebAPIFile
file objects are generally retrieved from a filelist object returned as a result of a user selecting files using the <input> element, from a drag and drop operation's datatransfer object, or from the mozgetasfile() api on an htmlcanvaselement.
FileReader.result - Web APIs
WebAPIFileReaderresult
var fileinput = document.queryselector('input[type="file"]'); function read(callback) { var file = fileinput.files.item(0); var reader = new filereader(); reader.onload = function() { callback(reader.result); } reader.readastext(file); } specifications specification status comment file apithe definition of 'result' in that specification.
FileReader - Web APIs
file objects may be obtained from a filelist object returned as a result of a user selecting files using the <input> element, from a drag and drop operation's datatransfer object, or from the mozgetasfile() api on an htmlcanvaselement.
FileRequest.onprogress - Web APIs
example // assuming 'request' which is a filerequest object request.onprogress = function (status) { var progress = document.queryselector('progress'); progress.value = status.loaded; progress.max = status.total; } specification not part of any current specification.
FileHandle API - Web APIs
var progress = document.queryselector('progress'); var myfile = myfilehandle.open('readonly'); // let's read a 1gb file var action = myfile.readasarraybuffer(1000000000); action.onprogress = function (event) { if (progress) { progress.value = event.loaded; progress.max = event.total; } } action.onsuccess = function () { console.log('yeah \o/ just read a 1gb file'); } action.onerror = function () { console.
Introduction to the File and Directory Entries API - Web APIs
sample use cases the following are just a few examples of how you can use the file and directory entries api: apps with persistent uploader when a file or directory is selected for upload, you can copy the file into a local sandbox and upload a chunk at a time.
FormData() - Web APIs
WebAPIFormDataFormData
those with a name, not disabled and checked (radio buttons and checkboxes) or selected (one or more options within a select).
FormDataEvent.formData - Web APIs
examples // grab reference to form const formelem = document.queryselector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object let data = e.formdata; for (var value of data.values()) { console.log(value); } //...
FormDataEvent - Web APIs
examples // grab reference to form const formelem = document.queryselector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object...
GainNode.gain - Web APIs
WebAPIGainNodegain
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.queryselector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); ...
GainNode - Web APIs
WebAPIGainNode
the below snippet wouldn't work as is — for a complete working example, check out our voice-change-o-matic demo (view source.) <div> <button class="mute">mute button</button> </div> var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var gainnode = audioctx.creategain(); var mute = document.queryselector('.mute'); var source; if (navigator.mediadevices.getusermedia) { navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app { audio: true }, // success callback function(stream) { source = audioctx.createmediastreamsource(stream); }, // error callback function(err) { console.log('the following gum error occured: ' + err); ...
GlobalEventHandlers.onauxclick - Web APIs
var button = document.queryselector('button'); var html = document.queryselector('html'); function random(number) { return math.floor(math.random() * number); } button.onclick = function() { var rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) + ')'; button.style.backgroundcolor = rndcol; }; button.onauxclick = function() { var rndcol = 'rgb(' + random(255) + ',' + random(255) + ',' + random(255) +...
GlobalEventHandlers.onblur - Web APIs
html <input type="text" value="click here"> javascript let input = document.queryselector('input'); input.onblur = inputblur; input.onfocus = inputfocus; function inputblur() { input.value = 'focus has been lost'; } function inputfocus() { input.value = 'focus is here'; } result try clicking in and out of the form field, and watch its contents change accordingly.
GlobalEventHandlers.onchange - Web APIs
html <input type="text" placeholder="type something here, then click outside of the field." size="50"> <p id="log"></p> javascript let input = document.queryselector('input'); let log = document.getelementbyid('log'); input.onchange = handlechange; function handlechange(e) { log.textcontent = `the field's value is ${e.target.value.length} character(s) long.`; } result specification specification status comment html living standardthe definition of 'onchange' in that specification.
GlobalEventHandlers.oncontextmenu - Web APIs
18s linear infinite; background: lightsalmon; border-radius: 42%; margin: 1em; } .paused { background-color: #ddd; } .paused .shape { animation-play-state: paused; } javascript function pause(e) { body.classlist.add('paused'); note.removeattribute('hidden'); } function play(e) { body.classlist.remove('paused'); note.setattribute('hidden', ''); } const body = document.queryselector('body'); const note = document.queryselector('.note'); window.oncontextmenu = pause; window.onpointerdown = play; result specifications specification status comment html living standardthe definition of 'oncontextmenu' in that specification.
GlobalEventHandlers.ondrag - Web APIs
hild(document.getelementbyid(data)); } function dragover_handler(ev) { console.log("dragover"); ev.preventdefault(); } </script> <body> <h1>examples of <code>ondrag</code>, <code>ondrop</code>, <code>ondragstart</code>, <code>ondragover</code></h1> <div> <!-- <div class="source"> --> <p id="source" ondrag="drag_handler(event);" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondrag' in that specification.
GlobalEventHandlers.ondragend - Web APIs
d("source"); el.ondragenter = dragenter_handler; el.ondragleave = dragleave_handler; el.ondragend = dragend_handler; el.ondragexit = dragexit_handler; } </script> <body onload="init();"> <h1>examples of <code>ondragenter</code>, <code>ondragleave</code>, <code>ondragend</code>, <code>ondragexit</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragend' in that specification.
GlobalEventHandlers.ondragenter - Web APIs
d("source"); el.ondragenter = dragenter_handler; el.ondragleave = dragleave_handler; el.ondragend = dragend_handler; el.ondragexit = dragexit_handler; } </script> <body onload="init();"> <h1>examples of <code>ondragenter</code>, <code>ondragleave</code>, <code>ondragend</code>, <code>ondragexit</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragenter' in that specification.
GlobalEventHandlers.ondragexit - Web APIs
d("source"); el.ondragenter = dragenter_handler; el.ondragleave = dragleave_handler; el.ondragend = dragend_handler; el.ondragexit = dragexit_handler; } </script> <body onload="init();"> <h1>examples of <code>ondragenter</code>, <code>ondragleave</code>, <code>ondragend</code>, <code>ondragexit</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragexit' in that specification.
GlobalEventHandlers.ondragleave - Web APIs
d("source"); el.ondragenter = dragenter_handler; el.ondragleave = dragleave_handler; el.ondragend = dragend_handler; el.ondragexit = dragexit_handler; } </script> <body onload="init();"> <h1>examples of <code>ondragenter</code>, <code>ondragleave</code>, <code>ondragend</code>, <code>ondragexit</code></h1> <div> <p id="source" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragleave' in that specification.
GlobalEventHandlers.ondragover - Web APIs
ta("text"); ev.target.appendchild(document.getelementbyid(data)); } function dragover_handler(ev) { console.log("dragover"); ev.preventdefault(); } </script> <body> <h1>examples of <code>ondrag</code>, <code>ondrop</code>, <code>ondragstart</code>, <code>ondragover</code></h1> <div> <p id="source" ondrag="drag_handler(event);" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragover' in that specification.
GlobalEventHandlers.ondragstart - Web APIs
ta("text"); ev.target.appendchild(document.getelementbyid(data)); } function dragover_handler(ev) { console.log("dragover"); ev.preventdefault(); } </script> <body> <h1>examples of <code>ondrag</code>, <code>ondrop</code>, <code>ondragstart</code>, <code>ondragover</code></h1> <div> <p id="source" ondrag="drag_handler(event);" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondragstart' in that specification.
GlobalEventHandlers.ondrop - Web APIs
.target.appendchild(document.getelementbyid(data)); } function dragover_handler(ev) { console.log("dragover"); ev.preventdefault(); } </script> <body> <h1>examples of <code>ondrag</code>, <code>ondrop</code>, <code>ondragstart</code>, <code>ondragover</code></h1> <div class="source"> <p id="source" ondrag="drag_handler(event);" ondragstart="dragstart_handler(event);" draggable="true"> select this element, drag it to the drop zone and then release the selection to move the element.</p> </div> <div id="target" ondrop="drop_handler(event);" ondragover="dragover_handler(event);">drop zone</div> </body> </html> specifications specification status comment html living standardthe definition of 'ondrop' in that specification.
GlobalEventHandlers.onfocus - Web APIs
html <input type="text" value="click here"> javascript let input = document.queryselector('input'); input.onblur = inputblur; input.onfocus = inputfocus; function inputblur() { input.value = 'focus has been lost'; } function inputfocus() { input.value = 'focus is here'; } result try clicking in and out of the form field, and watch its contents change accordingly.
GlobalEventHandlers.onformdata - Web APIs
examples // grab reference to form const formelem = document.queryselector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.onformdata = (e) => { console.log('formdata fired'); // get the form data from the event object let data = e.
GlobalEventHandlers.onkeydown - Web APIs
html <input> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.onkeydown = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result specifications specification status comment html living standardthe definition of 'onkeydown' in that specification.
GlobalEventHandlers.onkeyup - Web APIs
html <input> <p id="log"></p> javascript const input = document.queryselector('input'); const log = document.getelementbyid('log'); input.onkeyup = logkey; function logkey(e) { log.textcontent += ` ${e.code}`; } result specifications specification status comment html living standardthe definition of 'onkeyup' in that specification.
GlobalEventHandlers.onmousedown - Web APIs
ction showview(event) { view.removeattribute('hidden'); view.style.left = event.clientx - 50 + 'px'; view.style.top = event.clienty - 50 + 'px'; event.preventdefault(); } function moveview(event) { view.style.left = event.clientx - 50 + 'px'; view.style.top = event.clienty - 50 + 'px'; } function hideview(event) { view.setattribute('hidden', ''); } const container = document.queryselector('.container'); const view = document.queryselector('.view'); container.onmousedown = showview; container.onmousemove = moveview; document.onmouseup = hideview; result specification specification status comment html living standardthe definition of 'onmousedown' in that specification.
GlobalEventHandlers.onmousemove - Web APIs
cument.body.appendchild(node); this.follow = function(event) { node.style.left = event.clientx + 20 + 'px'; node.style.top = event.clienty + 10 + 'px'; }; this.show = function(event) { node.textcontent = event.target.dataset.tooltip; node.removeattribute('hidden'); }; this.hide = function() { node.setattribute('hidden', ''); }; })(); const links = document.queryselectorall('a'); links.foreach(link => { link.onmouseover = tooltip.show; link.onmousemove = tooltip.follow; link.onmouseout = tooltip.hide; }); result draggable elements we also have an example available showing the use of the onmousemove event handler with draggable objects — view the example in action.
GlobalEventHandlers.onmouseout - Web APIs
html <p>test your mouse on me!</p> javascript const p = document.queryselector('p'); p.onmouseover = logmouseover; p.onmouseout = logmouseout; function logmouseover() { p.innerhtml = 'mouse over detected'; } function logmouseout() { p.innerhtml = 'mouse out detected'; } result specification specification status comment html living standardthe definition of 'onmouseout' in that specification.
GlobalEventHandlers.onmouseover - Web APIs
html <p>test your mouse on me!</p> javascript const p = document.queryselector('p'); p.onmouseover = logmouseover; p.onmouseout = logmouseout; function logmouseover() { p.innerhtml = 'mouse over detected'; } function logmouseout() { p.innerhtml = 'mouse out detected'; } result specifications specification status comment html living standardthe definition of 'onmouseover' in that specification.
GlobalEventHandlers.onmouseup - Web APIs
z-index: -1; width: 100px; height: 50px; padding: 10px; background: #ed9; border-radius: 10px 10px 0 0; transform: translate(-50%, -90px); transition: transform .3s; } .depressed { transform: translate(-50%, -50%); } javascript function depress() { toast.classlist.add('depressed'); } function release() { toast.classlist.remove('depressed'); } const toaster = document.queryselector('.toaster'); const toast = document.queryselector('.toast'); toaster.onmousedown = depress; document.onmouseup = release; result specification specification status comment html living standardthe definition of 'onmouseup' in that specification.
GlobalEventHandlers.onpointerdown - Web APIs
#target { width: 400px; height: 30px; text-align: center; font: 16px "open sans", "helvetica", sans-serif; color: white; background-color: blue; border: 2px solid darkblue; cursor: pointer; user-select: none; -moz-user-select: none; -webkit-user-select: none; -ms-user-select: none; } result the resulting output is shown below.
GlobalEventHandlers.onresize - Web APIs
examples window size logger <p>resize the browser window to fire the <code>resize</code> event.</p> <p>window height: <span id="height"></span></p> <p>window width: <span id="width"></span></p> const heightoutput = document.queryselector('#height'); const widthoutput = document.queryselector('#width'); function resize() { heightoutput.textcontent = window.innerheight; widthoutput.textcontent = window.innerwidth; } window.onresize = resize; specification specification status comment html living standardthe definition of 'onresize' in that specification.
GlobalEventHandlers.onscroll - Web APIs
html <textarea>1 2 3 4 5 6 7 8 9</textarea> <p id="log"></p> css textarea { width: 4rem; height: 8rem; font-size: 3rem; } javascript const textarea = document.queryselector('textarea'); const log = document.getelementbyid('log'); textarea.onscroll = logscroll; function logscroll(e) { log.textcontent = `scroll position: ${e.target.scrolltop}`; } result specifications specification status comment html living standardthe definition of 'onscroll' in that specification.
GlobalEventHandlers.ontransitioncancel - Web APIs
let box = document.queryselector(".box"); box.ontransitionrun = function(event) { box.innerhtml = "zooming..."; } box.ontransitionend = function(event) { box.innerhtml = "done!"; } box.onclick = function() { box.style.display = 'none'; timeout = window.settimeout(appear, 2000); function appear() { box.style.display = 'block'; } } box.ontransitioncancel = function(event) { console.log('transitioncancel fired...
GlobalEventHandlers.ontransitionend - Web APIs
let box = document.queryselector(".box"); box.ontransitionrun = function(event) { box.innerhtml = "zooming..."; } box.ontransitionend = function(event) { box.innerhtml = "done!"; } result the resulting content looks like this: notice what happens when you hover your mouse cursor over the box, then move it away.
GlobalEventHandlers.onwheel - Web APIs
n: transform .3s; } javascript function zoom(event) { event.preventdefault(); if (event.deltay < 0) { // zoom in scale *= event.deltay * -2; } else { // zoom out scale /= event.deltay * 2; } // restrict scale scale = math.min(math.max(.125, scale), 4); // apply scale transform el.style.transform = `scale(${scale})`; } let scale = 1; const el = document.queryselector('div'); document.onwheel = zoom; result specification specification status comment html living standardthe definition of 'onwheel' in that specification.
HTMLCanvasElement.captureStream() - Web APIs
example // find the canvas element to capture var canvaselt = document.queryselector('canvas'); // get the stream var stream = canvaselt.capturestream(25); // 25 fps // do things to the stream // e.g.
HTMLCollection - Web APIs
the htmlcollection interface represents a generic collection (array-like object similar to arguments) of elements (in document order) and offers methods and properties for selecting from the list.
HTMLDetailsElement: toggle event - Web APIs
</details> </section> css body { display: flex; flex-direction: row-reverse; } #log { flex-shrink: 0; padding-left: 3em; } #summaries { flex-grow: 1; } javascript function logitem(e) { const item = document.queryselector(`[data-id=${e.target.id}]`); item.toggleattribute('hidden'); } const chapters = document.queryselectorall('details'); chapters.foreach((chapter) => { chapter.addeventlistener('toggle', logitem); }); result specifications specification status comment html living standardthe definition of 'toggle event' in that specification.
HTMLDialogElement.close() - Web APIs
<!-- simple pop-up dialog box, containing a form --> <dialog id="favdialog"> <form method="dialog"> <section> <p><label for="favanimal">favorite animal:</label> <select id="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="...
HTMLDialogElement.open - Web APIs
<!-- simple pop-up dialog box, containing a form --> <dialog id="favdialog"> <form method="dialog"> <section> <p><label for="favanimal">favorite animal:</label> <select id="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="...
HTMLDialogElement.returnValue - Web APIs
<!-- simple pop-up dialog box containing a form --> <dialog id="favdialog"> <form method="dialog"> <p><label>favorite animal: <select name="favanimal" required> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select> </label></p> <menu> <button>cancel</button> <button>confirm</button> </menu> </form> </dialog> <menu> <button id="updatedetails">update details</button> </menu...
HTMLDialogElement.show() - Web APIs
<!-- simple pop-up dialog box, containing a form --> <dialog id="favdialog"> <form method="dialog"> <section> <p><label for="favanimal">favorite animal:</label> <select id="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="...
HTMLDialogElement.showModal() - Web APIs
<!-- simple pop-up dialog box, containing a form --> <dialog id="favdialog"> <form method="dialog"> <section> <p><label for="favanimal">favorite animal:</label> <select id="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="...
HTMLDialogElement - Web APIs
<!-- simple pop-up dialog box, containing a form --> <dialog id="favdialog"> <form method="dialog"> <section> <p><label for="favanimal">favorite animal:</label> <select id="favanimal" name="favanimal"> <option></option> <option>brine shrimp</option> <option>red panda</option> <option>spider monkey</option> </select></p> </section> <menu> <button id="cancel" type="reset">cancel</button> <button type="submit">confirm</button> </menu> </form> </dialog> <menu> <button id="...
HTMLElement: gotpointercapture event - Web APIs
const para = document.queryselector('p'); para.addeventlistener('gotpointercapture', () => { console.log('i\'ve been captured!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, using the ongotpointercapture event handler property: const para = document.queryselector('p'); para.ongotpointercapture = () => { console.log('i\'ve been captured!') }; para...
HTMLElement: lostpointercapture event - Web APIs
const para = document.queryselector('p'); para.addeventlistener('lostpointercapture', () => { console.log('i\'ve been released!') }); para.addeventlistener('pointerdown', (event) => { para.setpointercapture(event.pointerid); }); the same example, but using the onlostpointercapture event handler property: const para = document.queryselector('p'); para.onlostpointercapture = () => { console.log('i\'ve been released!') }...
HTMLElement: pointercancel event - Web APIs
examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointercancel', (event) => { console.log('pointer event cancelled'); }); using the onpointercancel event handler property: const para = document.queryselector('p'); para.onpointercancel = (event) => { console.log('pointer event cancelled'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerdown event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerdown examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerdown', (event) => { console.log('pointer down event'); }); using the onpointerdown event handler property: const para = document.queryselector('p'); para.onpointerdown = (event) => { console.log('pointer down event'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerenter event - Web APIs
bubbles no cancelable no interface pointerevent event handler property onpointerenter examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerenter', (event) => { console.log('pointer entered element'); }); using the onpointerenter event handler property: const para = document.queryselector('p'); para.onpointerenter = (event) => { console.log('pointer entered element'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerleave event - Web APIs
bubbles no cancelable no interface pointerevent event handler property onpointerleave examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerleave', (event) => { console.log('pointer left element'); }); using the onpointerleave event handler property: const para = document.queryselector('p'); para.onpointerleave = (event) => { console.log('pointer left element'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointermove event - Web APIs
examples to add a handler for pointermove events using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointermove', (event) => { console.log('pointer moved'); }); you can also use the onpointermove event handler property: const para = document.queryselector('p'); para.onpointermove = (event) => { console.log('pointer moved'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerout event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerout examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerout', (event) => { console.log('pointer moved out'); }); using the onpointerout event handler property: const para = document.queryselector('p'); para.onpointerout = (event) => { console.log('pointer moved out'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerover event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerover examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerover', (event) => { console.log('pointer moved in'); }); using the onpointerover event handler property: const para = document.queryselector('p'); para.onpointerover = (event) => { console.log('pointer moved in'); }; specifications specification status pointer events obsolete ...
HTMLElement: pointerup event - Web APIs
bubbles yes cancelable yes interface pointerevent event handler property onpointerup examples using addeventlistener(): const para = document.queryselector('p'); para.addeventlistener('pointerup', (event) => { console.log('pointer up'); }); using the onpointerup event handler property: const para = document.queryselector('p'); para.onpointerup = (event) => { console.log('pointer up'); }; specifications specification status pointer events obsolete ...
HTMLElement: transitionrun event - Web APIs
const el = document.queryselector('.transition'); const message = document.queryselector('.message'); el.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); el.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); el.addeventlistener('transitionend', function() { message.textcontent = 'transitionend fired'; }); the difference...
HTMLElement: transitionstart event - Web APIs
const transition = document.queryselector('.transition'); const message = document.queryselector('.message'); transition.addeventlistener('transitionrun', function() { message.textcontent = 'transitionrun fired'; }); transition.addeventlistener('transitionstart', function() { message.textcontent = 'transitionstart fired'; }); transition.addeventlistener('transitionend', function() { message.textcontent = 'transitionend fired';...
HTMLFormElement.elements - Web APIs
the elements included by htmlformelement.elements and htmlformelement.length are the following: <button> <fieldset> <input> (with the exception that any whose type is "image" are omitted for historical reasons) <object> <output> <select> <textarea> no other elements are included in the list returned by elements, which makes it an excellent way to get at the elements most important when processing forms.
HTMLFormElement: formdata event - Web APIs
general info bubbles no cancelable no interface formdataevent event handler property globaleventhandlers.onformdata examples // grab reference to form const formelem = document.queryselector('form'); // submit handler formelem.addeventlistener('submit', (e) => { // on form submission, prevent default e.preventdefault(); // construct a formdata object, which fires the formdata event new formdata(formelem); }); // formdata handler to retrieve data formelem.addeventlistener('formdata', (e) => { console.log('formdata fired'); // get the form data from the event object...
HTMLFormElement.length - Web APIs
the elements included by htmlformelement.elements and htmlformelement.length are the following: <button> <fieldset> <input> (with the exception that any whose type is "image" are omitted for historical reasons) <object> <output> <select> <textarea> no other elements are included in the list returned by elements, which makes it an excellent way to get at the elements most important when processing forms.
HTMLFormElement.requestSubmit() - Web APIs
let myform = document.queryselector("form"); let submitbutton = myform.queryselector("#main-submit"); if (myform.requestsubmit) { if (submitbutton) { myform.requestsubmit(submitbutton); } else { myform.requestsubmit(); } } else { myform.submit(); } specifications specification status comment html living standardthe definition of 'requestsubmit()' in that specification.
HTMLImageElement.complete - Web APIs
let lightboxelem = document.queryselector("#lightbox"); let lightboximgelem = lightboxelem.queryselector("img"); let lightboxcontrolselem = lightboxelem.queryselector(".toolbar"); async function loadimage(url, elem) { return new promise((resolve, reject) => { elem.onload = () => resolve(elem); elem.onerror = reject; elem.src = url; }); } async function lightbox(url) { lightboxelem.style.display = "block"; await lo...
HTMLImageElement.height - Web APIs
var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const updateheight = event => { output.innertext = clockimage.height; }; window.addeventlistener("load", updateheight); window.addeventlistener("resize", updateheight); result this example may be easier to try out in its own window.
HTMLImageElement.loading - Web APIs
function addimagetolist(url) { const list = document.queryselector("div.photo-list"); let newitem = document.createelement("div"); newitem.classname = "photo-item"; let newimg = document.createelement("img"); newimg.loading = "lazy"; newimg.width = 320; newimg.height = 240; newimg.src = url; newitem.appendchild(newimg); list.appendchild(newitem); } specifications specification status comment html living stand...
HTMLImageElement.naturalHeight - Web APIs
javascript let output = document.queryselector(".output"); let image = document.queryselector("img"); window.addeventlistener("load", event => { output.innerhtml += `natural size: ${image.naturalwidth} x ` + `${image.naturalheight} pixels<br>`; output.innerhtml += `displayed size: ${image.width} x ` + `${image.height} pixels`; }); the javascript code simply dumps the natural and as-displaye...
HTMLImageElement.naturalWidth - Web APIs
javascript let output = document.queryselector(".output"); let image = document.queryselector("img"); window.addeventlistener("load", event => { output.innerhtml += `natural size: ${image.naturalwidth} x ` + `${image.naturalheight} pixels<br>`; output.innerhtml += `displayed size: ${image.width} x ` + `${image.height} pixels`; }); the javascript code simply dumps the natural and as-displaye...
HTMLImageElement.width - Web APIs
var clockimage = document.queryselector("img"); let output = document.queryselector(".size"); const updatewidth = event => { output.innertext = clockimage.width; }; window.addeventlistener("load", updatewidth); window.addeventlistener("resize", updatewidth); result this example may be easier to try out in its own window.
HTMLInputElement: invalid event - Web APIs
html <form action="#"> <ul> <li><label>enter an integer between 1 and 10: <input type="number" min="1" max="10" required></label></li> <li><input type="submit" value="submit"></li> </ul> </form><p id="log"></p> javascript const input = document.queryselector('input') const log = document.getelementbyid('log') input.addeventlistener('invalid', logvalue) function logvalue(e) { log.textcontent += e.target.value } result specifications specification status comment html living standardthe definition of 'invalid event' in that specification.
HTMLInputElement.mozGetFileNameArray() - Web APIs
the htmlinputelement.mozgetfilenamearray() method returns an array of the names of the files that were selected by the user on an html input element.
HTMLInputElement.mozSetFileNameArray() - Web APIs
the htmlinputelement.mozsetfilenamearray() method sets the names of the files that selected on an html input element.
HTMLInputElement: search event - Web APIs
examples // addeventlistener version const input = document.queryselector('input[type="search"]'); input.addeventlistener('search', () => { console.log("the term searched for was " + input.value); }) // onsearch version const input = document.queryselector('input[type="search"]'); input.onsearch = () => { console.log("the term searched for was " + input.value); }) specifications this event is not part of any specification.
HTMLMediaElement: abort event - Web APIs
bubbles no cancelable no interface event event handler property onabort examples const video = document.queryselector('video'); const videosrc = 'https://path/to/video.webm'; video.addeventlistener('abort', () => { console.log(`abort loading: ${videosrc}`); }); const source = document.createelement('source'); source.setattribute('src', videosrc); source.setattribute('type', 'video/webm'); video.appendchild(source); specifications specification status html living standard living standard html5 recommendation ...
HTMLMediaElement.autoplay - Web APIs
<video id="video" controls> <source src="https://player.vimeo.com/external/250688977.sd.mp4?s=d14b1f1a971dde13c79d6e436b88a6a928dfe26b&profile_id=165"> </video> *** disable autoplay (recommended) *** false is the default value document.queryselector('#video').autoplay = false; specifications specification status comment html living standardthe definition of 'htmlmediaelement.autoplay' in that specification.
HTMLMediaElement: canplay event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('canplay', (event) => { console.log('video can start, but not sure it will play through.'); }); using the oncanplay event handler property: const video = document.queryselector('video'); video.oncanplay = (event) => { console.log('video can start, but not sure it will play through.'); }; specifications specification status html liv...
HTMLMediaElement: canplaythrough event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('canplaythrough', (event) => { console.log('i think i can play through the entire ' + ' video without ever having to stop to buffer.'); }); using the oncanplaythrough event handler property: const video = document.queryselector('video'); video.oncanplaythrough = (event) => { console.log('i think i can play thru the entire ' + ' video without ...
HTMLMediaElement.captureStream() - Web APIs
document.queryselector('.playandrecord').addeventlistener('click', function() { var playbackelement = document.getelementbyid("playback"); var capturestream = playbackelement.capturestream(); playbackelement.play(); }); see recording a media element for a longer and more intricate example and explanation.
HTMLMediaElement.controlsList - Web APIs
the controlslist property of the htmlmediaelement interface returns a domtokenlist that helps the user agent select what controls to show on the media element whenever the user agent shows its own set of controls.
HTMLMediaElement.currentSrc - Web APIs
this could happen, for example, if the web server selects a media file based on the resolution of the user's display.
HTMLMediaElement: durationchange event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('durationchange', (event) => { console.log('not sure why, but the duration of the video has changed.'); }); using the ondurationchange event handler property: const video = document.queryselector('video'); video.ondurationchange = (event) => { console.log('not sure why, but the duration of the video has changed.'); }; specifications specificat...
HTMLMediaElement: ended event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('ended', (event) => { console.log('video stopped either because 1) it was over, ' + 'or 2) no further data is available.'); }); using the onended event handler property: const video = document.queryselector('video'); video.onended = (event) => { console.log('video stopped either because 1) it was over, ' + 'or 2) no further data is available.
HTMLMediaElement: error event - Web APIs
bubbles no cancelable no interface event event handler property onerror examples const video = document.queryselector('video'); const videosrc = 'https://path/to/video.webm'; video.addeventlistener('error', () => { console.error(`error loading: ${videosrc}`); }); video.setattribute('src', videosrc); specifications specification status html living standard living standard html5 recommendation ...
HTMLMediaElement: loadstart event - Web APIs
height: 5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "button log" "video log"; } button { grid-area: button; width: 10rem; margin: .5rem 0; } video { grid-area: video; } .event-log { grid-area: log; } .event-log>label { display: block; } js const loadvideo = document.queryselector('button'); const video = document.queryselector('video'); const eventlog = document.queryselector('.event-log-contents'); let source = null; function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}\n`; } video.addeventlistener('loadstart', handleevent); video.addeventlistener('progress', handleevent); video.addeventlistener('canplay', handleevent); video.
HTMLMediaElement.networkState - Web APIs
network_idle 1 htmlmediaelement is active and has selected a resource, but is not using the network.
HTMLMediaElement: playing event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('playing', (event) => { console.log('video is no longer paused'); }); using the onplaying event handler property: const video = document.queryselector('video'); video.onplaying = (event) => { console.log('video is no longer paused.'); }; specifications specification status html living standardthe definition of 'playing media ev...
HTMLMediaElement: progress event - Web APIs
5rem; border: 1px solid black; margin: .2rem; padding: .2rem; } .example { display: grid; grid-template-areas: "button log" "video log"; } button { grid-area: button; width: 10rem; margin: .5rem 0; } video { grid-area: video; } .event-log { grid-area: log; } .event-log>label { display: block; } javascript const loadvideo = document.queryselector('button'); const video = document.queryselector('video'); const eventlog = document.queryselector('.event-log-contents'); let source = null; function handleevent(event) { eventlog.textcontent = eventlog.textcontent + `${event.type}\n`; } video.addeventlistener('loadstart', handleevent); video.addeventlistener('progress', handleevent); video.addeventlistener('canplay', handleevent); video.
HTMLMediaElement: ratechange event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('ratechange', (event) => { console.log('the playback rate changed.'); }); using the onratechange event handler property: const video = document.queryselector('video'); video.onratechange = (event) => { console.log('the playback rate changed.'); }; specifications specification status html living standardthe definition of 'ratechange...
HTMLMediaElement.seekable - Web APIs
examples var video = document.queryselector("video"); var timerangesobject = video.seekable; var timeranges = []; //go through the object and output an array for (let count = 0; count < timerangesobject.length; count ++) { timeranges.push([timerangesobject.start(count), timerangesobject.end(count)]); } specifications specification status comment html living standardthe definition of 'htmlmediaelement' in that specification.
HTMLMediaElement: seeked event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('seeked', (event) => { console.log('video found the playback position it was looking for.'); }); using the onseeked event handler property: const video = document.queryselector('video'); video.onseeked = (event) => { console.log('video found the playback position it was looking for.'); }; specifications specification status html li...
HTMLMediaElement: seeking event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('seeking', (event) => { console.log('video is seeking a new position.'); }); using the onseeking event handler property: const video = document.queryselector('video'); video.onseeking = (event) => { console.log('video is seeking a new position.'); }; specifications specification status html living standardthe definition of 'seeking...
HTMLMediaElement.src - Web APIs
note: the best way to know the url of the media resource currently in active use in this element is to look at the value of the currentsrc attribute, which also takes into account selection of a best or preferred media resource from a list provided in an htmlsourceelement (which represents a <source> element).
HTMLMediaElement: stalled event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('stalled', (event) => { console.log('failed to fetch data, but trying.'); }); using the onstalled event handler property: const video = document.queryselector('video'); video.onstalled = (event) => { console.log('failed to fetch data, but trying.'); }; specifications specification status html living standardthe definition of 'stall...
HTMLMediaElement: suspend event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('suspend', (event) => { console.log('data loading has been suspended.'); }); using the onsuspend event handler property: const video = document.queryselector('video'); video.onsuspend = (event) => { console.log('data loading has been suspended.'); }; specifications specification status html living standardthe definition of 'suspend...
HTMLMedia​Element​.textTracks - Web APIs
var tracks = document.queryselector('video').texttracks; for (var i = 0, l = tracks.length; i < l; i++) { /* tracks.length == 10 */ if (tracks[i].language == 'en') { console.dir(tracks[i]); } } properties & methods properties length returns the number of text tracks in texttracklist object.
HTMLMediaElement: volumechange event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('volumechange', (event) => { console.log('the volume changed.'); }); using the onvolumechange event handler property: const video = document.queryselector('video'); video.onvolumechange = (event) => { console.log('the volume changed.'); }; specifications specification status html living standardthe definition of 'volumechange m...
HTMLMediaElement: waiting event - Web APIs
using addeventlistener(): const video = document.queryselector('video'); video.addeventlistener('waiting', (event) => { console.log('video is waiting for more data.'); }); using the onwaiting event handler property: const video = document.queryselector('video'); video.onwaiting = (event) => { console.log('video is waiting for more data.'); }; specifications specification status html living standardthe definition of 'waiti...
HTMLOrForeignElement.dataset - Web APIs
examples <div id="user" data-id="1234567890" data-user="johndoe" data-date-of-birth>john doe</div> const el = document.queryselector('#user'); // el.id === 'user' // el.dataset.id === '1234567890' // el.dataset.user === 'johndoe' // el.dataset.dateofbirth === '' // set the data attribute el.dataset.dateofbirth = '1960-10-03'; // result: el.dataset.dateofbirth === 1960-10-03 delete el.dataset.dateofbirth; // result: el.dataset.dateofbirth === undefined // 'somedataattr' in el.dataset === false el.dataset.somedataattr = 'm...
HTMLOrForeignElement.nonce - Web APIs
in later implementations, elements only expose their nonce attribute to scripts (and not to side-channels like css attribute selectors).
HTMLSlotElement.assignedElements() - Web APIs
examples let slots = this.shadowroot.queryselector('slot'); let elements = slots.assignedelements({flatten: true}); specifications specification status comment html living standardthe definition of 'assignedelements()' in that specification.
HTMLSlotElement.assignedNodes() - Web APIs
let slots = this.shadowroot.queryselectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLSlotElement.name - Web APIs
let slots = this.shadowroot.queryselectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLSlotElement: slotchange event - Web APIs
let slots = this.shadowroot.queryselectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the <slot>s, then add a slotchange event listener to the template's second slot — which is the one which has its contents changed in the example.
HTMLSlotElement - Web APIs
let slots = this.shadowroot.queryselectorall('slot'); slots[1].addeventlistener('slotchange', function(e) { let nodes = slots[1].assignednodes(); console.log('element in slot "' + slots[1].name + '" changed to "' + nodes[0].outerhtml + '".'); }); here we grab references to all the slots, then add a slotchange event listener to the 2nd slot in the template — which is the one that keeps having its contents changed in the example.
HTMLTableElement.createCaption() - Web APIs
html <table> <tr><td>cell 1.1</td><td>cell 1.2</td><td>cell 1.3</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td><td>cell 2.3</td></tr> </table> javascript let table = document.queryselector('table'); let caption = table.createcaption(); caption.textcontent = 'this caption was created by javascript!'; result specifications specification status comment html living standardthe definition of 'htmltableelement: createcaption' in that specification.
HTMLTableElement.deleteCaption() - Web APIs
html <table> <caption>this caption will be deleted!</caption> <tr><td>cell 1.1</td><td>cell 1.2</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td></tr> </table> javascript let table = document.queryselector('table'); table.deletecaption(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletecaption' in that specification.
HTMLTableElement.deleteRow() - Web APIs
html <table> <tr><td>cell 1.1</td><td>cell 1.2</td><td>cell 1.3</td></tr> <tr><td>cell 2.1</td><td>cell 2.2</td><td>cell 2.3</td></tr> <tr><td>cell 3.1</td><td>cell 3.2</td><td>cell 3.3</td></tr> </table> javascript let table = document.queryselector('table'); // delete second row table.deleterow(1); result specifications specification status comment html living standardthe definition of 'htmltableelement: deleterow' in that specification.
HTMLTableElement.deleteTFoot() - Web APIs
html <table> <thead><th>name</th><th>score</th></thead> <tr><td>bob</td><td>541</td></tr> <tr><td>jim</td><td>225</td></tr> <tfoot><th>average</th><td>383</td></tfoot> </table> javascript let table = document.queryselector('table'); table.deletetfoot(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletetfoot' in that specification.
HTMLTableElement.deleteTHead() - Web APIs
html <table> <thead><th>name</th><th>occupation</th></thead> <tr><td>bob</td><td>plumber</td></tr> <tr><td>jim</td><td>roofer</td></tr> </table> javascript let table = document.queryselector('table'); table.deletethead(); result specifications specification status comment html living standardthe definition of 'htmltableelement: deletethead' in that specification.
HTMLTableRowElement.rowIndex - Web APIs
html <table> <thead> <tr><th>item</th> <th>price</th></tr> </thead> <tbody> <tr><td>bananas</td> <td>$2</td></tr> <tr><td>oranges</td> <td>$8</td></tr> <tr><td>top sirloin</td> <td>$20</td></tr> </tbody> <tfoot> <tr><td>total</td> <td>$30</td></tr> </tfoot> </table> javascript let rows = document.queryselectorall('tr'); rows.foreach((row) => { let z = document.createelement("td"); z.textcontent = `(row #${row.rowindex})`; row.appendchild(z); }); result ...
HTMLTableRowElement - Web APIs
obsolete the cells, rowindex, and selectionrowindex properties are now read-only.
HTMLTemplateElement.content - Web APIs
syntax var documentfragment = templateelement.content example var templateelement = document.queryselector("#foo"); var documentfragment = templateelement.content.clonenode(true); specifications specification status comment html living standardthe definition of 'htmltemplateelement interface' in that specification.
HTMLVideoElement.msHorizontalMirror - Web APIs
example var myvideo = document.getelementbyid("videotag1"); myvideo.mshorizontalmirror = true; myvideo.play(); example #2: var flip = document.queryselector('#flip'); flip.addeventlistener('click', function() { video.mshorizontalmirror = true; }); see also htmlvideoelement microsoft api extensions ...
The HTML DOM API - Web APIs
ielement htmllabelelement htmllegendelement htmllinkelement htmlmapelement htmlmediaelement htmlmenuelement htmlmetaelement htmlmeterelement htmlmodelement htmlolistelement htmlobjectelement htmloptgroupelement htmloptionelement htmloutputelement htmlparagraphelement htmlparamelement htmlpictureelement htmlpreelement htmlprogresselement htmlquoteelement htmlscriptelement htmlselectelement htmlslotelement htmlsourceelement htmlspanelement htmlstyleelement htmltablecaptionelement htmltablecellelement htmltablecolelement htmltableelement htmltablerowelement htmltablesectionelement htmltemplateelement htmltextareaelement htmltimeelement htmltitleelement htmltrackelement htmlulistelement htmlunknownelement htmlvideoelement deprecated html element interfaces ...
Recommended Drag Types - Web APIs
for example: event.datatransfer.setdata("text/plain", "this is text to drag"); dragging text in textboxes and selections on web pages is done automatically by the browser, so you do not need to handle it yourself.
IDBCursor.continue() - Web APIs
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.delete() - Web APIs
WebAPIIDBCursordelete
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.direction - Web APIs
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.key - Web APIs
WebAPIIDBCursorkey
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.primaryKey - Web APIs
within each iteration we log the primary key of the cursor to the console, something like this (its the album title in each case, which is our primarykey): hemispheres the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.source - Web APIs
WebAPIIDBCursorsource
within each iteration we log the source of the cursor, which will log our idbobjectstore object to the console, something like this: idbobjectstore {autoincrement: false, transaction: idbtransaction, indexnames: domstringlist, keypath: "albumtitle", name: "rushalbumlist"…} the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor.update() - Web APIs
WebAPIIDBCursorupdate
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursor - Web APIs
WebAPIIDBCursor
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursorWithValue.value - Web APIs
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBCursorWithValue - Web APIs
the cursor does not require us to select the data based on a key; we can just grab all of it.
IDBFactory.open() - Web APIs
WebAPIIDBFactoryopen
for a full working example, see our to-do notifications app (view example live.) var note = document.queryselector("ul"); // in the following line, you should include the prefixes // of implementations you want to test.
IDBIndex.openCursor() - Web APIs
if nothing is passed, this will default to a key range that selects all the records in this object store.
IDBIndex.openKeyCursor() - Web APIs
if nothing is passed, this will default to a key range that selects all the records in this object store.
IDBObjectStore.get() - Web APIs
the get() method of the idbobjectstore interface returns an idbrequest object, and, in a separate thread, returns the object store selected by the specified key.
IDBObjectStore.getAll() - Web APIs
if nothing is passed, this will default to a key range that selects all the records in this object store.
IDBObjectStore.getKey() - Web APIs
the getkey() method of the idbobjectstore interface returns an idbrequest object, and, in a separate thread, returns the key selected by the specified query.
IDBObjectStore.openCursor() - Web APIs
if nothing is passed, this will default to a key range that selects all the records in this object store.
IDBObjectStore.openKeyCursor() - Web APIs
if nothing is passed, this will default to a key range that selects all the records in this object store.
IDBVersionChangeEvent.newVersion - Web APIs
for a full working example, see our to-do notifications app (view example live.) var note = document.queryselector("ul"); // in the following line, you should include the prefixes of // implementations you want to test.
IDBVersionChangeEvent - Web APIs
for a full working example, see our to-do notifications app (view example live.) var note = document.queryselector("ul"); // in the following line, you should include the prefixes of implementations you want to test.
IIRFilterNode.getFrequencyResponse() - Web APIs
ay[2] = 3000; myfrequencyarray[3] = 4000; myfrequencyarray[4] = 5000; var magresponseoutput = new float32array(5); var phaseresponseoutput = new float32array(5); next we create a <ul> element in our html to contain our results, and grab a reference to it in our javascript: <p>iir filter frequency response for: </p> <ul class="freq-response-output"> </ul> var freqresponseoutput = document.queryselector('.freq-response-output'); finally, after creating our filter, we use getfrequencyresponse() to generate the response data and put it in our arrays, then loop through each data set and output them in a human-readable list at the bottom of the page: var feedforwardcoefficients = [0.1, 0.2, 0.3, 0.4, 0.5]; var feedbackcoefficients = [0.5, 0.4, 0.3, 0.2, 0.1]; var iirfilter = audioctx.createiirf...
ImageCapture() constructor - Web APIs
navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); }) .catch(error => console.log(error)); specifications specification status comment mediastream image capturethe definition of 'imagecapture' in that specification.
ImageCapture.getPhotoCapabilities() - Web APIs
const input = document.queryselector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings...
ImageCapture.grabFrame() - Web APIs
var grabframebutton = document.queryselector('button#grabframe'); var canvas = document.queryselector('canvas'); grabframebutton.onclick = grabframe; function grabframe() { imagecapture.grabframe() .then(function(imagebitmap) { console.log('grabbed frame:', imagebitmap); canvas.width = imagebitmap.width; canvas.height = imagebitmap.height; canvas.getcontext('2d').drawimage(imagebitmap, 0, 0); canvas.classlist.rem...
Browser storage limits and eviction criteria - Web APIs
this will only be evicted if the user chooses to (for example, in firefox you can choose to delete all stored data or only stored data from selected origins by going to preferences and using the options under privacy & security > cookies & site data).
Checking when a deadline is due - Web APIs
<select> elements for inputting the day, month and year of the deadline.
InputEvent.data - Web APIs
WebAPIInputEventdata
<p>some text to copy and paste.</p> <input type="text"> <p class="result"></p> var editable = document.queryselector('input') var result = document.queryselector('.result'); editable.addeventlistener('input', (e) => { result.textcontent = "inputted text: " + e.data; }); specifications specification status comment input events level 2the definition of 'data' in that specification.
InputEvent.dataTransfer - Web APIs
<p><span style="font-weight: bold; color: blue">whoa, bold blue text!</span></p> <p><span style="font-style: italic; color: red">exciting: italic red text!</span></p> <p>boring normal text ;-(</p> <hr> <p contenteditable="true">go on, try pasting some content into this editable paragraph and see what happens!</p> <p class="result"></p> var editable = document.queryselector('p[contenteditable]'); var result = document.queryselector('.result') var datatransferobj; editable.addeventlistener('input', (e) => { result.textcontent = e.datatransfer.getdata('text/html'); }); specifications specification status comment input events level 2the definition of 'datatransfer' in that specification.
InputEvent.inputType - Web APIs
try inserting line breaks, or deleting text in different ways, or pasting different content in.</p> <hr> <ul> <li>a sample</li> <li>bulleted</li> <li>list.</li> </ul> <p>another paragraph.</p> </div> javascript const log = document.getelementbyid('log'); const editable = document.queryselector('div[contenteditable]'); editable.addeventlistener('input', loginputtype); function loginputtype(event) { log.textcontent = `input type: ${event.inputtype}`; } result try editing the text inside the <div> and see what happens.
installChrome - Web APIs
url url is a string containing a full or relative url to download name name is displayed in the dialog, but is also used to *select* the theme somust match exactly the name in the internal manifest.rdf file.
IntersectionObserver - Web APIs
if (entries[0].intersectionratio <= 0) return; loaditems(10); console.log('loaded new items'); }); // start observing intersectionobserver.observe(document.queryselector('.scrollerfooter')); specifications specification status comment intersection observerthe definition of 'intersectionobserver' in that specification.
KeyboardEvent.charCode - Web APIs
example html <p>type anything into the input box below to log a <code>charcode</code>.</p> <input type="text" /> <p id="log"></p> javascript let input = document.queryselector('input'); let log = document.queryselector('#log'); input.addeventlistener('keypress', function(e) { log.innertext = `key pressed: ${string.fromcharcode(e.charcode)}\ncharcode: ${e.charcode}`; }); result notes in a keypress event, the unicode value of the key pressed is stored in either the keycode or charcode property, but never both.
KeyboardEvent.key - Web APIs
WebAPIKeyboardEventkey
when they occur, the key's value is checked to see if it's one of the keys the code is interested in, and if it is, it gets processed in some way (possibly by steering a spacecraft, perhaps by changing the selected cell in a spreadsheet).
KeyframeEffect - Web APIs
keyframeeffect.pseudoelement gets and sets the selector of the pseudo-element being animated by this object.
KeyframeEffectOptions - Web APIs
pseudoelement optional the selector of the pseudo-element to be targeted, if any.
Location - Web APIs
WebAPILocation
00%; width:100%; left:50%; margin-left:-50%; font-size:40%; line-height:1.5; background:black;} [title]:hover:before, :target:before {background:black; color:yellow;} [title] [title]:before {margin-top:1.5em;} [title] [title] [title]:before {margin-top:3em;} [title]:hover, :target {position:relative; z-index:1; outline:50em solid rgba(255,255,255,.8);} javascript [].foreach.call(document.queryselectorall('[title][id]'), function (node) { node.addeventlistener("click", function(e) { e.preventdefault(); e.stoppropagation(); window.location.hash = '#' + $(this).attr('id'); }); }); [].foreach.call(document.queryselectorall('[title]'), function (node) { node.addeventlistener("click", function(e) { e.preventdefault(); e.stoppropagation(); window.location.hash = ''; ...
MSManipulationEvent.initMSManipulationEvent() - Web APIs
arg: boolean, viewarg: window, detailarg: number, laststate: number, currentstate: number): void; readonly ms_manipulation_state_active: number; readonly ms_manipulation_state_cancelled: number; readonly ms_manipulation_state_committed: number; readonly ms_manipulation_state_dragging: number; readonly ms_manipulation_state_inertia: number; readonly ms_manipulation_state_preselect: number; readonly ms_manipulation_state_selecting: number; readonly ms_manipulation_state_stopped: number; } see also msmanipulationevent microsoft api extensions ...
MSManipulationEvent - Web APIs
arg: boolean, viewarg: window, detailarg: number, laststate: number, currentstate: number): void; readonly ms_manipulation_state_active: number; readonly ms_manipulation_state_cancelled: number; readonly ms_manipulation_state_committed: number; readonly ms_manipulation_state_dragging: number; readonly ms_manipulation_state_inertia: number; readonly ms_manipulation_state_preselect: number; readonly ms_manipulation_state_selecting: number; readonly ms_manipulation_state_stopped: number; } see also touchevent msmanipulationstatechanged microsoft api extensions ...
MathMLElement - Web APIs
ndlers, element, elementcssinlinestyle, globaleventhandlers, htmlorforeignelement methods this interface has no methods, but inherits methods from: documentandelementeventhandlers, element, elementcssinlinestyle, globaleventhandlers, htmlorforeignelement examples mathml <math xmlns="http://www.w3.org/1998/math/mathml"> <msqrt> <mi>x</mi> </msqrt> </math> javascript document.queryselector('msqrt').constructor.name; // mathmlelement specifications specification status comment mathmlelement interface ...
MediaElementAudioSourceNode.mediaElement - Web APIs
examples const audioctx = new window.audiocontext(); const audioelem = document.queryselector('audio'); let options = { mediaelement: audioelem } let source = new mediaelementaudiosourcenode(audioctx, options); console.log(source.mediaelement); specifications specification status comment web audio apithe definition of 'mediaelementaudiosourcenode.mediaelement' in that specification.
MediaElementAudioSourceNode - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.queryselector('audio'); var pre = document.queryselector('pre'); var myscript = document.queryselector('script'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a gain node var gainnode = audioctx.creategain(); // create variables to store mouse pointer y coordinate // and ...
MediaQueryList.addListener() - Web APIs
examples var para = document.queryselector('p'); var mql = window.matchmedia('(max-width: 600px)'); function screentest(e) { if (e.matches) { /* the viewport is 600 pixels wide or less */ para.textcontent = 'this is a narrow screen — less than 600px wide.'; document.body.style.backgroundcolor = 'red'; } else { /* the viewport is more than than 600 pixels wide */ para.textcontent = 'this is a wide screen — mo...
MediaQueryList.media - Web APIs
javascript let mql = window.matchmedia('(max-width: 600px)'); document.queryselector(".mq-value").innertext = mql.media; the javascript code simply passes the media query to match into matchmedia() to compile it, then sets the <span>'s innertext to the value of the result's media property.
MediaQueryList - Web APIs
var para = document.queryselector('p'); var mql = window.matchmedia('(max-width: 600px)'); function screentest(e) { if (e.matches) { /* the viewport is 600 pixels wide or less */ para.textcontent = 'this is a narrow screen — less than 600px wide.'; document.body.style.backgroundcolor = 'red'; } else { /* the viewport is more than than 600 pixels wide */ para.textcontent = 'this is a wide screen — mo...
MediaRecorder() - Web APIs
options optional a dictionary object that can contain the following properties: mimetype: a mime type specifying the format for the resulting media; you may simply specify the container format (the browser will select its preferred codecs for audio and/or video), or you may use the codecs parameter and/or the profiles parameter to provide detailed information about which codecs to use and how to configure them.
MediaRecorder - Web APIs
properties mediarecorder.mimetype read only returns the mime type that was selected as the recording container for the mediarecorder object when it was created.
MediaSession.playbackState - Web APIs
example the following example sets up event handlers, for pausing and playing: var audio = document.queryselector("#player"); audio.src = "song.mp3"; navigator.mediasession.setactionhandler('play', play); navigator.mediasession.setactionhandler('pause', pause); function play() { audio.play(); navigator.mediasession.playbackstate = "playing"; } function pause() { audio.pause(); navigator.mediasession.playbackstate = "paused"; } specifications specification status comment ...
MediaSession - Web APIs
) {}); navigator.mediasession.setactionhandler('seekbackward', function() {}); navigator.mediasession.setactionhandler('seekforward', function() {}); navigator.mediasession.setactionhandler('previoustrack', function() {}); navigator.mediasession.setactionhandler('nexttrack', function() {}); } the following example sets up event handlers for pausing and playing: var audio = document.queryselector("#player"); audio.src = "song.mp3"; navigator.mediasession.setactionhandler('play', play); navigator.mediasession.setactionhandler('pause', pause); function play() { audio.play(); navigator.mediasession.playbackstate = "playing"; } function pause() { audio.pause(); navigator.mediasession.playbackstate = "paused"; } specifications specification status comment ...
MediaSettingsRange - Web APIs
const input = document.queryselector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings...
MediaSource.MediaSource() - Web APIs
example the following snippet is taken from a simple example written by nick desaulniers (view the full demo live, or download the source for further investigation.) var video = document.queryselector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource; //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(medi...
active - Web APIs
var promise = navigator.mediadevices.getusermedia({ audio: true, video: true }); promise.then(function(stream) { var startbtn = document.queryselector('#startbtn'); startbtn.disabled = stream.active; };) specifications specification status comment media capture and streamsthe definition of 'active' in that specification.
MediaStream.getAudioTracks() - Web APIs
navigator.mediadevices.getusermedia({audio: true, video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; // stop the audio stream after 5 seconds settimeout(() => { const tracks = mediastream.getaudiotracks() tracks[0].stop() }, 5000) }) specifications specification status comment media capture and streamsthe definition of 'getaudiotracks()' in that specification.
MediaStream.getTracks() - Web APIs
example navigator.mediadevices.getusermedia({audio: false, video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; // stop the stream after 5 seconds settimeout(() => { const tracks = mediastream.gettracks() tracks[0].stop() }, 5000) }) specifications specification status comment media capture and streamsthe definition of 'gettracks()' in that specification.
MediaStream.getVideoTracks() - Web APIs
var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) specifications specification status comment media capture and streamsthe definition of 'getvideotracks()' in that specification.
MediaStreamTrack.enabled - Web APIs
"&#x25b6;&#xfe0f;" : "&#x23f8;&#xfe0f;"; myaudiotrack.enabled = newstate; } this creates a variable, newstate, which is the opposite of the current value of enabled, then uses that to select either the emoji character for the "play" icon or the character for the "pause" icon as the new innerhtml of the pause button's element.
MediaStreamTrackAudioSourceNode - Web APIs
var pre = document.queryselector('pre'); var video = document.queryselector('video'); var myscript = document.queryselector('script'); var range = document.queryselector('input'); // getusermedia block - grab stream // put it into a mediastreamaudiosourcenode // also output the visuals into a video element if (navigator.mediadevices) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ({audi...
Using the MediaStream Recording API - Web APIs
we'll declare some variables for the record and stop buttons, and the <article> that will contain the generated audio players: const record = document.queryselector('.record'); const stop = document.queryselector('.stop'); const soundclips = document.queryselector('.sound-clips'); finally for this section, we set up the basic getusermedia structure: if (navigator.mediadevices && navigator.mediadevices.getusermedia) { console.log('getusermedia supported.'); navigator.mediadevices.getusermedia ( // constraints - only audio needed for this app ...
MediaTrackConstraints.cursor - Web APIs
usage notes you can check the setting selected by the user agent after the display media has been created by getdisplaymedia() by calling getsettings() on the display media's video mediastreamtrack, then checking the value of the returned mediatracksettings object's cursor object.
MediaTrackSettings.aspectRatio - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.aspectratio property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.autoGainControl - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.autogaincontrol property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.channelCount - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.channelcount property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.deviceId - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.deviceid property you provided when calling either getusermedia().
MediaTrackSettings.echoCancellation - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.echocancellation property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.facingMode - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.facingmode property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.frameRate - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.framerate property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.groupId - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.groupid property you provided when calling either getusermedia().
MediaTrackSettings.height - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.height property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.latency - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.latency property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.logicalSurface - Web APIs
the most common scenario in which a display surface may be a logical one is if the selected surface contains the entire content area of a window which is too large to display onscreen at once.
MediaTrackSettings.noiseSuppression - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.noisesuppression property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.sampleRate - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.samplerate property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.sampleSize - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.samplesize property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.volume - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.volume property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
MediaTrackSettings.width - Web APIs
this lets you determine what value was selected to comply with your specified constraints for this property's value as described in the mediatrackconstraints.width property you provided when calling either getusermedia() or mediastreamtrack.applyconstraints().
Media Session API - Web APIs
the following example adds a pointerup event to an on-page play button, which is then used to kick off the media session code: playbutton.addeventlistener('pointerup', function(event) { var audio = document.queryselector('audio'); // user interacted with the page.
MessageChannel() - Web APIs
var channel = new messagechannel(); var para = document.queryselector('p'); var ifr = document.queryselector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel mes...
MessageChannel.port1 - Web APIs
var channel = new messagechannel(); var para = document.queryselector('p'); var ifr = document.queryselector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } specifications specification status ...
MessageChannel.port2 - Web APIs
var channel = new messagechannel(); var para = document.queryselector('p'); var ifr = document.queryselector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel mes...
MessageChannel - Web APIs
var channel = new messagechannel(); var output = document.queryselector('.output'); var iframe = document.queryselector('iframe'); // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for messages on port1 channel.port1.onmessage = onmessage; // transfer port2 to the iframe iframe.contentwindow.postmessage('hello from the main page!', '*', [channel.port2]); } // handle messages received on port1 function...
MessagePort: message event - Web APIs
event handler property onmessage examples suppose a script creates a messagechannel and sends one of the ports to a different browsing context, such as another <iframe>, using code like this: const channel = new messagechannel(); const myport = channel.port1; const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const messagecontrol = document.queryselector('#message'); const channelmessagebutton = document.queryselector('#channel-message'); channelmessagebutton.addeventlistener('click', () => { myport.postmessage(messagecontrol.value); }) targetframe.postmessage('init', targetorigin, [channel.port2]); the target can receive the port and start listening for messages on it using code like this: window.addeventlistener('message', (event) => ...
MessagePort: messageerror event - Web APIs
vent handler property onmessageerror examples suppose a script creates a messagechannel and sends one of the ports to a different browsing context, such as another <iframe>, using code like this: const channel = new messagechannel(); const myport = channel.port1; const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const messagecontrol = document.queryselector('#message'); const channelmessagebutton = document.queryselector('#channel-message'); channelmessagebutton.addeventlistener('click', () => { myport.postmessage(messagecontrol.value); }) targetframe.postmessage('init', targetorigin, [channel.port2]); the target can receive the port and start listening for messages and message errors on it using code like this: window.addeventlistener('me...
MessagePort.onmessage - Web APIs
var channel = new messagechannel(); var para = document.queryselector('p'); var ifr = document.queryselector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel mes...
MessagePort.postMessage() - Web APIs
var channel = new messagechannel(); var para = document.queryselector('p'); var ifr = document.queryselector('iframe'); var otherwindow = ifr.contentwindow; ifr.addeventlistener("load", iframeloaded, false); function iframeloaded() { otherwindow.postmessage('hello from the main page!', '*', [channel.port2]); } channel.port1.onmessage = handlemessage; function handlemessage(e) { para.innerhtml = e.data; } for a full working example, see our channel mes...
MessagePort - Web APIs
var channel = new messagechannel(); var output = document.queryselector('.output'); var iframe = document.queryselector('iframe'); // wait for the iframe to load iframe.addeventlistener("load", onload); function onload() { // listen for messages on port1 channel.port1.onmessage = onmessage; // transfer port2 to the iframe iframe.contentwindow.postmessage('hello from the main page!', '*', [channel.port2]); } // handle messages received on port1 function...
Microsoft API extensions - Web APIs
layoutchanged msfirstpaint pinned sites apis mssitemodeevent mssitemodejumplistitemremoved msthumbnailclick other apis x-ms-aria-flowfrom x-ms-acceleratorkey x-ms-format-detection mscaching mscachingenabled mscapslockwarningoff event.msconverturl() mselementresize document.mselementsfromrect() msisstatichtml navigator.mslaunchuri() mslaunchuricallback element.msmatchesselector() msprotocols msputpropertyenabled mswriteprofilermark ...
MouseEvent.altKey - Web APIs
WebAPIMouseEventaltKey
html <p>click anywhere to test the <code>altkey</code> property.</p> <p id="log"></p> javascript let log = document.queryselector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the alt key is pressed: ${e.altkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.altkey' in that specification.
MouseEvent.button - Web APIs
WebAPIMouseEventbutton
example html <button id="button" oncontextmenu="event.preventdefault();">click here with your mouse...</button> <p id="log"></p> javascript let button = document.queryselector('#button'); let log = document.queryselector('#log'); button.addeventlistener('mouseup', logmousebutton); function logmousebutton(e) { if (typeof e === 'object') { switch (e.button) { case 0: log.textcontent = 'left button clicked.'; break; case 1: log.textcontent = 'middle button clicked.'; break; case 2: log.textcontent = 'right...
MouseEvent.buttons - Web APIs
re id="log">buttons: </pre> javascript let log = document.createtextnode('?'); // let log = new text('?'); function logbuttons(e) { log.data = `${e.buttons} (${e.type})`; // log.nodevalue= `${e.buttons} (${e.type})`; } document.addeventlistener('mouseup', logbuttons); document.addeventlistener('mousedown', logbuttons); // document.addeventlistener('mousemove', logbuttons); document.queryselector('#log').appendchild(log) result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.buttons' in that specification.
MouseEvent.clientX - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.queryselector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'clientx' in that specification.
MouseEvent.clientY - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.queryselector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'clienty' in that specification.
MouseEvent.ctrlKey - Web APIs
html <p>click anywhere to test the <code>ctrlkey</code> property.</p> <p id="log"></p> javascript let log = document.queryselector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the ctrl key is pressed: ${e.ctrlkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.ctrlkey' in that specification.
MouseEvent.metaKey - Web APIs
html <p>click anywhere to test the <code>metakey</code> property.</p> <p id="log"></p> javascript let log = document.queryselector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the meta key is pressed: ${e.metakey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.metakey' in that specification.
MouseEvent.pageX - Web APIs
WebAPIMouseEventpageX
javascript var box = document.queryselector(".box"); var pagex = document.getelementbyid("x"); var pagey = document.getelementbyid("y"); function updatedisplay(event) { pagex.innertext = event.pagex; pagey.innertext = event.pagey; } box.addeventlistener("mousemove", updatedisplay, false); box.addeventlistener("mouseenter", updatedisplay, false); box.addeventlistener("mouseleave", updatedisplay, false); the javascript code uses add...
MouseEvent.screenX - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.queryselector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result routing an event when you trap events on the window, document, or other roomy elements, you can get the coordinates of that event (e.g., a click) and route it properly, as the followi...
MouseEvent.screenY - Web APIs
html <p>move your mouse to see its position.</p> <p id="screen-log"></p> javascript let screenlog = document.queryselector('#screen-log'); document.addeventlistener('mousemove', logkey); function logkey(e) { screenlog.innertext = ` screen x/y: ${e.screenx}, ${e.screeny} client x/y: ${e.clientx}, ${e.clienty}`; } result specifications specification status comment css object model (cssom) view modulethe definition of 'screeny' in that specification.
MouseEvent.shiftKey - Web APIs
html <p>click anywhere to test the <code>shiftkey</code> property.</p> <p id="log"></p> javascript let log = document.queryselector('#log'); document.addeventlistener('click', logkey); function logkey(e) { log.textcontent = `the shift key is pressed: ${e.shiftkey}`; } result specifications specification status comment document object model (dom) level 3 events specificationthe definition of 'mouseevent.shiftkey' in that specification.
MutationObserver.MutationObserver() - Web APIs
const targetnode = document.queryselector("#someelement"); const observeroptions = { childlist: true, attributes: true, // omit (or set to false) to observe only changes to the parent node subtree: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); the desired subtree is located by finding an element with the id someelement.
MutationObserver.disconnect() - Web APIs
const targetnode = document.queryselector("#someelement"); const observeroptions = { childlist: true, attributes: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); /* some time later...
MutationObserver.observe() - Web APIs
// identify an element to observe const elementtoobserve = document.queryselector("#targetelementid"); // create a new instance of `mutationobserver` named `observer`, // passing it a callback function const observer = new mutationobserver(function() { console.log('callback that runs when observer is triggered'); }); // call `observe()` on that mutationobserver instance, // passing it the element to observe, and the options object observer.observe(elementtoobserve, {su...
MutationObserver.takeRecords() - Web APIs
const targetnode = document.queryselector("#someelement"); const observeroptions = { childlist: true, attributes: true } const observer = new mutationobserver(callback); observer.observe(targetnode, observeroptions); /* ...later, when it's time to stop observing...
MutationObserver - Web APIs
// select the node that will be observed for mutations const targetnode = document.getelementbyid('some-id'); // options for the observer (which mutations to observe) const config = { attributes: true, childlist: true, subtree: true }; // callback function to execute when mutations are observed const callback = function(mutationslist, observer) { // use traditional 'for loops' for ie 11 for(let m...
MutationObserverInit.attributeFilter - Web APIs
tion.type) { case "attributes": switch(mutation.attributename) { case "status": userstatuschanged(mutation.target.username, mutation.target.status); break; case "username": usernamechanged(mutation.oldvalue, mutation.target.username); break; } break; } }); } var userlistelement = document.queryselector("#userlist"); var observer = new mutationobserver(callback); observer.observe(userlistelement, { attributefilter: [ "status", "username" ], attributeoldvalue: true, subtree: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
MutationObserverInit.attributeOldValue - Web APIs
function callback(mutationlist) { mutationlist.foreach(function(mutation) { switch(mutation.type) { case "attributes": notifyuser("attribute name " + mutation.attributename + " changed to " + mutation.target[mutation.attributename] + " (was " + mutation.oldvalue + ")"); break; } }); } var targetnode = document.queryselector("#target"); var observer = new mutationobserver(callback); observer.observe(targetnode, { attributes: true, attributeoldvalue: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
MutationObserverInit.attributes - Web APIs
function callback(mutationlist) { mutationlist.foreach(function(mutation) { switch(mutation.type) { case "attributes": notifyuser("attribute name " + mutation.attributename + " changed to " + mutation.target[mutation.attributename] + " (was " + mutation.oldvalue + ")"); break; } }); } var targetnode = document.queryselector("#target"); var observer = new mutationobserver(callback); observer.observe(targetnode, { attributes: true, attributeoldvalue: true }); the callback() function—which will be passed into the observe() method when starting the observer, looks at each item in the list of mutationrecord objects.
Navigator.clipboard - Web APIs
navigator.clipboard.readtext().then( cliptext => document.queryselector(".cliptext").innertext = cliptext); this snippet replaces the contents of the element whose class is "cliptext" with the text contents of the clipboard.
Navigator.connection - Web APIs
this could be used to select high definition content or low definition content based on the user's connection.
Navigator.share() - Web APIs
WebAPINavigatorshare
the javascript looks like this: const sharedata = { title: 'mdn', text: 'learn web development on mdn!', url: 'https://developer.mozilla.org', } const btn = document.queryselector('button'); const resultpara = document.queryselector('.result'); // must be triggered some kind of "user activation" btn.addeventlistener('click', async () => { try { await navigator.share(sharedata) resultpara.textcontent = 'mdn shared successfully' } catch(err) { resultpara.textcontent = 'error: ' + err } }); sharing files to share files, first test for and call navigator...
NavigatorLanguage.language - Web APIs
example if (/^en\b/.test(navigator.language)) { dolangselect(window.navigator.language); } specifications specification status comment html living standardthe definition of 'navigatorlanguage: language' in that specification.
Online and offline events - Web APIs
this property is updated whenever the user switches into "offline mode" by selecting the corresponding menu item (file -> work offline in firefox).
Network Information API - Web APIs
this can be used to select high definition content or low definition content based on the user's connection.
NodeIterator - Web APIs
nodeiterator.filter read only returns a nodefilter used to select the relevant nodes.
Notification.Notification() - Web APIs
the action's name is sent to the service worker notification handler to let it know the action was selected by the user.
PannerNode.distanceModel - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode.maxDistance - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode.panningModel - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode.setOrientation() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode.setPosition() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode.setVelocity() - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PannerNode - Web APIs
ctx.currenttime); listener.forwardy.setvalueattime(0, audioctx.currenttime); listener.forwardz.setvalueattime(-1, audioctx.currenttime); listener.upx.setvalueattime(0, audioctx.currenttime); listener.upy.setvalueattime(1, audioctx.currenttime); listener.upz.setvalueattime(0, audioctx.currenttime); } else { listener.setorientation(0,0,-1,0,1,0); } var source; var play = document.queryselector('.play'); var stop = document.queryselector('.stop'); var boombox = document.queryselector('.boom-box'); var listenerdata = document.queryselector('.listener-data'); var pannerdata = document.queryselector('.panner-data'); leftbound = (-xpos) + 50; rightbound = xpos - 50; xiterator = width/150; // listener will always be in the same place for this demo if(listener.positionx) { listener.
PasswordCredential - Web APIs
var form = document.queryselector('#form'); var creds = new passwordcredential(form); // store the credentials.
PasswordCredential.additionalData - Web APIs
navigator.credentials.get(options).then(function(creds) { if (creds.type == 'password') { var form = new formdata(); var csrf_token = document.queryselector('csrf_token').value; form.append('csrf_token', csrf_token); creds.additionaldata = form; fetch('https://www.example.com', { method: 'post', credentials: creds }); }; }); specifications specification status comment credential management level 1 working draft initial definition.
PaymentAddress - Web APIs
portedmethods: "basic-card", }, ]; const details = { total: { label: "donation", amount: { currency: "usd", value: "65.00" } }, displayitems: [ { label: "original donation amount", amount: { currency: "usd", value: "65.00" }, }, ], shippingoptions: [ { id: "standard", label: "standard shipping", amount: { currency: "usd", value: "0.00" }, selected: true, }, ], }; const options = { requestshipping: true }; async function dopaymentrequest() { const request = new paymentrequest(supportedinstruments, details, options); // add event listeners here.
PaymentDetailsBase - Web APIs
for example, you can use one to adjust the total payment amount based on the selected payment method ("5% cash discount!").
PaymentDetailsUpdate.error - Web APIs
this message can be used to explain to the user why they cannot submit their payment as currently specified—whether that's because the selected products cannot be shipped to their region or because their address is not served by any of the shipping companies you use.
PaymentDetailsUpdate - Web APIs
for example, you can use one to adjust the total payment amount based on the selected payment method ("5% cash discount!").
PaymentItem - Web APIs
this can be used to show items such as shipping or tax amounts that depend upon the selection of shipping address, shipping option, or so forth.
PaymentMethodChangeEvent.methodDetails - Web APIs
example this example uses the paymentmethodchange event to watch for changes to the payment method selected for apple pay, in order to compute a discount if the user chooses to use a visa card as their payment method.
PaymentMethodChangeEvent - Web APIs
the paymentmethodchangeevent interface of the payment request api describes the paymentmethodchange event which is fired by some payment handlers when the user switches payment instruments (e.g., a user selects a "store" card to make a purchase while using apple pay).
PaymentRequest.onpaymentmethodchange - Web APIs
for example, when using apple pay, the user can swipe to select different credit cards, debit cards, and so forth.
PaymentRequest.onshippingoptionchange - Web APIs
var request = new paymentrequest(supportedinstruments, details, options); // when user selects a shipping address request.addeventlistener('shippingaddresschange', e => { e.updatewith(((details, addr) => { var shippingoption = { id: '', label: '', amount: { currency: 'usd', value: '0.00' }, selected: true }; // shipping to us is supported if (addr.country === 'us') { shippingoption.id = 'us'; shippingoption.label = 'standard shipping i...
PaymentRequest.shippingAddress - Web APIs
}).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.
PaymentRequest: shippingaddresschange event - Web APIs
the shippingaddresschange event is sent to the paymentrequest object when the user selects a shipping address or changes details of their shipping address.
PaymentRequest.show() - Web APIs
// paymentresponse.methodname contains the selected payment method // paymentresponse.details contains a payment method specific response await response.complete("success"); } catch (err) { console.error("uh oh, something bad happened", err.message); } } the following example shows how to update the payment sheet as it's being presented to the end-user.
PaymentRequest - Web APIs
paymentrequest.shippingoption read only secure context returns the identifier of the selected shipping option.
PaymentRequestEvent() - Web APIs
options optional options are as follows: instrumentkey: a paymentinstrument object reflecting the payment instrument selected by the user or an empty string if the user has not registered or chosen a payment instrument.
PaymentRequestEvent.instrumentKey - Web APIs
the instrumentkey read-only property of the paymentrequestevent interface returns a paymentinstrument object reflecting the payment instrument selected by the user or an empty string if the user has not registered or chosen a payment instrument.
PaymentRequestEvent - Web APIs
properties instrumentkeyread only returns a paymentinstrument object reflecting the payment instrument selected by the user or an empty string if the user has not registered or chosen a payment instrument.
PaymentRequestUpdateEvent.updateWith() - Web APIs
for example, you can use one to adjust the total payment amount based on the selected payment method ("5% cash discount!").
PaymentResponse.methodName - Web APIs
the methodname read-only property of the paymentresponse interface returns a string uniquely identifying the payment handler selected by the user.
PaymentResponse.shippingAddress - Web APIs
}).catch(function(err) { console.error("uh oh, something bad happened", err.message); }); function updatedetails(details, shippingaddress, resolve) { if (shippingaddress.country === 'us') { var shippingoption = { id: '', label: '', amount: {currency: 'usd', value: '0.00'}, selected: true }; if (shippingaddress.region === 'mo') { shippingoption.id = 'mo'; shippingoption.label = 'free shipping in missouri'; details.total.amount.value = '55.00'; } else { shippingoption.id = 'us'; shippingoption.label = 'standard shipping in us'; shippingoption.amount.value = '5.00'; details.total.amount.value = '60.00'; } details.
Using the Payment Request API - Web APIs
recommending a payment app when user has no apps if you select to pay with the bobpay demo payment provider on this merchant page, it tries to call paymentrequest.show(), while intercepting the notsupportederr exception.
PhotoCapabilities - Web APIs
const input = document.queryselector('input[type="range"]'); var imagecapture; navigator.mediadevices.getusermedia({video: true}) .then(mediastream => { document.queryselector('video').srcobject = mediastream; const track = mediastream.getvideotracks()[0]; imagecapture = new imagecapture(track); return imagecapture.getphotocapabilities(); }) .then(photocapabilities => { const settings = imagecapture.track.getsettings...
Using Pointer Events - Web APIs
selecting a color for each touch in order to make each touch's drawing look different, the colorfortouch() function is used to pick a color based on the touch's unique identifier.
PublicKeyCredentialCreationOptions.extensions - Web APIs
also chrome doesn't plan to support any other extension in future extension identifier type description authnsel array of buffersource authenticator selection.
PublicKeyCredentialRequestOptions.userVerification - Web APIs
note: an analogous option exists for the creation operation (navigators.credentials.create()), see the userverification property of publickeycredentialcreationoptions.authenticatorselection.
PushManager.getSubscription() - Web APIs
var pushbutton = document.queryselector('.js-push-button'); pushbutton.disabled = false; if (!subscription) { // we aren’t subscribed to push, so set ui // to allow the user to enable push return; } // keep your server in sync with the latest subscriptionid sendsubscriptiontoserver(subscription); showcurlcommand(subscription); // set your ui t...
RTCConfiguration.iceTransportPolicy - Web APIs
the webrtc device api dictionary rtcconfiguration's icetransportpolicy property is a string indicating the transport selection policy the ice agent should use during negotiation of connections.
RTCIceCandidate.protocol - Web APIs
these values are defined by the enumerated type rtciceprotocol: tcp the candidate, if selected, would use tcp as the transport protocol for its data.
RTCIceCandidate.relatedAddress - Web APIs
for relay candidates, the related address and port are set to the mapped address selected by the turn server.
RTCIceCandidate.relatedPort - Web APIs
for relay candidates, the related address and port provide the mapped address selected by the turn server.
RTCIceCandidatePairStats.nominated - Web APIs
note: if more than one candidate pair are nominated at the same time, the one whose priority is higher will be selected for use.
RTCIceCandidatePairStats.priority - Web APIs
the higher the value, the more likely the webrtc layer is to select the candidate pair when the time comes to establish (or re-establish) a connection between the two peers.
RTCIceCandidateStats.deleted - Web APIs
`; // now the statistics for this report; we intentially drop the ones we // sorted to the top above object.keys(report).foreach(statname => { if (statname !== "id" && statname !== "timestamp" && statname !== "type") { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; } }); } }); document.queryselector(".stats-box").innerhtml = statsoutput; }); }, 1000); specifications specification status comment identifiers for webrtc's statistics apithe definition of 'rtcicecandidatestats.deleted' in that specification.
RTCIceCandidateStats.networkType - Web APIs
`; // now the statistics for this report; we intentially drop the ones we // sorted to the top above object.keys(report).foreach(statname => { if (statname !== "id" && statname !== "timestamp" && statname !== "type") { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; } }); } }); document.queryselector(".stats-box").innerhtml = statsoutput; }); }, 1000); ...
RTCIceCandidateStats.protocol - Web APIs
syntax protocol = rtcicecandidatestats.protocol; value the value is one of the members of the rtciceprotocol enumerated string type: tcp the candidate, if selected, would use tcp as the transport protocol for its data.
RTCIceProtocol - Web APIs
values tcp the candidate, if selected, would use tcp as the transport protocol for its data.
RTCIceServer - Web APIs
every server in the list will be contacted and tried out before one is selected to be used for negotiation.
RTCIceTransport.getLocalCandidates() - Web APIs
to find the best match found so far, call rtcicetransport.getselectedcandidatepair().
RTCIceTransport.getRemoteCandidates() - Web APIs
to find the best match found so far, call rtcicetransport.getselectedcandidatepair().
RTCIceTransport: statechange event - Web APIs
the state can be used to determine how far through the process of examining, verifying, and selecting a valid candidate pair is prior to successfully connecting the two peers for webrtc communications.
RTCPeerConnection.createDataChannel() - Web APIs
if you don't include this option, the user agent will select an id for you.
RTCPeerConnection: iceconnectionstatechange event - Web APIs
pc.addeventlistener("iceconnectionstatechange", ev => { let stateelem = document.queryselector("#call-state"); stateelem.classname = `${pc.iceconnectionstate}-state`; }, false); this can also be written as: pc.oniceconnectionstatechange = ev => { let stateelem = document.queryselector("#call-state"); stateelem.classname = `${pc.iceconnectionstate}-state`; } specifications specification status comment webrtc 1.0: real-time communication between browsers...
RTCRemoteOutboundRtpStreamStats.localId - Web APIs
async function networkteststop(pc) { if (pc) { let statsbox = document.queryselector(".stats-box"); let endreport = await pc.getstats(); for (let endremoteoutbound of endreport.values()) { if (endremoteoutbound.type === "remote-outbound-rtp") { let startremoteoutbound = startreport.get(endremoteoutbound.id); if (startremoteoutbound) { let startinboundstats = findreportentry(startreport, "remoteid", startremoteoutbound.id); let...
RTCRtpSender.replaceTrack() - Web APIs
examples switching video cameras // example to change video camera, suppose selected value saved into window.selectedcamera navigator.mediadevices .getusermedia({ video: { deviceid: { exact: window.selectedcamera } } }) .then(function(stream) { let videotrack = stream.getvideotracks()[0]; pcs.foreach(function(pc) { var sender = pc.getsenders().find(function(s) { return s.track.kind == videotrack.kind; }); cons...
Range.cloneRange() - Web APIs
WebAPIRangecloneRange
syntax clone = range.clonerange(); example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); clone = range.clonerange(); specifications specification status comment domthe definition of 'range.clonerange()' in that specification.
Range.collapse() - Web APIs
WebAPIRangecollapse
example var range = document.createrange(); referencenode = document.getelementsbytagname("div").item(0); range.selectnode(referencenode); range.collapse(true); specifications specification status comment domthe definition of 'range.collapse()' in that specification.
Range.compareBoundaryPoints() - Web APIs
example var range, sourcerange, compare; range = document.createrange(); range.selectnode(document.getelementsbytagname("div")[0]); sourcerange = document.createrange(); sourcerange.selectnode(document.getelementsbytagname("div")[1]); compare = range.compareboundarypoints(range.start_to_end, sourcerange); specifications specification status comment domthe definition of 'range.compareboundarypoints()' in that specification.
Range.comparePoint() - Web APIs
example range = document.createrange(); range.selectnode(document.getelementsbytagname('div').item(0)); returnvalue = range.comparepoint(document.getelementsbytagname('p').item(0), 1); specification specification status comment domthe definition of 'range.comparepoint()' in that specification.
Range.deleteContents() - Web APIs
syntax range.deletecontents() example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); range.deletecontents(); specifications specification status comment domthe definition of 'range.deletecontents()' in that specification.
Range.detach() - Web APIs
WebAPIRangedetach
syntax range.detach(); example var range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); range.detach(); specifications specification status comment domthe definition of 'range.detach()' in that specification.
Range.getClientRects() - Web APIs
syntax rectlist = range.getclientrects() example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); rectlist = range.getclientrects(); specification specification status comment css object model (cssom) view modulethe definition of 'range.getclientrects()' in that specification.
Range.insertNode() - Web APIs
WebAPIRangeinsertNode
example range = document.createrange(); newnode = document.createelement("p"); newnode.appendchild(document.createtextnode("new node inserted here")); range.selectnode(document.getelementsbytagname("div").item(0)); range.insertnode(newnode); specifications specification status comment domthe definition of 'range.insertnode()' in that specification.
Range.intersectsNode() - Web APIs
example var range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); var bool = range.intersectsnode(document.getelementsbytagname("p").item(0)); specification specification status comment domthe definition of 'range.intersectnode()' in that specification.
Range.isPointInRange() - Web APIs
example range = document.createrange(); range.selectnode(document.getelementsbytagname("div").item(0)); bool = range.ispointinrange(document.getelementsbytagname("p").item(0),1); specification specification status comment domthe definition of 'range.ispointinrange()' in that specification.
Range.setStart() - Web APIs
WebAPIRangesetStart
the selected range is then highlighted using range.surroundcontents().
Report - Web APIs
WebAPIReport
the report details are displayed via the displayreports() fuction, which takes the observer callback's reports parameter as its parameter: function displayreports(reports) { const outputelem = document.queryselector('.output'); const list = document.createelement('ul'); outputelem.appendchild(list); for(let i = 0; i < reports.length; i++) { let listitem = document.createelement('li'); let textnode = document.createtextnode('report ' + (i + 1) + ', type: ' + reports[i].type); listitem.appendchild(textnode); let innerlist = document.createelement('ul'); listitem.appendchild(innerli...
ResizeObserver - Web APIs
the javascript looks like so: const h1elem = document.queryselector('h1'); const pelem = document.queryselector('p'); const divelem = document.queryselector('body > div'); const slider = document.queryselector('input[type="range"]'); const checkbox = document.queryselector('input[type="checkbox"]'); divelem.style.width = '600px'; slider.addeventlistener('input', () => { divelem.style.width = slider.value + 'px'; }) const resizeobserver = new resizeobserver...
ResizeObserverEntry.borderBoxSize - Web APIs
math.min(100, (entry.borderboxsize[0].inlinesize/10) + (entry.borderboxsize[0].blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.queryselector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
ResizeObserverEntry.contentBoxSize - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.queryselector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
ResizeObserverEntry.target - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.queryselector('div')); specifications specification status comment resize observerthe definition of 'target' in that specification.
Resize Observer API - Web APIs
us = math.min(100, (entry.contentboxsize.inlinesize/10) + (entry.contentboxsize.blocksize/10)) + 'px'; } else { entry.target.style.borderradius = math.min(100, (entry.contentrect.width/10) + (entry.contentrect.height/10)) + 'px'; } } }); resizeobserver.observe(document.queryselector('div')); specifications specification status comment resize observer editor's draft initial definition.
Response.clone() - Web APIs
WebAPIResponseclone
var image1 = document.queryselector('.img1'); var image2 = document.queryselector('.img2'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { var response2 = response.clone(); response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); image1.src = objecturl; }); response2.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob...
Response.headers - Web APIs
WebAPIResponseheaders
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.headers); // returns a headers{} object response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'headers' in t...
Response.ok - Web APIs
WebAPIResponseok
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.ok); // returns true if the response returned successfully response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definitio...
Response.status - Web APIs
WebAPIResponsestatus
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.status); // returns 200 response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'status' in that specification...
Response.statusText - Web APIs
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.statustext); // returns "ok" if the response returned successfully response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe d...
Response.type - Web APIs
WebAPIResponsetype
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.type); // returns basic by default response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'type' in that spec...
Response.url - Web APIs
WebAPIResponseurl
var myimage = document.queryselector('img'); var myrequest = new request('flowers.jpg'); fetch(myrequest).then(function(response) { console.log(response.url); // returns /docs/web/api/response/flowers.jpg response.blob().then(function(myblob) { var objecturl = url.createobjecturl(myblob); myimage.src = objecturl; }); }); specifications specification status comment fetchthe definition of 'u...
Response - Web APIs
WebAPIResponse
const image = document.queryselector('.my-image'); fetch('flowers.jpg').then(function(response) { return response.blob(); }).then(function(blob) { const objecturl = url.createobjecturl(blob); image.src = objecturl; }); you can also use the response.response() constructor to create your own custom response object: const response = new response(); specifications specification status comment fetc...
RsaPssParams - Web APIs
rfc 3447 says that "typical salt lengths" are either 0 or the length of the output of the digest algorithm that was selected when this key was generated.
SVGAElement.target - Web APIs
var linkref = document.queryselector('a'); linkref.target ='_blank'; ...
SVGAElement - Web APIs
var linkref = document.queryselector("a"); linkref.target = "_self"; linkref.onclick = function(){ if (linkref.target === "_blank") { console.log("blank!"); linkref.target = "_self"; } else { console.log("sorry!
SVGAnimationElement: beginEvent event - Web APIs
h="300px" height="100px"> <title>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.queryselector('svg'); let animateelem = document.queryselector('animatemotion'); let list = document.queryselector('ul'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('repeatevent', (e) => { let listitem = document.createelement('li'); let msg ...
SVGAnimationElement: endEvent event - Web APIs
e>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <button>stop animation</button> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.queryselector('svg'); let animateelem = document.queryselector('animatemotion'); let list = document.queryselector('ul'); let btn = document.queryselector('button'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('endevent', () => { let listitem = d...
SVGAnimationElement: repeatEvent event - Web APIs
h="300px" height="100px"> <title>svg smil animate with path</title> <circle cx="0" cy="50" r="50" fill="blue" stroke="black" stroke-width="1"> <animatemotion path="m 0 0 h 300 z" dur="5s" repeatcount="indefinite" /> </circle> </svg> <hr> <ul> </ul> ul { height: 100px; border: 1px solid #ddd; overflow-y: scroll; padding: 10px 30px; } let svgelem = document.queryselector('svg'); let animateelem = document.queryselector('animatemotion'); let list = document.queryselector('ul'); animateelem.addeventlistener('beginevent', () => { let listitem = document.createelement('li'); listitem.textcontent = 'beginevent fired'; list.appendchild(listitem); }) animateelem.addeventlistener('repeatevent', (e) => { let listitem = document.createelement('li'); let msg =...
getBBox() - Web APIs
world!</text> <text x="8" y="32" transform="translate(0 20) scale(1.25 1)">hello world again!</text> </g> <!-- shows bbox in green --> <rect id="rect_1" stroke="#00ff00" stroke-width="3" fill="none"> </rect> <!-- shows boundingclientrect in red --> <rect id="rect_2" stroke="#ff0000" stroke-width="3" fill="none"></rect> </svg> javascript var rectbbox = document.queryselector('#rect_1'); var rectboundingclientrect = document.queryselector('#rect_2'); var groupelement = document.queryselector('#group_text_1'); var bboxgroup = groupelement.getbbox(); rectbbox.setattribute('x', bboxgroup.x); rectbbox.setattribute('y', bboxgroup.y); rectbbox.setattribute('width', bboxgroup.width); rectbbox.setattribute('height', bboxgroup.height); var boundingclientrectgroup = groupel...
SVGSVGElement - Web APIs
svgsvgelement.deselectall() unselects any selected objects, including any selections of text strings and type-in bars.
SVGTextContentElement - Web APIs
because the relationship between characters and glyphs is not one-to-one, only the first character of the relevant typographic character is returned svgtextcontentelement.selectsubstring() selects text within the element.
Screen.lockOrientation() - Web APIs
passing several strings lets the screen rotate only in the selected orientations.
ScriptProcessorNode.bufferSize - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.queryselector('script'); var mypre = document.queryselector('pre'); var playbutton = document.queryselector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(scrip...
ScriptProcessorNode.onaudioprocess - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.queryselector('script'); var mypre = document.queryselector('pre'); var playbutton = document.queryselector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log...
ScriptProcessorNode - Web APIs
note: for a full working example, see our script-processor-node github repo (also view the source code.) var myscript = document.queryselector('script'); var mypre = document.queryselector('pre'); var playbutton = document.queryselector('button'); // create audiocontext and buffer source var audioctx = new audiocontext(); source = audioctx.createbuffersource(); // create a scriptprocessornode with a buffersize of 4096 and a single input and output channel var scriptnode = audioctx.createscriptprocessor(4096, 1, 1); console.log(scrip...
ServiceWorker.onstatechange - Web APIs
var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.queryselector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.queryselector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.queryselector('#kind').textcontent = 'active'; } if (serviceworker) { logstate(serviceworker.state); serviceworker.addeventlistener('stat...
ServiceWorker.state - Web APIs
var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.queryselector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.queryselector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.queryselector('#kind').textcontent = 'active'; } if (serviceworker) { logstate(serviceworker.state); serviceworker.addeventlistener('stat...
ServiceWorker - Web APIs
if ('serviceworker' in navigator) { navigator.serviceworker.register('service-worker.js', { scope: './' }).then(function (registration) { var serviceworker; if (registration.installing) { serviceworker = registration.installing; document.queryselector('#kind').textcontent = 'installing'; } else if (registration.waiting) { serviceworker = registration.waiting; document.queryselector('#kind').textcontent = 'waiting'; } else if (registration.active) { serviceworker = registration.active; document.queryselector('#kind').textcontent = 'active'; } if (serviceworker) { ...
ServiceWorkerContainer.getRegistration() - Web APIs
example navigator.serviceworker.getregistration('/app').then(function(registration) { if(registration){ document.queryselector('#status').textcontent = 'serviceworkerregistration found.'; } }); specifications specification status comment service workersthe definition of 'serviceworkercontainer: getregistration' in that specification.
ServiceWorkerContainer.getRegistrations() - Web APIs
example navigator.serviceworker.getregistrations().then(function(registrations) { document.queryselector('#status').textcontent = 'serviceworkerregistrations found.'; }); specifications specification status comment service workersthe definition of 'getregistrations()' in that specification.
Using Service Workers - Web APIs
when we come to call the imgload() function, we call it with the url to the image we want to load, as we might expect, but the rest of the code is a little different: let body = document.queryselector('body'); let myimage = new image(); imgload('mylittlevader.jpg').then((response) => { var imageurl = window.url.createobjecturl(response); myimage.src = imageurl; body.appendchild(myimage); }, (error) => { console.log(error); }); on to the end of the function call, we chain the promise then() method, which contains two functions — the first one is executed when the promise successfu...
ShadowRoot.delegatesFocus - Web APIs
examples let customelem = document.queryselector('my-shadow-dom-element'); let shadow = customelem.shadowroot; ...
ShadowRoot.host - Web APIs
WebAPIShadowRoothost
examples let customelem = document.queryselector('my-shadow-dom-element'); let shadow = customelem.shadowroot; ...
ShadowRoot.innerHTML - Web APIs
examples let customelem = document.queryselector('my-shadow-dom-element'); let shadow = customelem.shadowroot; shadow.innerhtml = '<strong>this element should be more important!</strong>'; specifications this property is not defined by any specifications yet; see this open spec issue to specify it.
ShadowRoot.mode - Web APIs
WebAPIShadowRootmode
examples let customelem = document.queryselector('my-shadow-dom-element'); let shadow = customelem.shadowroot; // another way to check whether the shadow root is open; it will return null if not if(shadow) { // if it is open, close it to stop people stealing our secrets!
ShadowRoot - Web APIs
documentorshadowroot.getselection() returns a selection object representing the range of text selected by the user, or the current position of the caret.
Slottable: assignedSlot - Web APIs
let slottedspan = document.queryselector('my-paragraph span') console.log(slottedspan.assignedslot); // logs '<slot name="my-text">' specifications specification status comment domthe definition of 'assignedslot' in that specification.
SourceBuffer - Web APIs
this example was written by nick desaulniers and can be viewed live here (you can also download the source for further investigation.) var video = document.queryselector('video'); var asseturl = 'frag_bunny.mp4'; // need to be specific for blink regarding codecs // ./mp4info frag_bunny.mp4 | grep codec var mimecodec = 'video/mp4; codecs="avc1.42e01e, mp4a.40.2"'; if ('mediasource' in window && mediasource.istypesupported(mimecodec)) { var mediasource = new mediasource(); //console.log(mediasource.readystate); // closed video.src = url.createobjecturl(me...
SpeechRecognition.abort() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.queryselector('.output'); var bg = document.queryselector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specifica...
SpeechRecognition.start() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.queryselector('.output'); var bg = document.queryselector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specifica...
SpeechRecognition.stop() - Web APIs
| navy | olive | orange | orchid | peru | pink | plum | purple | red | salmon | sienna | silver | snow | tan | teal | thistle | tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; var diagnostic = document.queryselector('.output'); var bg = document.queryselector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } abortbtn.onclick = function() { recognition.abort(); console.log('speech recognition aborted.'); } recognition.onspeechend = function() { recognition.stop(); console.log('speech recognition has stopped.'); } specifica...
SpeechRecognition - Web APIs
tomato | turquoise | violet | white | yellow ;' var recognition = new speechrecognition(); var speechrecognitionlist = new speechgrammarlist(); speechrecognitionlist.addfromstring(grammar, 1); recognition.grammars = speechrecognitionlist; recognition.continuous = false; recognition.lang = 'en-us'; recognition.interimresults = false; recognition.maxalternatives = 1; var diagnostic = document.queryselector('.output'); var bg = document.queryselector('html'); document.body.onclick = function() { recognition.start(); console.log('ready to receive a color command.'); } recognition.onresult = function(event) { var color = event.results[0][0].transcript; diagnostic.textcontent = 'result received: ' + color; bg.style.backgroundcolor = color; } specifications specification stat...
SpeechSynthesis.getVoices() - Web APIs
getvoices(); for(var i = 0; i < voices.length; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); document.getelementbyid("voiceselect").appendchild(option); } } populatevoicelist(); if (typeof speechsynthesis !== 'undefined' && speechsynthesis.onvoiceschanged !== undefined) { speechsynthesis.onvoiceschanged = populatevoicelist; } html <select id="voiceselect"></select> specifications specification status comment web speech apithe definition of 'getvoices()' in that specification.
SpeechSynthesis.onvoiceschanged - Web APIs
celist() { voices = synth.getvoices(); for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } } populatevoicelist(); if (speechsynthesis.onvoiceschanged !== undefined) { speechsynthesis.onvoiceschanged = populatevoicelist; } specifications specification status comment web speech apithe definition of 'onvoiceschanged' in that specification.
SpeechSynthesis.speak() - Web APIs
inputform.onsubmit = function(event) { event.preventdefault(); var utterthis = new speechsynthesisutterance(inputtxt.value); var selectedoption = voiceselect.selectedoptions[0].getattribute('data-name'); for(i = 0; i < voices.length ; i++) { if(voices[i].name === selectedoption) { utterthis.voice = voices[i]; } } synth.speak(utterthis); inputtxt.blur(); } specifications specification status comment web speech apithe definition of 'speak()' in that specification.
SpeechSynthesisVoice.default - Web APIs
examples for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } specifications specification status comment web speech apithe definition of 'default' in that specification.
SpeechSynthesisVoice.lang - Web APIs
examples for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } specifications specification status comment web speech apithe definition of 'lang' in that specification.
SpeechSynthesisVoice.localService - Web APIs
examples for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } console.log(voices[i].localservice); option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } specifications specification status comment web speech apithe definition of 'localservice' in that specification.
SpeechSynthesisVoice.name - Web APIs
examples for(i = 0; i < voices.length ; i++) { var option = document.createelement('option'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } specifications specification status comment web speech apithe definition of 'name' in that specification.
SpeechSynthesisVoice.voiceURI - Web APIs
ption'); option.textcontent = voices[i].name + ' (' + voices[i].lang + ')'; if(voices[i].default) { option.textcontent += ' -- default'; } console.log(voices[i].voiceuri); // on mac, this returns urns, for example 'urn:moz-tts:osx:com.apple.speech.synthesis.voice.daniel' option.setattribute('data-lang', voices[i].lang); option.setattribute('data-name', voices[i].name); voiceselect.appendchild(option); } specifications specification status comment web speech apithe definition of 'voiceuri' in that specification.
StereoPannerNode.pan - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.queryselector('audio'); var pancontrol = document.queryselector('.panning-control'); var panvalue = document.queryselector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler functi...
StereoPannerNode - Web APIs
var audioctx = new (window.audiocontext || window.webkitaudiocontext)(); var myaudio = document.queryselector('audio'); var pancontrol = document.queryselector('.panning-control'); var panvalue = document.queryselector('.panning-value'); pre.innerhtml = myscript.innerhtml; // create a mediaelementaudiosourcenode // feed the htmlmediaelement into it var source = audioctx.createmediaelementsource(myaudio); // create a stereo panner var pannode = audioctx.createstereopanner(); // event handler functi...
Storage API - Web APIs
this includes scenarios such as the user selecting a "clear caches" or "clear recent history" option.
StylePropertyMapReadOnly.get() - Web APIs
// get the element const myelement = document.queryselector('a'); // get the <dl> we'll be populating const styleslist = document.queryselector('#regurgitation'); // retrieve all computed styles with computedstylemap() const stylemap = myelement.computedstylemap(); // array of properties we're interested in const ofinterest = ['font-weight', 'border-left-color', 'color', '--colour']; // iterate thru our properties of interest for ( let i = 0; i < of...
StylePropertyMapReadOnly - Web APIs
// get the element const myelement = document.queryselector('p'); // get the <dl> we'll be populating const styleslist = document.queryselector('#output'); // retrieve all computed styles with computedstylemap() const stylepropertymap = myelement.computedstylemap(); // iterate thru the map of all the properties and values, adding a <dt> and <dd> for each for (const [prop, val] of stylepropertymap) { // properties const cssproperty = document.create...
SubmitEvent() - Web APIs
const form = document.queryselector("form"); const formtrigger = form.queryselector("button.submit"); const submitevent = new submitevent("submit", { submitter: formtrigger }); form.dispatchevent(submitevent); this is a somewhat contrived example, as you can do nearly all of this much more easily, but this gives you deep control over the process that can be useful.
SubmitEvent.submitter - Web APIs
let form = document.queryselector("form"); form.addeventlistener("submit", (event) => { let submitter = event.submitter; let handler = submitter.id; if (handler) { processorder(form, handler); } else { showalertmessage("an unknown or unaccepted payment type was selected.
SubmitEvent - Web APIs
let form = document.queryselector("form"); form.addeventlistener("submit", (event) => { let submitter = event.submitter; let handler = submitter.id; if (handler) { processorder(form, handler); } else { showalertmessage("an unknown or unaccepted payment type was selected.
SubtleCrypto.unwrapKey() - Web APIs
*/ let signingkey; const signbutton = document.queryselector(".pkcs8 .sign-button"); /* convert an array of byte values to an arraybuffer.
Text.splitText() - Web APIs
WebAPITextsplitText
html <p>foobar</p> javascript const p = document.queryselector('p'); // get contents of <p> as a text node const foobar = p.firstchild; // split 'foobar' into two text nodes, 'foo' and 'bar', // and save 'bar' as a const const bar = foobar.splittext(3); // create a <u> element containing ' new content ' const u = document.createelement('u'); u.appendchild(document.createtextnode(' new content ')); // add <u> before 'bar' p.insertbefore(u, bar); // the...
TextEncoder.prototype.encode() - Web APIs
examples <p class="source">this is a sample paragraph.</p> <p class="result">encoded result: </p> const sourcepara = document.queryselector('.source'); const resultpara = document.queryselector('.result'); const string = sourcepara.textcontent; const textencoder = new textencoder(); let encoded = textencoder.encode(string); resultpara.textcontent += encoded; specifications specification status comment encodingthe definition of 'textencoder.prototype.encode()' in that specification.
TextEncoder.prototype.encodeInto() - Web APIs
u8array.subarray(position|0) : u8array); if (stats.written < u8array.length) u8array[stats.written] = 0; // append null if room return stats; } examples <p class="source">this is a sample paragraph.</p> <p class="result"></p> const sourcepara = document.queryselector('.source'); const resultpara = document.queryselector('.result'); const string = sourcepara.textcontent; const textencoder = new textencoder(); const utf8 = new uint8array(string.length); let encodedresults = textencoder.encodeinto(string, utf8); resultpara.textcontent += 'bytes read: ' + encodedresults.read + ' | bytes written: ' + encodedresults.written + ...
TextTrack.mode - Web APIs
WebAPITextTrackmode
window.addeventlistener("load", event => { let trackelem = document.queryselector("track"); let track = trackelem.track; track.mode = "showing"; for (let index=0; index < track.cues.length; index++) { let cue = track.cues[index]; cue.pauseonexit = true; }; }); specifications specification status comment html living standardthe definition of 'mode' in that specification.
TextTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const mediaelement = document.queryselector('video, audio'); mediaelement.texttracks.addeventlistener('addtrack', (event) => { console.log(`text track: ${event.track.label} added`); }); using the onaddtrack event handler property: const mediaelement = document.queryselector('video, audio'); mediaelement.texttracks.onaddtrack = (event) => { console.log(`text track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
TextTrackList: change event - Web APIs
bubbles no cancelable no interface event event handler property onchange examples using addeventlistener(): const mediaelement = document.queryselectorall('video, audio')[0]; mediaelement.texttracks.addeventlistener('change', (event) => { console.log(`'${event.type}' event fired`); }); using the onchange event handler property: const mediaelement = document.queryselector('video, audio'); mediaelement.texttracks.onchange = (event) => { console.log(`'${event.type}' event fired`); }; specifications specification status html living standardthe definition of 'change' in that specification.
TextTrackList.onaddtrack - Web APIs
document.queryselector("video").texttracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'texttracklist: onaddtrack' in that specification.
TextTrackList.onchange - Web APIs
var tracklist = document.queryselector("video, audio").texttracks; tracklist.onchange = function(event) { ....
TextTrackList.onremovetrack - Web APIs
document.queryselectorall("video, audio")[0].texttracks.onremovetrack = function(event) { mytrackcount = document.queryselectorall("video, audio")[0].texttracks.length; }; the current number of text tracks remaining in the media element is obtained from texttracklist property length.
TextTrackList: removeTrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const mediaelement = document.queryselector('video, audio'); mediaelement.texttracks.addeventlistener('removetrack', (event) => { console.log(`text track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const mediaelement = document.queryselector('video, audio'); mediaelement.texttracks.onremovetrack = (event) => { console.log(`text track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specificatio...
TextTrackList - Web APIs
var texttracks = document.queryselector("video").texttracks; monitoring track count changes in this example, we have an app that displays information about the number of channels available.
Touch events - Web APIs
selecting a color for each touch to make each touch's drawing look different, the colorfortouch() function is used to pick a color based on the touch's unique identifier.
TrackEvent - Web APIs
var videoelem = document.queryselector("video"); videoelem.videotracks.addeventlistener("addtrack", handletrackevent, false); videoelem.videotracks.addeventlistener("removetrack", handletrackevent, false); videoelem.audiotracks.addeventlistener("addtrack", handletrackevent, false); videoelem.audiotracks.addeventlistener("removetrack", handletrackevent, false); videoelem.texttracks.addeventlistener("addtrack", handletrackevent, fals...
TreeWalker - Web APIs
treewalker.filter read only returns a nodefilter used to select the relevant nodes.
USBDevice.claimInterface() - Web APIs
async function connectdevice(usbdevice) { await usbdevice.open(); if (usbdevice.configuration === null) await usbdevice.selectconfiguration(1); await usbdevice.claiminterface(0); } specifications specification status comment webusbthe definition of 'claiminterface()' in that specification.
VRStageParameters - Web APIs
examples var info = document.queryselector('p'); var vrdisplay; navigator.getvrdisplays().then(function(displays) { vrdisplay = displays[0]; var stageparams = vrdisplay.stageparameters; // stageparams is a vrstageparameters object if(stageparams === null) { info.textcontent = 'your vr hardware does not support room-scale experiences.' } else { info.innerhtml = '<strong>display stage parameters</strong>' ...
VTTCue - Web APIs
WebAPIVTTCue
example html <video controls src="https://udn.realityripple.com/samples/c6/f8a3489533.webm"></video> css video { width: 320px; height: 180px; } javascript let video = document.queryselector('video'); video.addeventlistener('loadedmetadata', () => { const track = video.addtexttrack("captions", "简体中文subtitles", "zh_cn"); track.mode = "showing"; const cuecn = new vttcue(0, 2.500, '字幕会在0至2.5秒间显示'); track.addcue(cuecn); const cueen = new vttcue(2.6, 4, 'subtitles will display between 2.6 and 4 seconds'); track.addcue(cueen); }); result chro...
validityState.tooShort - Web APIs
the read-only tooshort property of a validitystate object indicates if the value of an <input>, <button>, <select>, <output>, <fieldset> or <textarea>, after having been edited by the user, is less than the minimum code-unit length established by the element's minlength attribute.
VideoTrack.label - Web APIs
WebAPIVideoTracklabel
example this example returns an array of track kinds and labels for potential use in a user interface to select video tracks for a specified media element.
VideoTrackList: addtrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onaddtrack examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.videotracks.addeventlistener('addtrack', (event) => { console.log(`video track: ${event.track.label} added`); }); using the onaddtrack event handler property: const videoelement = document.queryselector('video'); videoelement.videotracks.onaddtrack = (event) => { console.log(`video track: ${event.track.label} added`); }; specifications specification status html living standardthe definition of 'addtrack' in that specification.
VideoTrackList.onaddtrack - Web APIs
document.queryselector("video").videotracks.onaddtrack = function(event) { addtotracklist(event.track); }; specifications specification status comment html living standardthe definition of 'videotracklist: onaddtrack' in that specification.
VideoTrackList.onremovetrack - Web APIs
document.queryselector("my-video").videotracks.onremovetrack = function(event) { mytrackcount = document.queryselector("my-video").videotracks.length; }; the current number of video tracks remaining in the media element is obtained from videotracklist property length.
VideoTrackList: removetrack event - Web APIs
bubbles no cancelable no interface trackevent event handler property onremovetrack examples using addeventlistener(): const videoelement = document.queryselector('video'); videoelement.videotracks.addeventlistener('removetrack', (event) => { console.log(`video track: ${event.track.label} removed`); }); using the onremovetrack event handler property: const videoelement = document.queryselector('video'); videoelement.videotracks.onremovetrack = (event) => { console.log(`video track: ${event.track.label} removed`); }; specifications specification status html living standardthe definition of 'removetrack' in that specification.
WebGL2RenderingContext.readBuffer() - Web APIs
the webgl2renderingcontext.readbuffer() method of the webgl 2 api selects a color buffer as the source for pixels for subsequent calls to copyteximage2d, copytexsubimage2d, copytexsubimage3d or readpixels.
WebGL2RenderingContext - Web APIs
webgl2renderingcontext.invalidatesubframebuffer() invalidates portions of the contents of attachments in a framebuffer webgl2renderingcontext.readbuffer() selects a color buffer as the source for pixels.
WebGLRenderingContext.activeTexture() - Web APIs
examples the following call selects gl.texture1 as the current texture.
WebGLRenderingContext.isContextLost() - Web APIs
examples include: two or more pages are using the gpu, but together place too high a demand on the gpu, so the browser tells the two contexts that they've lost the connection, then selects one of the two to restore access for.
WebGLRenderingContext.makeXRCompatible() - Web APIs
javascript the code that handles starting up graphics, switching to vr mode, and so forth looks like this: const outputcanvas = document.queryselector(".output-canvas"); const gl = outputcanvas.getcontext("webgl"); let xrsession = null; let usingxr = false; let currentscene = "scene1"; let glstartbutton; let xrstartbutton; window.addeventlistener("load", (event) => { loadsceneresources(currentscene); glstartbutton.addeventlistener("click", handlestartbuttonclick); xrstartbutton.addeventlistener("click", handlestartbuttonclick); }); o...
Basic scissoring - Web APIs
ser does not seem to support html5 canvas.</canvas> body { text-align : center; } canvas { display : block; width : 280px; height : 210px; margin : auto; padding : 0; border : none; background-color : black; } window.addeventlistener("load", function setupwebgl (evt) { "use strict" window.removeeventlistener(evt.type, setupwebgl, false); var paragraph = document.queryselector("p"); var canvas = document.queryselector("canvas"); // the following two lines set the size (in css pixels) of // the drawing buffer to be identical to the size of the // canvas html element, as determined by css.
Boilerplate 1 - Web APIs
r does not seem to support html5 canvas.</canvas> css body { text-align : center; } canvas { display : block; width : 280px; height : 210px; margin : auto; padding : 0; border : none; background-color : black; } button { display : block; font-size : inherit; margin : auto; padding : 0.6em; } javascript function getrenderingcontext() { var canvas = document.queryselector("canvas"); canvas.width = canvas.clientwidth; canvas.height = canvas.clientheight; var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { var paragraph = document.queryselector("p"); paragraph.innerhtml = "failed to get webgl context." + "your browser or device may not support webgl."; return null; } gl.viewport(0, 0, gl.
Canvas size and WebGL - Web APIs
firstcanvas = document.getelementsbytagname("canvas")[0], secondcanvas = document.getelementsbytagname("canvas")[1]; firstcanvas.width = firstcanvas.clientwidth; firstcanvas.height = firstcanvas.clientheight; [firstcanvas, secondcanvas].foreach(function(canvas) { var gl = canvas.getcontext("webgl") || canvas.getcontext("experimental-webgl"); if (!gl) { document.queryselector("p").innerhtml = "failed to get webgl context.
Clearing by clicking - Web APIs
var canvas = document.queryselector("#canvas-view"); var button = document.queryselector("#color-switcher"); canvas.addeventlistener("click", switchcolor, false); button.addeventlistener("click", switchcolor, false); // a variable to hold the webglrenderingcontext.
Clearing with colors - Web APIs
var paragraph = document.queryselector("p"), canvas = document.queryselector("canvas"); // getting the webgl rendering context.
Detect WebGL - Web APIs
window.addeventlistener("load", function() { var paragraph = document.queryselector("p"), button = document.queryselector("button"); // adding click event handler to button.
Simple color animation - Web APIs
var button = document.queryselector("#animation-onoff"); var verb = document.queryselector("strong"); function startanimation(evt) { button.removeeventlistener(evt.type, startanimation, false); button.addeventlistener("click", stopanimation, false); verb.innerhtml="stop"; // setup animation loop by redrawing every second.
Adding 2D content to a WebGL context - Web APIs
const positionbuffer = gl.createbuffer(); // select the positionbuffer as the one to apply buffer // operations to from here out.
Getting started with WebGL - Web APIs
// // start here // function main() { const canvas = document.queryselector("#glcanvas"); // initialize the gl context const gl = canvas.getcontext("webgl"); // only continue if webgl is available and working if (gl === null) { alert("unable to initialize webgl.
Lifetime of a WebRTC session - Web APIs
the answer is simple: since the two devices have no way to directly contact each other, and the specification can’t predict every possible use case for webrtc, it makes more sense to let the developer select an appropriate networking technology and messaging protocol.
WebRTC Statistics API - Web APIs
err); } function getconnectionstats() { mypeerconnection.getstats(null).then(stats => { var statsoutput = ""; stats.foreach(report => { if (report.type === "inbound-rtp" && report.kind === "video") { object.keys(report).foreach(statname => { statsoutput += `<strong>${statname}:</strong> ${report[statname]}<br>\n`; }); } }); document.queryselector(".stats-box").innerhtml = statsoutput; }); } when the promise returned by getstats() is fulfilled, the resolution handler receives as input an rtcstatsreport object containing the statistics information.
WebSocket.extensions - Web APIs
the websocket.extensions read-only property returns the extensions selected by the server.
WebSocket.protocol - Web APIs
the websocket.protocol read-only property returns the name of the sub-protocol the server selected; this will be one of the strings specified in the protocols parameter when creating the websocket object, or the empty string if no connection is established.
Writing WebSocket client applications - Web APIs
if you want to open a connection and are flexible about the protocols you support, you can specify an array of protocols: var examplesocket = new websocket("wss://www.example.com/socketserver", ["protocolone", "protocoltwo"]); once the connection is established (that is, readystate is open), examplesocket.protocol will tell you which protocol the server selected.
Writing a WebSocket server in C# - Web APIs
> <style> textarea { vertical-align: bottom; } #output { overflow: auto; } #output > p { overflow-wrap: break-word; } #output span { color: blue; } #output span.error { color: red; } </style> <h2>websocket test</h2> <textarea cols=60 rows=6></textarea> <button>send</button> <div id=output></div> <script> // http://www.websocket.org/echo.html var button = document.queryselector("button"), output = document.queryselector("#output"), textarea = document.queryselector("textarea"), // wsuri = "ws://echo.websocket.org/", wsuri = "ws://127.0.0.1/", websocket = new websocket(wsuri); button.addeventlistener("click", onclickbutton); websocket.onopen = function (e) { writetoscreen("connected"); dosend("websocket ...
Web Video Text Tracks Format (WebVTT) - Web APIs
the type of pseudo class is determined by the selector it is using and working is similar in nature as it works in html.
Using bounded reference spaces - Web APIs
if it does, it likely has a system in place to allow the user to specify or select the boundaries to apply if a bounded space is to be used.
Fundamentals of WebXR - Web APIs
in webxr, the primary select and squeeze actions are directly supported using events, while other controls are available through a special webxr-specific implementation of the gamepad object.
WebXR Device API - Web APIs
the webxr device api implements the core of the webxr feature set, managing the selection of output devices, render the 3d scene to the chosen device at the appropriate frame rate, and manage motion vectors created using input controllers.
Using IIR filters - Web APIs
// create a canvas element and append it to our dom const canvascontainer = document.queryselector('.filter-graph'); const canvasel = document.createelement('canvas'); canvascontainer.appendchild(canvasel); // set 2d context and set dimesions const canvasctx = canvasel.getcontext('2d'); const width = canvascontainer.offsetwidth; const height = canvascontainer.offsetheight; canvasel.width = width; canvasel.height = height; // set background fill canvasctx.fillstyle = 'white'; canvasctx.fill...
Web audio spatialization basics - Web APIs
finally, we'll set some bounds so our boombox doesn't move too far in any direction: const movecontrols = document.queryselector('#move-controls').queryselectorall('button'); const boombox = document.queryselector('.boombox-body'); // the values for our css transforms let transform = { xaxis: 0, yaxis: 0, zaxis: 0.8, rotatex: 0, rotatey: 0 } // set our bounds const topbound = -posy; const bottombound = posy; const rightbound = posx; const leftbound = -posx; const innerbound = 0.1; const outerbound =...
Using the Web Storage API - Web APIs
on the events page (see events.js) the only javascript is as follows: window.addeventlistener('storage', function(e) { document.queryselector('.my-key').textcontent = e.key; document.queryselector('.my-old').textcontent = e.oldvalue; document.queryselector('.my-new').textcontent = e.newvalue; document.queryselector('.my-url').textcontent = e.url; document.queryselector('.my-storage').textcontent = json.stringify(e.storagearea); }); here we add an event listener to the window object that fires when the storage object associat...
Window.captureEvents() - Web APIs
syntax window.captureevents(eventtype) eventtype is a combination of the following values: event.abort, event.blur, event.click, event.change, event.dblclick, event.dragddrop, event.error, event.focus, event.keydown, event.keypress, event.keyup, event.load, event.mousedown, event.mousemove, event.mouseout, event.mouseover, event.mouseup, event.move, event.reset, event.resize, event.select, event.submit, event.unload.
Window.confirm() - Web APIs
WebAPIWindowconfirm
return value a boolean indicating whether ok (true) or cancel (false) was selected.
Window.content - Web APIs
WebAPIWindowcontent
in unprivileged content (webpages), content is normally equivalent to top (except in the case of a webpage loaded in a sidebar, content still refers to the window of the currently selected tab).
Window.devicePixelRatio - Web APIs
let pixelratiobox = document.queryselector(".pixel-ratio"); let mqstring = `(resolution: ${window.devicepixelratio}dppx)`; const updatepixelratio = () => { let pr = window.devicepixelratio; let prstring = (pr * 100).tofixed(0); pixelratiobox.innertext = `${prstring}% (${pr.tofixed(2)})`; } updatepixelratio(); matchmedia(mqstring).addlistener(updatepixelratio); the string mqstring is set up to be the media query itself.
Window: error event - Web APIs
css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } button { height: 2rem; margin: .5rem; } img { width: 0; height: 0; } js const log = document.queryselector('.event-log-contents'); window.addeventlistener('error', (event) => { log.textcontent = log.textcontent + `${event.type}: ${event.message}\n`; console.log(event) }); const scripterror = document.queryselector('#script-error'); scripterror.addeventlistener('click', () => { const badcode = 'const s;'; eval(badcode); }); result specifications specification statu...
Window.find() - Web APIs
WebAPIWindowfind
" + window.find(text)); } html <p>apples, bananas, and oranges.</p> <button type="button" onclick='findstring("apples")'>search for apples</button> <button type="button" onclick='findstring("banana")'>search for banana</button> <button type="button" onclick='findstring("orange")'>search for orange</button> result notes in some browsers, window.find() selects (highlights) the found content on the site.
Window: load event - Web APIs
WebAPIWindowload event
g-contents" rows="8" cols="30"></textarea> </div> css body { display: grid; grid-template-areas: "control log"; } .controls { grid-area: control; display: flex; align-items: center; justify-content: center; } .event-log { grid-area: log; } .event-log-contents { resize: none; } label, button { display: block; } #reload { height: 2rem; } js const log = document.queryselector('.event-log-contents'); const reload = document.queryselector('#reload'); reload.addeventlistener('click', () => { log.textcontent =''; window.settimeout(() => { window.location.reload(true); }, 200); }); window.addeventlistener('load', (event) => { log.textcontent = log.textcontent + 'load\n'; }); document.addeventlistener('readystatechange', (event) => { log.textcontent...
Window.matchMedia() - Web APIs
WebAPIWindowmatchMedia
javascript let mql = window.matchmedia('(max-width: 600px)'); document.queryselector(".mq-value").innertext = mql.matches; the javascript code simply passes the media query to match into matchmedia() to compile it, then sets the <span>'s innertext to the value of the results' matches property, so that it indicates whether or not the document matches the media query at the moment the page was loaded.
Window: message event - Web APIs
bubbles no cancelable no interface messageevent event handler property onmessage examples suppose a script sends a message to a different browsing context, such as another <iframe>, using code like this: const targetframe = window.top.frames[1]; const targetorigin = 'https://example.org'; const windowmessagebutton = document.queryselector('#window-message'); windowmessagebutton.addeventlistener('click', () => { targetframe.postmessage('hello there', targetorigin); }); the receiver can listen for the message using addeventlistener() with code like this: window.addeventlistener('message', (event) => { console.log(`received message: ${event.data}`); }); alternatively the listener could use the onmessage event handler pr...
Window.openDialog() - Web APIs
WebAPIWindowopenDialog
if the features parameter is a zero-length string, or contains only one or more of the behavior features (chrome, dependent, dialog and modal) the chrome features are assumed "os' choice." that is, window creation code is not given specific instructions, but is instead allowed to select the chrome that best fits a dialog on that operating system.
Window.releaseEvents() - Web APIs
syntax window.releaseevents(eventtype) eventtype is a combination of the following values: event.abort, event.blur, event.click, event.change, event.dblclick, event.dragddrop, event.error, event.focus, event.keydown, event.keypress, event.keyup, event.load, event.mousedown, event.mousemove, event.mouseout, event.mouseover, event.mouseup, event.move, event.reset, event.resize, event.select, event.submit, event.unload.
Window: resize event - Web APIs
<p>resize the browser window to fire the <code>resize</code> event.</p> <p>window height: <span id="height"></span></p> <p>window width: <span id="width"></span></p> const heightoutput = document.queryselector('#height'); const widthoutput = document.queryselector('#width'); function reportwindowsize() { heightoutput.textcontent = window.innerheight; widthoutput.textcontent = window.innerwidth; } window.onresize = reportwindowsize; addeventlistener equivalent you could set up the event handler using the addeventlistener() method: window.addeventlistener('resize', reportwindowsize); specif...
Window.updateCommands() - Web APIs
notes this enables or disables items (setting or clearing the "disabled" attribute on the command node as appropriate), or ensures that the command state reflects the state of the selection by setting current state information in the "state" attribute of the xul command nodes.
WindowClient - Web APIs
the service worker client independently selects and uses a service worker for its own loading and sub-resources.
Worker - Web APIs
WebAPIWorker
example the following code snippet creates a worker object using the worker() constructor, then uses the worker object: var myworker = new worker('/worker.js'); var first = document.queryselector('input#number1'); var second = document.queryselector('input#number2'); first.onchange = function() { myworker.postmessage([first.value, second.value]); console.log('message posted to worker'); } for a full example, see ourbasic dedicated worker example (run dedicated worker).
WorkerNavigator.connection - Web APIs
this could be used to select high definition content or low definition content based on the user's connection.
WritableStream.WritableStream() - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStream.getWriter() - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStream - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStreamDefaultWriter.WritableStreamDefaultWriter() - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStreamDefaultWriter.close() - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStreamDefaultWriter.write() - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); }) ...
WritableStreamDefaultWriter - Web APIs
const list = document.queryselector('ul'); function sendmessage(message, writablestream) { // defaultwriter is of type writablestreamdefaultwriter const defaultwriter = writablestream.getwriter(); const encoder = new textencoder(); const encoded = encoder.encode(message, { stream: true }); encoded.foreach((chunk) => { defaultwriter.ready .then(() => { return defaultwriter.write(chunk); ...
XMLHttpRequest: abort event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XMLHttpRequest: error event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XMLHttpRequest: load event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XMLHttpRequest: loadend event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XMLHttpRequest: loadstart event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XMLHttpRequest: progress event - Web APIs
click to start xhr (error)" /> <input class="xhr abort" type="button" name="xhr" value="click to start xhr (abort)" /> </div> <textarea readonly class="event-log"></textarea> css .event-log { width: 25rem; height: 4rem; border: 1px solid black; margin: .5rem; padding: .2rem; } input { width: 11rem; margin: .5rem; } js const xhrbuttonsuccess = document.queryselector('.xhr.success'); const xhrbuttonerror = document.queryselector('.xhr.error'); const xhrbuttonabort = document.queryselector('.xhr.abort'); const log = document.queryselector('.event-log'); function handleevent(e) { log.textcontent = log.textcontent + `${e.type}: ${e.loaded} bytes transferred\n`; } function addlisteners(xhr) { xhr.addeventlistener('loadstart', handleevent); xhr.add...
XPathEvaluator.createExpression() - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator.createexpression()' in that specification.
XPathEvaluator.evaluate() - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var evaluator = new xpathevaluator(); var result = evaluator.evaluate("//div", document, null, xpathresult.ordered_node_snapshot_type); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator.evaluate()' in that specification.
XPathEvaluator - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathevaluator' in that specification.
XPathExpression.evaluate() - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression("//div"); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathexpression.evaluate()' in that specification.
XPathExpression - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var xpath = "//div"; var evaluator = new xpathevaluator(); var expression = evaluator.createexpression(xpath); var result = expression.evaluate(document, xpathresult.ordered_node_snapshot_type); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathexpression' in that specification.
XPathResult.booleanValue - Web APIs
html <div>xpath example</div> <p>text is 'xpath example': <output></output></p> javascript var xpath = "//div/text() = 'xpath example'"; var result = document.evaluate(xpath, document, null, xpathresult.boolean_type, null); document.queryselector("output").textcontent = result.booleanvalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.booleanvalue' in that specification.
XPathResult.invalidIteratorState - Web APIs
html <div>xpath example</div> <p>iterator state: <output></output></p> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); // invalidates the iterator state document.queryselector("div").remove(); document.queryselector("output").textcontent = result.invaliditeratorstate ?
XPathResult.iterateNext() - Web APIs
html <div>xpath example</div> <div>tag names of the matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); var node = null; var tagnames = []; while(node = result.iteratenext()) { tagnames.push(node.localname); } document.queryselector("output").textcontent = tagnames.join(", "); result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.iteratenext()' in that specification.
XPathResult.numberValue - Web APIs
html <div>xpath example</div> <div>number of &lt;div&gt;s: <output></output></div> javascript var xpath = "count(//div)"; var result = document.evaluate(xpath, document, null, xpathresult.number_type, null); document.queryselector("output").textcontent = result.numbervalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.numbervalue' in that specification.
XPathResult.resultType - Web APIs
html <div>xpath example</div> <div>is xpath result a node set: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.any_type, null); document.queryselector("output").textcontent = result.resulttype >= xpathresult.unordered_node_iterator_type && result.resulttype <= xpathresult.first_ordered_node_type; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.resulttype' in that specification.
XPathResult.singleNodeValue - Web APIs
html <div>xpath example</div> <div>tag name of the element having the text content 'xpath example': <output></output></div> javascript var xpath = "//*[text()='xpath example']"; var result = document.evaluate(xpath, document, null, xpathresult.first_ordered_node_type, null); document.queryselector("output").textcontent = result.singlenodevalue.localname; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.singlenodevalue' in that specification.
XPathResult.snapshotItem() - Web APIs
html <div>xpath example</div> <div>tag names of the matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.ordered_node_snapshot_type, null); var node = null; var tagnames = []; for(var i = 0; i < result.snapshotlength; i++) { var node = result.snapshotitem(i); tagnames.push(node.localname); } document.queryselector("output").textcontent = tagnames.join(", "); result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.snapshotitem()' in that specification.
XPathResult.snapshotLength - Web APIs
html <div>xpath example</div> <div>number of matched nodes: <output></output></div> javascript var xpath = "//div"; var result = document.evaluate(xpath, document, null, xpathresult.ordered_node_snapshot_type, null); document.queryselector("output").textcontent = result.snapshotlength; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.snapshotlength' in that specification.
XPathResult.stringValue - Web APIs
html <div>xpath example</div> <div>text content of the &lt;div&gt; above: <output></output></div> javascript var xpath = "//div/text()"; var result = document.evaluate(xpath, document, null, xpathresult.string_type, null); document.queryselector("output").textcontent = result.stringvalue; result specifications specification status comment document object model (dom) level 3 xpath specificationthe definition of 'xpathresult.stringvalue' in that specification.
XRReferenceSpace - Web APIs
the tracking behavior is defined by the selected reference space type.
XRRenderState.baseLayer - Web APIs
examples you can set the xrwebgllayer used for rendering by calling updaterenderstate(), like this: let canvas = document.queryselector("canvas"); gl = canvas.getcontext("webgl", { xrcompatible: true }); setnewwebgllayer(); function setnewwebgllayer(gl) { if (!gl) { /* webgl not available */ return; } xrsession.updaterenderstate({ baselayer: new xrwebgllayer(xrsession, gl); }); }; here, the canvas obtained in the first line is the canvas into which webgl is going to draw.
XRWebGLLayer() - Web APIs
the browser selects the anti-aliasing method to use; there is no support for requesting a specific mode yet.
XRWebGLLayerInit - Web APIs
the browser selects the anti-aliasing method to use; there is no support for requesting a specific mode yet.
XSLT Basic Example - Web APIs
bar</author> </authors> <body>this is my article text.</body> </article> xsl stylesheet (example.xsl) : <?xml version="1.0"?> <xsl:stylesheet version="1.0" xmlns:xsl="http://www.w3.org/1999/xsl/transform"> <xsl:output method="text"/> <xsl:template match="/"> article - <xsl:value-of select="/article/title"/> authors: <xsl:apply-templates select="/article/authors/author"/> </xsl:template> <xsl:template match="author"> - <xsl:value-of select="." /> </xsl:template> </xsl:stylesheet> browser output : article - my article authors: - mr.
Introduction - Web APIs
xsl (extensible stylesheet language) transformations are composed of two parts: xsl elements, which allow the transformation of an xml tree into another markup tree and xpath, a selection language for trees.
Using the alert role - Accessibility
the pseudo code snippet below illustrates this approach: <p id="forminstruction">you must select at least 3 options</p> // when the user tries to submit the form with less than 3 checkboxes selected: document.getelementbyid("forminstruction").setattribute("role", "alert"); example 4: making an element with an alert role visible if an element already has role="alert" and is initially hidden using css, making it visible will cause the alert to fire as if it was just added to the page.
Using the aria-valuetext attribute - Accessibility
examples example 1: the snippet below shows a simple slider for selecting a day of the week.
Using the link role - Accessibility
-href="https://mozilla.org" tabindex="0" id="link1" role="link" class="link"> fake accessible link created using a span </span> <p><a href="https://mozilla.org" target="_blank">actual real link</a></p> css span[role="link"] { color: blue; text-decoration: underline; cursor: pointer; } span[role="link"]:focus { outline: 1px dotted black; } javascript const spanelem = document.queryselector('span'); //handles clicks and keydowns on the link function navigatelink(e) { if (e.type === 'click' || e.key === 'enter') { let ref = e.target != null ?
x-ms-aria-flowfrom - Accessibility
syntax x-ms-aria-flowfrom="elementid"; value the x-ms-aria-flowfrom property value uses an id selector to define which previous element the reading order will flow from.
Using ARIA: Roles, states, and properties - Accessibility
contentinfo form main navigation region search live region roles alert log marquee status timer window roles alertdialog dialog states and properties widget attributes aria-autocomplete aria-checked aria-current aria-disabled aria-errormessage aria-expanded aria-haspopup aria-hidden aria-invalid aria-label aria-level aria-modal aria-multiline aria-multiselectable aria-orientation aria-placeholder aria-pressed aria-readonly aria-required aria-selected aria-sort aria-valuemax aria-valuemin aria-valuenow aria-valuetext live region attributes aria-live aria-relevant aria-atomic aria-busy drag & drop attributes aria-dropeffect aria-dragged relationship attributes aria-activedescendant aria-colcount aria-colindex aria-...
ARIA: tabpanel role - Accessibility
<div role="tablist"> <div role="tab" aria-selected="true" aria-controls="tabpanel-id" id="tab-id" tabindex="0">tab label</div> accessibility concerns optionally, warn of any potential accessibility concerns that exist with using this property, and how to work around them.
ARIA: alert role - Accessibility
<button type="button" onclick="triggeralert">trigger alert</button> <p class="alert">the alert will trigger when the button is pressed.</p> function triggeralert() { var alertel = document.queryselector('.alert'); alertel.addattribute("role", "alert"); } accessibility concerns the alert role should read out content that has changed, or bring the user's attention to it immediately, so it should not be used for static content or used regularly.
Web applications and ARIA FAQ - Accessibility
though on its own aria will not change any styles, as with any html attributes, css can take advantage of aria attributes as element selectors.
Cognitive accessibility - Accessibility
examples of this are checking a checkbox, entering data or changing a select option.
Accessibility documentation index - Accessibility
68 aria: listbox role aria, accessibility, needscontent the listbox role is used for lists from which a user may select one or more items which are static and, unlike html <select> elements, may contain images.
Mobile accessibility checklist - Accessibility
however, for other custom controls state changes must be provided via aria states such as aria-checked, aria-disabled, aria-selected, aria-expanded, and aria-pressed.
Perceivable - Accessibility
1.4.8 visual presentation (aaa) for text content presentation, the following should be true: foreground and background colors should be user-selectable.
Understandable - Accessibility
suggesting alternatives when the user is choosing a user name and has selected one that is already taken), unless doing so would cause a security issue (e.g.
-moz-user-input - CSS: Cascading Style Sheets
formal definition initial valueautoapplies toall elementsinheritedyescomputed valueas specifiedanimation typediscrete formal syntax auto | none | enabled | disabled examples disabling user input for an element input.example { /* the user will be able to select the text, but not change it.
-webkit-text-stroke-color - CSS: Cascading Style Sheets
)where <alpha-value> = <number> | <percentage><hue> = <number> | <angle> examples varying the stroke color html <p>text with stroke</p> <input type="color" value="#ff0000"> css p { margin: 0; font-size: 4em; -webkit-text-stroke-width: 3px; -webkit-text-stroke-color: #ff0000; /* can be changed in the live sample */ } javascript var colorpicker = document.queryselector("input"); colorpicker.addeventlistener("change", function(evt) { document.queryselector("p").style.webkittextstrokecolor = evt.target.value; }); results specifications specification status comment compatibility standardthe definition of '-webkit-text-stroke-color' in that specification.
:-moz-broken - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-focusring - CSS: Cascading Style Sheets
this feature is not defined in any specification yet, though it was discussed in the working group and it was decided to add it to selectors 4 or 5.
:-moz-handler-blocked - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-handler-crashed - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-handler-disabled - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-loading - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-suppressed - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
:-moz-ui-invalid - CSS: Cascading Style Sheets
specifications specification status comment selectors level 4the definition of ':user-invalid' in that specification.
:-moz-user-disabled - CSS: Cascading Style Sheets
note: this selector is mainly intended to be used by theme developers.
::-moz-color-swatch - CSS: Cascading Style Sheets
the ::-moz-color-swatch css pseudo-element is a mozilla extension that represents the color selected in an <input> of type="color".
::-moz-progress-bar - CSS: Cascading Style Sheets
(the bar represents the amount of progress that has been made.) if you want to select the unfinished part of <progress> in mozilla, please select the <progress> directly.
::-moz-range-progress - CSS: Cascading Style Sheets
this portion corresponds to values lower than the value currently selected by the thumb (i.e., virtual knob).
::-webkit-file-upload-button - CSS: Cascading Style Sheets
syntax selector::-webkit-file-upload-button examples html <form> <label for="fileupload">upload file</label><br> <input type="file" id="fileupload"> </form> css input, label { display: block; } input[type=file]::-webkit-file-upload-button { border: 1px solid grey; background: #fffaaa; } below is the example for you to try.
::-webkit-meter-inner-element - CSS: Cascading Style Sheets
::-webkit-meter-inner-element is a proprietary webkit css pseudo-element for selecting and applying styles to to the outer containing element of a <meter> element.
::-webkit-scrollbar - CSS: Cascading Style Sheets
css scrollbar selectors you can use the following pseudo elements to customize various parts of the scrollbar for webkit browsers: ::-webkit-scrollbar — the entire scrollbar.
::-webkit-search-cancel-button - CSS: Cascading Style Sheets
syntax selector::-webkit-search-cancel-button specifications not part of any standard.
::-webkit-search-results-button - CSS: Cascading Style Sheets
syntax selector::-webkit-search-results-button specifications not part of any standard.
::grammar-error - CSS: Cascading Style Sheets
allowable properties only a small subset of css properties can be used in a rule with ::grammar-error in its selector: color background-color cursor caret-color outline and its longhands text-decoration and its associated properties text-emphasis-color text-shadow syntax ::grammar-error examples simple document grammar check in this example, eventual supporting browsers should highlight any flagged grammatical errors with the styles shown.
::part() - CSS: Cascading Style Sheets
WebCSS::part
; border-color: #0c0c0d33; } tabbed-custom-element::part(tab):hover:active { background-color: #0c0c0d33; } tabbed-custom-element::part(tab):focus { box-shadow: 0 0 0 1px #0a84ff inset, 0 0 0 1px #0a84ff, 0 0 0 4px rgba(10, 132, 255, 0.3); } tabbed-custom-element::part(active) { color: #0060df; border-color: #0a84ff !important; } javascript let template = document.queryselector("#tabbed-custom-element"); globalthis.customelements.define(template.id, class extends htmlelement { constructor() { super(); this.attachshadow({ mode: "open" }); this.shadowroot.appendchild(template.content); } }); result specifications specification status comment shadow partsthe definition of '::part' in that specification.
::placeholder - CSS: Cascading Style Sheets
::placeholder { color: blue; font-size: 1.5em; } only the subset of css properties that apply to the ::first-line pseudo-element can be used in a rule using ::placeholder in its selector.
::spelling-error - CSS: Cascading Style Sheets
allowable properties only a small subset of css properties can be used in a rule with ::spelling-error in its selector: color background-color cursor caret-color outline and its longhands text-decoration and its associated properties text-emphasis-color text-shadow syntax ::spelling-error examples simple document spell check in this example, eventual supporting browsers should highlight any flagged spelling errors with the styles shown.
:defined - CSS: Cascading Style Sheets
WebCSS:defined
/* selects any defined element */ :defined { font-style: italic; } /* selects any instance of a specific custom element */ simple-custom:defined { display: block; } syntax :defined examples hiding elements until they are defined the following snippets are taken from our defined-pseudo-class demo (see it live also).
:fullscreen - CSS: Cascading Style Sheets
if multiple elements have been put into full-screen mode, this selects them all.
:left - CSS: Cascading Style Sheets
WebCSS:left
/* selects any left-hand pages when printing */ @page :left { margin: 2in 3in; } whether a given page is "left" or "right" is determined by the major writing direction of the document.
:right - CSS: Cascading Style Sheets
WebCSS:right
/* selects any right-hand pages when printing */ @page :right { margin: 2in 3in; } whether a given page is "left" or "right" is determined by the major writing direction of the document.
@document - CSS: Cascading Style Sheets
WebCSS@document
@document is currently only supported in firefox; if you wanted to replicate using such functionality in your own non-firefox browser, you could try using this polyfill by @an-error94, which uses a combination of a user script, data-* attributes, and attribute selectors.
CSS Basic User Interface - CSS: Cascading Style Sheets
reference properties appearance box-sizing cursor ime-mode nav-down nav-left nav-right nav-up outline outline-width outline-style outline-color outline-offset resize text-overflow user-select guides using url values for the cursor property explains how a url can be used with the cursor property to produce custom cursors.
Using feature queries - CSS: Cascading Style Sheets
you can also use or, if one property out of a selection could match to enable the css you want to use: @supports (property1: value) or (property2: value) { css rules to apply } this can be particularly useful if a feature is vendor prefixed, as you can test for the standard property plus any vendor prefixes.
Relationship of flexbox to other layout methods - CSS: Cascading Style Sheets
you can see that as i have used a direct child selector to add the background and borders to the flex items, this has not been applied to our nested children.
Layout using named grid lines - CSS: Cascading Style Sheets
by selecting names that will make sense to you and your team you will help everyone to use the layouts you create more easily.
Overview of CSS Shapes - CSS: Cascading Style Sheets
in the example below, if you change the threshold the path that the shape takes changes based on the level of opacity you have selected.
Using media queries - CSS: Cascading Style Sheets
only the only operator is used to apply a style only if an entire query matches, and is useful for preventing older browsers from applying selected styles.
Microsoft CSS extensions - CSS: Cascading Style Sheets
e-color -ms-scrollbar-highlight-color -ms-scrollbar-shadow-color -ms-scrollbar-track-color -ms-scroll-chaining -ms-scroll-limit -ms-scroll-limit-x-max -ms-scroll-limit-x-min -ms-scroll-limit-y-max -ms-scroll-limit-y-min -ms-scroll-rails -ms-scroll-snap-points-x -ms-scroll-snap-points-y -ms-scroll-snap-x -ms-scroll-snap-y -ms-scroll-translation -ms-text-autospace -ms-touch-select -ms-wrap-flow -ms-wrap-margin -ms-wrap-through zoom pseudo-elements ::-ms-browse ::-ms-check ::-ms-clear ::-ms-expand ::-ms-fill ::-ms-fill-lower ::-ms-fill-upper ::-ms-reveal ::-ms-thumb ::-ms-ticks-after ::-ms-ticks-before ::-ms-tooltip ::-ms-track ::-ms-value media features -ms-high-contrast css-related dom apis mscontentzoomfactor msgetpropertyenabled m...
Visual formatting model - CSS: Cascading Style Sheets
in my examples, i am using a direct child selector to target the children of the container.
animation - CSS: Cascading Style Sheets
WebCSSanimation
ransform: scalex(0); } to { transform: scalex(1); } } .a1 { animation: 3s ease-in 1s 2 reverse both paused slidein; } .a2 { animation: 3s linear 1s slidein; } .a3 { animation: 3s slidein; } .animation { background: #3f87a6; width: 100%; height: calc(100% - 1.5em); transform-origin: left center; } window.addeventlistener('load', function () { var animation = array.from(document.queryselectorall('.animation')); var button = array.from(document.queryselectorall('button')); function togglebutton (btn, type) { btn.classlist.remove('play', 'pause', 'restart'); btn.classlist.add(type); btn.title = type.touppercase(type); } function playpause (i) { var btn = button[i]; var anim = animation[i]; if (btn.classlist.contains('play')) { anim.style.an...
appearance (-moz-appearance, -webkit-appearance) - CSS: Cascading Style Sheets
auto div{ color: black; -moz-appearance: auto; -webkit-appearance: auto; appearance:auto; } <div>lorem</div> none the user agent selects the appropriate special styling based on the element.
attr() - CSS: Cascading Style Sheets
WebCSSattr
the attr() css function is used to retrieve the value of an attribute of the selected element and use it in the stylesheet.
border-image-repeat - CSS: Cascading Style Sheets
t | round | space ]{1,2} examples repeating border images css #bordered { width: 12rem; margin-bottom: 1rem; padding: 1rem; border: 40px solid; border-image: url("https://mdn.mozillademos.org/files/4127/border.png") 27; border-image-repeat: stretch; /* can be changed in the live sample */ } html <div id="bordered">you can try out various border repetition rules on me!</div> <select id="repetition"> <option value="stretch">stretch</option> <option value="repeat">repeat</option> <option value="round">round</option> <option value="space">space</option> <option value="stretch repeat">stretch repeat</option> <option value="space round">space round</option> </select> javascript var repetition = document.getelementbyid("repetition"); repetition.addeventlistener("cha...
border-image-slice - CSS: Cascading Style Sheets
6/bb98f533ef.png); border-image-slice: 30; border-image-repeat: round; } li { display: flex; place-content: center; } javascript const widthslider = document.getelementbyid('width'); const sliceslider = document.getelementbyid('slice'); const widthoutput = document.getelementbyid('width-output'); const sliceoutput = document.getelementbyid('slice-output'); const divelem = document.queryselector('div > div'); widthslider.addeventlistener('input', () => { const newvalue = widthslider.value + 'px'; divelem.style.borderwidth = newvalue; widthoutput.textcontent = newvalue; }) sliceslider.addeventlistener('input', () => { const newvalue = sliceslider.value; divelem.style.borderimageslice = newvalue; sliceoutput.textcontent = newvalue; }) result specifications spe...
caret-color - CSS: Cascading Style Sheets
syntax /* keyword values */ caret-color: auto; caret-color: transparent; caret-color: currentcolor; /* <color> values */ caret-color: red; caret-color: #5729e9; caret-color: rgb(0, 200, 0); caret-color: hsla(228, 4%, 24%, 0.8); values auto the user agent selects an appropriate color for the caret.
clamp() - CSS: Cascading Style Sheets
WebCSSclamp
clamp() enables selecting a middle value within a range of values between a defined minimum and maximum.
env() - CSS: Cascading Style Sheets
WebCSSenv
as the spec evolves, it may also be usable in other places such as selectors.
font-feature-settings - CSS: Cascading Style Sheets
stylistic alternates), the value implies a particular glyph to be selected; for boolean values, it is a switch.
font-smooth - CSS: Cascading Style Sheets
auto - allow the browser to select an optimization for font smoothing, typically grayscale.
font-variant-caps - CSS: Cascading Style Sheets
when a given font includes capital letter glyphs of multiple different sizes, this property selects the most appropriate ones.
font-weight - CSS: Cascading Style Sheets
y: auto; } .sample { text-transform: uppercase; font: 1.5rem 'mutatorsans', sans-serif; } html, body { max-height: 100vh; max-width: 100vw; overflow: hidden; } body { display: flex; flex-direction: column; } header { margin-bottom: 1.5rem; } .container { flex-grow: 1; } .container > p { margin-top: 0; margin-bottom: 0; } javascript let weightlabel = document.queryselector('label[for="weight"]'); let weightinput = document.queryselector('#weight'); let sampletext = document.queryselector('.sample'); function update() { weightlabel.textcontent = `font-weight: ${weightinput.value};`; sampletext.style.fontweight = weightinput.value; } weightinput.addeventlistener('input', update); update(); accessibility concerns people experiencing low vision conditions ...
font - CSS: Cascading Style Sheets
WebCSSfont
constituent properties this property is a shorthand for the following css properties: font-family font-size font-stretch font-style font-variant font-weight line-height syntax the font property may be specified as either a single keyword, which will select a system font, or as a shorthand for various font-related properties.
grid-auto-flow - CSS: Cascading Style Sheets
formal definition initial valuerowapplies togrid containersinheritednocomputed valueas specifiedanimation typediscrete formal syntax [ row | column ] | dense examples setting grid auto-placement html <div id="grid"> <div id="item1"></div> <div id="item2"></div> <div id="item3"></div> <div id="item4"></div> <div id="item5"></div> </div> <select id="direction" onchange="changegridautoflow()"> <option value="column">column</option> <option value="row">row</option> </select> <input id="dense" type="checkbox" onchange="changegridautoflow()"> <label for="dense">dense</label> css #grid { height: 200px; width: 200px; display: grid; grid-gap: 10px; grid-template: repeat(4, 1fr) / repeat(2, 1fr); grid-auto-flow: column; /* or...
height - CSS: Cascading Style Sheets
WebCSSheight
auto the browser will calculate and select a height for the specified element.
image-orientation - CSS: Cascading Style Sheets
flip ] examples orienting image from image data css #image { image-orientation: from-image; /* can be changed in the live sample */ } html <img id="image" src="https://udn.realityripple.com/samples/db/4f9fbd7dfb.svg" alt="orientation taken from the image"> <select id="imageorientation"> <option value="from-image">from-image</option> <option value="none">none</option> </select> javascript var imageorientation = document.getelementbyid("imageorientation"); imageorientation.addeventlistener("change", function (evt) { document.getelementbyid("image").style.imageorientation = evt.target.value; }); result specifications specification ...
inherit - CSS: Cascading Style Sheets
WebCSSinherit
examples exclude selected elements from a rule /* make second-level headers green */ h2 { color: green; } /* ...but leave those in the sidebar alone so they use their parent's color */ #sidebar h2 { color: inherit; } in this example the h2 elements inside the sidebar might be different colors.
initial-letter-align - CSS: Cascading Style Sheets
values auto the user agent selects the value which corresponds to the language of the text.
<length> - CSS: Cascading Style Sheets
WebCSSlength
5); background-color: orange; display: flex; align-items: center; margin-top: 10px; } .result code { position: absolute; margin-left: 20px; } .results { margin-top: 10px; } .input-container { position: absolute; display: flex; justify-content: flex-start; align-items: center; height: 50px; } label { margin: 0 10px 0 20px; } javascript const inputdiv = document.queryselector('.inner'); const inputelem = document.queryselector('input'); const resultsdiv = document.queryselector('.results'); inputelem.addeventlistener('change', () => { inputdiv.style.width = inputelem.value; const result = document.createelement('div'); result.classname = 'result'; result.style.width = inputelem.value; result.innerhtml = `<code>width: ${inputelem.value}</code>`; results...
margin-bottom - CSS: Cascading Style Sheets
auto the browser selects a suitable value to use.
margin-top - CSS: Cascading Style Sheets
auto the browser selects a suitable value to use.
margin - CSS: Cascading Style Sheets
WebCSSmargin
auto the browser selects a suitable margin to use.
mask-composite - CSS: Cascading Style Sheets
| exclude examples compositing mask layers with addition css #masked { width: 100px; height: 100px; background-color: #8cffa0; mask-image: url(https://mdn.mozillademos.org/files/12668/mdn.svg), url(https://mdn.mozillademos.org/files/12676/star.svg); mask-size: 100% 100%; mask-composite: add; /* can be changed in the live sample */ } html <div id="masked"> </div> <select id="compositemode"> <option value="add">add</option> <option value="subtract">subtract</option> <option value="intersect">intersect</option> <option value="exclude">exclude</option> </select> javascript var clipbox = document.getelementbyid("compositemode"); clipbox.addeventlistener("change", function (evt) { document.getelementbyid("masked").style.maskcomposite = evt.target.value; }...
mask-mode - CSS: Cascading Style Sheets
WebCSSmask-mode
ation typediscrete formal syntax <masking-mode>#where <masking-mode> = alpha | luminance | match-source examples using alpha mask mode css #masked { width: 227px; height: 200px; background: blue linear-gradient(red, blue); mask-image: url(https://mdn.mozillademos.org/files/12668/mdn.svg); mask-mode: alpha; /* can be changed in the live sample */ } html <div id="masked"> </div> <select id="maskmode"> <option value="alpha">alpha</option> <option value="luminance">luminance</option> <option value="match-source">match-source</option> </select> javascript var maskmode = document.getelementbyid("maskmode"); maskmode.addeventlistener("change", function (evt) { document.getelementbyid("masked").style.maskmode = evt.target.value; }); result specifications spe...
mask-origin - CSS: Cascading Style Sheets
> = border-box | padding-box | content-box examples setting mask origin to border-box css #masked { width: 100px; height: 100px; margin: 10px; border: 10px solid blue; background-color: #8cffa0; padding: 10px; mask-image: url(https://mdn.mozillademos.org/files/12676/star.svg); mask-origin: border-box; /* can be changed in the live sample */ } html <div id="masked"> </div> <select id="origin"> <option value="content-box">content-box</option> <option value="padding-box">padding-box</option> <option value="border-box" selected>border-box</option> <option value="margin-box">margin-box</option> <option value="fill-box">fill-box</option> <option value="stroke-box">stroke-box</option> <option value="view-box">view-box</option> </select> javascript var origin = d...
mask-position - CSS: Cascading Style Sheets
r: 1px solid black; width: 250px; height: 250px; } #masked { width: 250px; height: 250px; background: blue linear-gradient(red, blue); mask-image: url(https://mdn.mozillademos.org/files/12676/star.svg); mask-repeat: no-repeat; mask-position: top right; /* can be changed in the live sample */ margin-bottom: 10px; } html <div id="wrapper"> <div id="masked"> </div> </div> <select id="maskposition"> <option value="top">top</option> <option value="center">center</option> <option value="bottom">bottom</option> <option value="top right" selected>top right</option> <option value="center center">center center</option> <option value="bottom left">bottom left</option> <option value="10px 20px">10px 20px</option> <option value="60% 20%">60% 20%</option> </select> ...
mask-repeat - CSS: Cascading Style Sheets
-x | repeat-y | [ repeat | space | round | no-repeat ]{1,2} examples setting repeat for a single mask css #masked { width: 250px; height: 250px; background: blue linear-gradient(red, blue); mask-image: url(https://mdn.mozillademos.org/files/12676/star.svg); mask-repeat: repeat; /* can be changed in the live sample */ margin-bottom: 10px; } html content <div id="masked"> </div> <select id="repetition"> <option value="repeat-x">repeat-x</option> <option value="repeat-y">repeat-y</option> <option value="repeat" selected>repeat</option> <option value="space">space</option> <option value="round">round</option> <option value="no-repeat">no-repeat</option> </select> javascript content var repetition = document.getelementbyid("repetition"); repetition.addeventlistener("...
mask-size - CSS: Cascading Style Sheets
WebCSSmask-size
a percentage css #masked { width: 200px; height: 200px; background: blue linear-gradient(red, blue); -webkit-mask-image: url(https://mdn.mozillademos.org/files/12668/mdn.svg); mask-image: url(https://mdn.mozillademos.org/files/12668/mdn.svg); -webkit-mask-size: 50%; mask-size: 50%; /* can be changed in the live sample */ margin-bottom: 10px; } html <div id="masked"> </div> <select id="masksize"> <option value="auto">auto</option> <option value="40% 80%">40% 80%</option> <option value="50%" selected>50%</option> <option value="200px 100px">200px 100px</option> <option value="cover">cover</option> <option value="contain">contain</option> </select> javascript var masksize = document.getelementbyid("masksize"); masksize.addeventlistener("change", function (evt) ...
max-block-size - CSS: Cascading Style Sheets
auto the browser will calculate and select a max-width for the specified element.
max-height - CSS: Cascading Style Sheets
auto the browser will calculate and select a max-height for the specified element.
max-width - CSS: Cascading Style Sheets
WebCSSmax-width
auto the browser will calculate and select a max-width for the specified element.
min-height - CSS: Cascading Style Sheets
auto the browser will calculate and select a min-height for the specified element.
min-width - CSS: Cascading Style Sheets
WebCSSmin-width
auto the browser will calculate and select a min-width for the specified element.
object-position - CSS: Cascading Style Sheets
the object-position css property specifies the alignment of the selected replaced element's contents within the element's box.
overflow-anchor - CSS: Cascading Style Sheets
none the element won't be selected as a potential anchor.
paint() - CSS: Cascading Style Sheets
WebCSSpaint
li { --boxcolor: hsla(55, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 2px); } li:nth-of-type(3n) { --boxcolor: hsla(155, 90%, 60%, 1.0); background-image: paint(hollowhighlights, filled, 3px); } li:nth-of-type(3n+1) { --boxcolor: hsla(255, 90%, 60%, 1.0); background-image: paint(hollowhighlights, stroke, 1px); } we've included a custom property in the selector block defining a boxcolor.
quotes - CSS: Cascading Style Sheets
WebCSSquotes
auto appropriate quote marks will be used for whatever language value is set on the selected elements (i.e.
Used value - CSS: Cascading Style Sheets
">..</p> <div id="width-inherit"> <p>explicit width: inherit.</p> <p class="show-used-width">..</p> </div> </div> </div> css #no-width { width: auto; } #width-50 { width: 50%; } #width-inherit { width: inherit; } /* make results easier to see */ div { border: 1px solid red; padding: 8px; } javascript function updateusedwidth(id) { var div = document.queryselector(`#${id}`); var par = div.queryselector('.show-used-width'); var wid = window.getcomputedstyle(div)["width"]; par.textcontent = `used width: ${wid}.`; } function updateallusedwidths() { updateusedwidth("no-width"); updateusedwidth("width-50"); updateusedwidth("width-inherit"); } updateallusedwidths(); window.addeventlistener('resize', updateallusedwidths); result difference fr...
var() - CSS: Cascading Style Sheets
WebCSSvar
the var() function cannot be used in property names, selectors or anything else besides property values.
width - CSS: Cascading Style Sheets
WebCSSwidth
auto the browser will calculate and select a width for the specified element.
CSS: Cascading Style Sheets
WebCSS
this module looks at the cascade and inheritance, all the selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
exsl:node-set() - EXSLT
WebEXSLTexslnode-set
xslt/xpath reference: xslt elements, exslt functions, xpath functions, xpath axes exsl:node-set() returns a node-set from a result tree fragment, which is what you get when you look at the xsl:variable instead of its select attribute to fetch a variable's value.
Common (exsl) - EXSLT
WebEXSLTexsl
exsl:node-set()exsl:node-set() returns a node-set from a result tree fragment, which is what you get when you look at the xsl:variable instead of its select attribute to fetch a variable's value.
regexp:match() - EXSLT
WebEXSLTregexpmatch
for example: <xsl:for-each select="regexp:match('http://developer.mozilla.org/en/docs/firefox_3_for_developers', '(\w+):\/\/([^/:]+)(:\d*)?([^# ]*)')"> part <xsl:value-of select="position()" /> = <xsl:value-of select="." /> </xsl:for-each> this code generates the following output: part 1 = http://developer.mozilla.org/en/docs/firefox_3_for_developers part 2 = http part 3 = developer.mozill...
EXSLT
<xsl:value-of select="regexp:replace(/root/@value, 'before', 'gi', 'after')"/> ...
Ajax - Developer guides
WebGuideAJAX
file objects may be obtained from a filelist object returned as a result of a user selecting files using the <input> element, from a drag and drop operation's datatransfer object, or from the mozgetasfile() api on an htmlcanvaselement.
Audio and video manipulation - Developer guides
selecting an audio source the web audio api can receive audio from a variety of sources, then process it and send it back out to an audiodestinationnode representing the output device to which the sound is sent after processing.
Overview of events and handlers - Developer guides
"eventprototype" : "objectprototype"; alert("we got a click event at " + ev.timestamp + " with an argument object derived from: " + objkind ); }; and second register our function with the the button object, either on the scripting side using the dom (document object model) representation of the html page: var buttondomelement = document.queryselector('#buttonone'); buttondomelement.addeventlistener('click', example_click_handler); or within the html page by adding the function as the value of the 'onclick' attribute, although this second approach is usually only used in very simple web pages.
HTML5 Parser - Developer guides
WebGuideHTMLHTML5HTML5 Parser
the dom methods and css selectors behave case-sensitively, so you need to write your dom calls and css selectors using the canonical case, which is camelcase for various parts of svg such as viewbox.
Using HTML sections and outlines - Developer guides
this is often useful if you want to add css selectors to the class property of the element to style the document.
Localizations and character encodings - Developer guides
setting some encodings to be more easily selectable from the character encoding menu the preference intl.charsetmenu.browser.static in intl.properties makes some character encodings more easily available in the character encoding menu in the browser.
HTML attribute: capture - HTML: Hypertext Markup Language
examples when set on a file input type, operating systems with microphones and cameras will display a user interface allowing the selection from an existing file or the creating of a new one.
HTML attribute: readonly - HTML: Hypertext Markup Language
the attribute is not supported or relevant to <select> or input types that are already not mutable, such as checkbox and radio or cannot, by definition, start with a value, such as the file input type.
<audio>: The Embed Audio element - HTML: Hypertext Markup Language
WebHTMLElementaudio
for example, to detect when audio tracks are added to or removed from an <audio> element, you can use code like this: var elem = document.queryselector("audio"); elem.audiotracklist.onaddtrack = function(event) { trackeditor.addtrack(event.track); }; elem.audiotracklist.onremovetrack = function(event) { trackeditor.removetrack(event.track); }; this code watches for audio tracks to be added to and removed from the element, and calls a hypothetical function on a track editor to register and remove the track from the editor's list of avai...
<body>: The Document Body element - HTML: Hypertext Markup Language
WebHTMLElementbody
alink color of text for hyperlinks when selected.
<canvas>: The Graphics Canvas element - HTML: Hypertext Markup Language
WebHTMLElementcanvas
</canvas> javascript then in the javascript code, call htmlcanvaselement.getcontext() to get a drawing context and start drawing onto the canvas: const canvas = document.queryselector('canvas'); const ctx = canvas.getcontext('2d'); ctx.fillstyle = 'green'; ctx.fillrect(10, 10, 100, 100); result accessibility concerns alternative content the <canvas> element on its own is just a bitmap and does not provide information about any drawn objects.
<command>: The HTML Command element - HTML: Hypertext Markup Language
WebHTMLElementcommand
checked indicates whether the command is selected.
<embed>: The Embed External Content element - HTML: Hypertext Markup Language
WebHTMLElementembed
type the mime type to use to select the plug-in to instantiate.
<form> - HTML: Hypertext Markup Language
WebHTMLElementform
me"> </label> <button>save</button> </form> <!-- form which will send a post request to the current url --> <form method="post"> <label>name: <input name="submitted-name" autocomplete="name"> </label> <button>save</button> </form> <!-- form with fieldset, legend, and label --> <form method="post"> <fieldset> <legend>title</legend> <label><input type="radio" name="radio"> select me</label> </fieldset> </form> specifications specification status comment html living standardthe definition of '<form>' in that specification.
<link>: The External Resource Link element - HTML: Hypertext Markup Language
WebHTMLElementlink
"screen and (min-width: 600px)"> <link href="highres.css" rel="stylesheet" media="screen and (min-resolution: 300dpi)"> stylesheet load events you can determine when a style sheet has been loaded by watching for a load event to fire on it; similarly, you can detect if an error has occurred while processing a style sheet by watching for an error event: <script> var mystylesheet = document.queryselector('#my-stylesheet'); mystylesheet.onload = function() { // do something interesting; the sheet has been loaded } mystylesheet.onerror = function() { console.log("an error occurred loading the stylesheet!"); } </script> <link rel="stylesheet" href="mystylesheet.css" id="my-stylesheet"> note: the load event fires once the stylesheet and all of its imported content has been loaded and pars...
<menu> - HTML: Hypertext Markup Language
WebHTMLElementmenu
context menus consist of a <menu> element which contains <menuitem> elements for each selectable option in the menu, <menu> elements for submenus within the menu, and <hr> elements for separator lines to break up the menu's content into sections.
<p>: The Paragraph element - HTML: Hypertext Markup Language
WebHTMLElementp
switch back!">use pilcrow for paragraphs</button> </p> css p { margin: 0; text-indent: 3ch; } p.pilcrow { text-indent: 0; display: inline; } p.pilcrow + p.pilcrow::before { content: " ¶ "; } javascript document.queryselector('button').addeventlistener('click', function (event) { document.queryselectorall('p').foreach(function (paragraph) { paragraph.classlist.toggle('pilcrow'); }); var newbuttontext = event.target.dataset.toggletext; var oldtext = event.target.innertext; event.target.innertext = newbuttontext; event.target.dataset.toggletext = oldtext; }); result accessibility concerns breaking...
<shadow>: The obsolete Shadow Root element - HTML: Hypertext Markup Language
WebHTMLElementshadow
--> <div> <!-- this heading will not be displayed --> <h4>my original heading</h4> </div> <script> // get the <div> above with its content var origcontent = document.queryselector('div'); // create the first shadow root var shadowroot1 = origcontent.createshadowroot(); // create the second shadow root var shadowroot2 = origcontent.createshadowroot(); // insert something into the older shadow root shadowroot1.innerhtml = '<p>older shadow root inserted by &lt;shadow&gt;</p>'; // insert into younger shadow root, including <shadow...
<source>: The Media or Image Source element - HTML: Hypertext Markup Language
WebHTMLElementsource
for information about image formats supported by web browsers and guidance on selecting appropriate formats to use, see our image file type and format guide on the web.
<style>: The Style Information element - HTML: Hypertext Markup Language
WebHTMLElementstyle
in the same manner as <link> elements, <style> elements can include media attributes that contain media queries, allowing you to selectively apply internal stylesheets to your document depending on media features such as viewport width.
<tr>: The Table Row element - HTML: Hypertext Markup Language
WebHTMLElementtr
notice, however, that we're using the :nth-of-type selector to apply border-bottom to the second row in the heading.
<tt>: The Teletype Text element (obsolete) - HTML: Hypertext Markup Language
WebHTMLElementtt
you can override this using css by creating a rule using the tt selector, as seen in the example overriding the default font above.
<ul>: The Unordered List element - HTML: Hypertext Markup Language
WebHTMLElementul
if not present and if no css list-style-type property applies to the element, the user agent selects a bullet type depending on the nesting level of the list.
class - HTML: Hypertext Markup Language
classes allow css and javascript to select and access specific elements via the class selectors or functions like the dom method document.getelementsbyclassname.
draggable - HTML: Hypertext Markup Language
if this attribute is not set, its default value is auto, which means drag behavior is the default browser behavior: only text selections, images, and links can be dragged.
part - HTML: Hypertext Markup Language
part names allows css to select and style specific elements in a shadow tree via the ::part pseudo-element.
Inline elements - HTML: Hypertext Markup Language
ed in html 5, use content categories instead): <a> <abbr> <acronym> <audio> (if it has visible controls) <b> <bdi> <bdo> <big> <br> <button> <canvas> <cite> <code> <data> <datalist> <del> <dfn> <em> <embed> <i> <iframe> <img> <input> <ins> <kbd> <label> <map> <mark> <meter> <noscript> <object> <output> <picture> <progress> <q> <ruby> <s> <samp> <script> <select> <slot> <small> <span> <strong> <sub> <sup> <svg> <template> <textarea> <time> <u> <tt> <var> <video> <wbr> see also block-level elements html element reference display content categories block and inline layout in normal flow ...
Preloading content with rel="preload" - HTML: Hypertext Markup Language
ample</title> <link rel="preload" href="bg-image-narrow.png" as="image" media="(max-width: 600px)"> <link rel="preload" href="bg-image-wide.png" as="image" media="(min-width: 601px)"> <link rel="stylesheet" href="main.css"> </head> <body> <header> <h1>my site</h1> </header> <script> var mediaquerylist = window.matchmedia("(max-width: 600px)"); var header = document.queryselector('header'); if (mediaquerylist.matches) { header.style.backgroundimage = 'url(bg-image-narrow.png)'; } else { header.style.backgroundimage = 'url(bg-image-wide.png)'; } </script> </body> we include media attributes on our <link> elements so that a narrow image is preloaded if the user has a narrow viewport, and a wider image is loaded if they have a wide viewport.
Quirks Mode and Standards Mode - HTML: Hypertext Markup Language
in firefox, select view page info from the context menu, and look for render mode.
Using the application cache - HTML: Hypertext Markup Language
storage location and clearing the offline cache in chrome you can clear the offline cache by selecting "clear browsing data..." in the preferences or by visiting chrome://appcache-internals/.
Resource URLs - HTTP
for example, if you open the view source page (view page source or view selection source), you will find it requires viewsource.css through a resource: uri.
Cross-Origin Resource Sharing (CORS) - HTTP
WebHTTPCORS
cross-origin resource sharing (cors) is a mechanism that uses additional http headers to tell browsers to give a web application running at one origin, access to selected resources from a different origin.
Compression in HTTP - HTTP
to select the algorithm to use, browsers and servers use proactive content negotiation.
Using HTTP cookies - HTTP
WebHTTPCookies
to see stored cookies (and other storage that a web page can use), you can enable the storage inspector in developer tools and select cookies from the storage tree.
Feature Policy - HTTP
feature policy allows web developers to selectively enable, disable, and modify the behavior of certain features and apis in the browser.
Accept-Charset - HTTP
using content negotiation, the server selects one of the encodings, uses it, and informs the client of its choice within the content-type response header, usually in a charset= parameter.
Accept-Encoding - HTTP
using content negotiation, the server selects one of the proposals, uses it and informs the client of its choice with the content-encoding response header.
Accept-Language - HTTP
(by languages, we mean natural languages, such as english, and not programming languages.) using content negotiation, the server then selects one of the proposals, uses it and informs the client of its choice with the content-language response header.
Accept - HTTP
WebHTTPHeadersAccept
using content negotiation, the server then selects one of the proposals, uses it and informs the client of its choice with the content-type response header.
CSP: style-src - HTTP
import url("https://not-example.com/styles/print.css") print; </style> as well as styles loaded using the link header: link: <https://not-example.com/styles/stylesheet.css>;rel=stylesheet inline style attributes are also blocked: <div style="display:none">foo</div> as well as styles that are applied in javascript by setting the style attribute directly, or by setting csstext: document.queryselector('div').setattribute('style', 'display:none;'); document.queryselector('div').style.csstext = 'display:none;'; however, styles properties that are set directly on the element's style property will not be blocked, allowing users to safely manipulate styles via javascript: document.queryselector('div').style.display = 'none'; these types of manipulations can be prevented by disallowing javascri...
Feature-Policy: fullscreen - HTTP
it can do so by delivering the following http response header to define a feature policy: feature-policy: fullscreen 'self' then include an allow attribute on the <iframe> element: <iframe src="https://other.com/videoplayer" allow="fullscreen"></iframe> iframe attributes can selectively enable features in certain frames, and not in others, even if those frames contain documents from the same origin.
Feature-Policy: geolocation - HTTP
it can do so by delivering the following http response header to define a feature policy: feature-policy: geolocation 'self' then include an allow attribute on the <iframe> element: <iframe src="https://other.com/map" allow="geolocation"></iframe> iframe attributes can selectively enable features in certain frames, and not in others, even if those frames contain documents from the same origin.
Feature-Policy: screen-wake-lock - HTTP
note: this api is still actively being developed and available only behind a flag on select browsers and platforms.
Feature-Policy: wake-lock - HTTP
note: this api is still actively being developed and available only behind a flag on select browsers and platforms.
Vary - HTTP
WebHTTPHeadersVary
it is used by the server to indicate which headers it used when selecting a representation of a resource in a content negotiation algorithm.
Want-Digest - HTTP
ant-digest header, listing the algorithms that it does support: request: get /item want-digest: sha;q=1 response: http/1.1 400 bad request want-digest: sha-256, sha-512 specifications specification title draft-ietf-httpbis-digest-headers-latest resource digests for http this header was originally defined in rfc 3230, but the definition of "selected representation" in rfc 7231 made the original definition inconsistent with current http specifications.
POST - HTTP
WebHTTPMethodsPOST
in this case, the content type is selected by putting the adequate string in the enctype attribute of the <form> element or the formenctype attribute of the <input> or <button> elements: application/x-www-form-urlencoded: the keys and values are encoded in key-value tuples separated by '&', with a '=' between the key and the value.
Redirections in HTTP - HTTP
special redirections 304 (not modified) redirects a page to the locally cached copy (that was stale), and 300 (multiple choice) is a manual redirection: the body, presented by the browser as a web page, lists the possible redirections and the user clicks on one to select it.
Introduction - JavaScript
to open the web console (ctrl+shift+i on windows and linux or cmd-option-k on mac), open the tools menu in firefox, and select "developer ▶ web console".
JavaScript modules - JavaScript
over in main.js we've grabbed a reference to each button using a document.queryselector() call, for example: let squarebtn = document.queryselector('.square'); we then attach an event listener to each button so that when pressed, the relevant module is dynamically loaded and used to draw the shape: squarebtn.addeventlistener('click', () => { import('./modules/square.js').then((module) => { let square1 = new module.square(mycanvas.ctx, mycanvas.listid, 50, 50, 100, 'blue')...
TypeError: Reduce of empty array with no initial value - JavaScript
similarly, the same issue can happen if there is a typo in a selector, or an unexpected number of elements in a list: var names = document.getelementsbyclassname("names"); var name_list = array.prototype.reduce.call(names, (acc, name) => acc + ", " + name); valid cases these problems can be solved in two different ways.
arguments.callee - JavaScript
1 : arguments.callee(n - 1) * n; }); however, this was actually a really bad solution as this (in conjunction with other arguments, callee, and caller issues) make inlining and tail recursion impossible in the general case (you can achieve it in select cases through tracing, etc., but even the best code is suboptimal due to checks that would not otherwise be necessary.) the other major issue is that the recursive call will get a different this value, e.g.: var global = this; var sillyfunction = function(recursed) { if (!recursed) { return arguments.callee(true); } if (this !== global) { alert('this is: ' + this); } else { ...
Array.prototype.slice() - JavaScript
the slice() method returns a shallow copy of a portion of an array into a new array object selected from start to end (end not included) where start and end represent the index of items in that array.
Intl.DateTimeFormat() constructor - JavaScript
two algorithms are available for this negotiation and selected by the formatmatcher property: a fully specified "basic" algorithm and an implementation-dependent "best fit" algorithm.
Intl.DateTimeFormat.prototype.resolvedOptions() - JavaScript
weekday era year month day hour minute second timezonename the values resulting from format matching between the corresponding properties in the options argument and the available combinations and representations for date-time formatting in the selected locale.
Intl.NumberFormat() constructor - JavaScript
a subset of units from the full list was selected for use in ecmascript.
JSON.stringify() - JavaScript
replacer optional a function that alters the behavior of the stringification process, or an array of string and number that serve as an allowlist for selecting/filtering the properties of the value object to be included in the json string.
Math.min() - JavaScript
zero or more numbers among which the lowest value will be selected and returned.
Math.random() - JavaScript
the implementation selects the initial seed to the random number generation algorithm; it cannot be chosen or reset by the user.
Math.random() - JavaScript
the implementation selects the initial seed to the random number generation algorithm; it cannot be chosen or reset by the user.
Promise.reject() - JavaScript
for debugging purposes and selective error catching, it is useful to make reason an instanceof error.
Proxy() constructor - JavaScript
examples selectively proxy property accessors in this example the target has two properties, notproxied and proxied.
Set - JavaScript
, "some text", {"a": 1, "b": 2}, {"a": 1, "b": 2} // (key and value are the same here) for (let [key, value] of myset.entries()) console.log(key) // convert set object to an array object, with array.from let myarr = array.from(myset) // [1, "some text", {"a": 1, "b": 2}, {"a": 1, "b": 2}] // the following will also work if run in an html document myset.add(document.body) myset.has(document.queryselector('body')) // true // converting between set and array myset2 = new set([1, 2, 3, 4]) myset2.size // 4 [...myset2] // [1, 2, 3, 4] // intersect can be simulated via let intersection = new set([...set1].filter(x => set2.has(x))) // difference can be simulated via let difference = new set([...set1].filter(x => !set2.has(x))) // iterate set entries with fore...
SharedArrayBuffer - JavaScript
examples creating a new sharedarraybuffer var sab = new sharedarraybuffer(1024); slicing the sharedarraybuffer sab.slice(); // sharedarraybuffer { bytelength: 1024 } sab.slice(2); // sharedarraybuffer { bytelength: 1022 } sab.slice(-2); // sharedarraybuffer { bytelength: 2 } sab.slice(0, 1); // sharedarraybuffer { bytelength: 1 } using it in a webgl buffer const canvas = document.queryselector('canvas'); const gl = canvas.getcontext('webgl'); const buffer = gl.createbuffer(); gl.bindbuffer(gl.array_buffer, buffer); gl.bufferdata(gl.array_buffer, sab, gl.static_draw); specifications specification ecmascript (ecma-262)the definition of 'sharedarraybuffer' in that specification.
for...of - JavaScript
nt of arguments) { console.log(argument); } })(1, 2, 3); // 1 // 2 // 3 iterating over a dom collection iterating over dom collections like nodelist: the following example adds a read class to paragraphs that are direct descendants of an article: // note: this will only work in platforms that have // implemented nodelist.prototype[symbol.iterator] const articleparagraphs = document.queryselectorall('article > p'); for (const paragraph of articleparagraphs) { paragraph.classlist.add('read'); } closing iterators in for...of loops, abrupt iteration termination can be caused by break, throw or return.
import - JavaScript
const main = document.queryselector("main"); for (const link of document.queryselectorall("nav > a")) { link.addeventlistener("click", e => { e.preventdefault(); import('/modules/my-module.js') .then(module => { module.loadpageinto(main); }) .catch(err => { main.textcontent = err.message; }); }); } specifications specification ecmascript (ecma-262)the de...
switch - JavaScript
(if multiple cases match the provided value, the first case that matches is selected, even if the cases are not equal to each other.) if no matching case clause is found, the program looks for the optional default clause, and if found, transfers control to that clause, executing the associated statements.
display - Web app manifests
note: you can selectively apply css to your app based on the display mode, using the display-mode media feature.
MathML attribute reference - MathML
selection <maction> the child element which is addressed by the action.
Autoplay guide for media and Web Audio APIs - Web media technologies
document.queryselector("video").play(); example: handling play() failures it's much easier to detect a failure to autoplay media when you use the play() method to start it.
Digital audio concepts - Web media technologies
dwidth required to broadcast the audio; this is especially important for live streams and teleconferencing psychoacoustics 101 diving into the details of psychoacoustics and how audio compression works is far beyond the scope of this article, but it is useful to have a general idea of how audio gets compressed by common algorithms can help understand and make better decisions about audio codec selection.
Image file type and format guide - Web media technologies
in this guide, we'll cover the image file types generally supported by web browsers, and provide insights that will help you select the most appropriate formats to use for your site's imagery.
Guide to streaming audio and video - Web media technologies
hls uses playlists to allow the user to not only select the media to stream, but also to choose among versions or forms of the same media.
Populating the page: how browsers work - Web Performance
the browser goes through each rule set in the css, creating a tree of nodes with parent, child, and sibling relationships based on the css selectors.
Understanding latency - Web Performance
the approximate values of some presets include: selection download speed upload speed minimum latency (ms) gprs 50 kbps 20 kbps 500 regular 2g 250 kbps 50 kbps 300 good 2g 450 kbps 150 kbps 150 regular 3g 750 kbps 250 kbps 100 good 3g 1.5 mbps 750 kbps 40 regular 4g/lte 4 mbps 3 mbps 20 dsl 2 mbps 1 mbps 5 ...
Progressive web app structure - Progressive web apps (PWAs)
he next code block requests permission for notifications when a button is clicked: var button = document.getelementbyid("notifications"); button.addeventlistener('click', function(e) { notification.requestpermission().then(function(result) { if(result === 'granted') { randomnotification(); } }); }); the last block creates notifications that display a randomly-selected item from the games list: function randomnotification() { var randomitem = math.floor(math.random()*games.length); var notiftitle = games[randomitem].name; var notifbody = 'created by '+games[randomitem].author+'.'; var notifimg = 'data/img/'+games[randomitem].slug+'.jpg'; var options = { body: notifbody, icon: notifimg } var notif = new notification...
Graphic design for responsive sites - Progressive web apps (PWAs)
serving images selectively via css in general, you will use mostly the same graphical assets for different layouts in a responsive design, but you may well include slightly different ones dependant on context.
Web technology reference
below you'll find links to a selection of key documentation for each.
SVG Event Attributes - SVG: Scalable Vector Graphics
WebSVGAttributeEvents
agover, ondragstart, ondrop, ondurationchange, onemptied, onended, onerror, onfocus, oninput, oninvalid, onkeydown, onkeypress, onkeyup, onload, onloadeddata, onloadedmetadata, onloadstart, onmousedown, onmouseenter, onmouseleave, onmousemove, onmouseout, onmouseover, onmouseup, onmousewheel, onpause, onplay, onplaying, onprogress, onratechange, onreset, onresize, onscroll, onseeked, onseeking, onselect, onshow, onstalled, onsubmit, onsuspend, ontimeupdate, ontoggle, onvolumechange, onwaiting graphical event attributes onactivate, onfocusin, onfocusout ...
SVG Presentation Attributes - SVG: Scalable Vector Graphics
value: <number>|none|inherit; animatable: yes font-stretch it selects a normal, condensed, or expanded face from a font.
baseFrequency - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'basefrequency' in that specification.
begin - SVG: Scalable Vector Graphics
WebSVGAttributebegin
those are: focus, blur, focusin, focusout, activate, auxclick, click, dblclick, mousedown, mouseenter, mouseleave, mousemove, mouseout, mouseover, mouseup, wheel, beforeinput, input, keydown, keyup, compositionstart, compositionupdate, compositionend, load, unload, abort, error, select, resize, scroll, beginevent, endevent, and repeatevent.
class - SVG: Scalable Vector Graphics
WebSVGAttributeclass
an element's class name serves two key roles: as a style sheet selector, for when an author assigns style information to a set of elements.
dominant-baseline - SVG: Scalable Vector Graphics
the writing-mode, whether horizontal or vertical, is used to select the appropriate set of baseline-tables and the dominant baseline is used to select the baseline-table that corresponds to that baseline.
end - SVG: Scalable Vector Graphics
WebSVGAttributeend
those are: focus, blur, focusin, focusout, activate, auxclick, click, dblclick, mousedown, mouseenter, mouseleave, mousemove, mouseout, mouseover, mouseup, wheel, beforeinput, input, keydown, keyup, compositionstart, compositionupdate, compositionend, load, unload, abort, error, select, resize, scroll, beginevent, endevent, and repeatevent .
numOctaves - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence basefrequency="0.05" numoctaves="3" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'numoctaves' in that specification.
restart - SVG: Scalable Vector Graphics
WebSVGAttributerestart
dur="5s" repeatcount="1" restart="always" /> </rect> <rect x="120" y="30" width="100" height="100"> <animate attributetype="xml" attributename="y" from="30" to="100" dur="5s" repeatcount="1" restart="whennotactive"/> </rect> <a id="restart"><text y="20">restart animation</text></a> </svg> document.getelementbyid("restart").addeventlistener("click", evt => { document.queryselectorall("animate").foreach(element => { element.beginelement(); }); }); usage notes value always | whennotactive | never default value always animatable no always this value indicates that the animation can be restarted at any time.
result - SVG: Scalable Vector Graphics
WebSVGAttributeresult
phology>, <feoffset>, <fespecularlighting>, <fetile>, and <feturbulence> html, body, svg { height: 100%; } <svg viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> usage notes value <filter-primitive-reference> default value none animatable yes <filter-primitive-reference> this value is a <custom-ident> and defines the name for the filter primitive.
seed - SVG: Scalable Vector Graphics
WebSVGAttributeseed
notes value <number> default value 0 animatable yes example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence basefrequency="0.05" seed="1000" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of 'seed' in that specification.
visibility - SVG: Scalable Vector Graphics
="m16.59 8.59l12 13.17 7.41 8.59 6 10l6 6 6-6z" /> <path d="m12 8l-6 6 1.41 1.41l12 10.83l4.59 4.58l18 14z" class="invisible" /> <path d="m0 0h24v24h0z" fill="none" /> </svg> <span> click me </span> </button> css svg { display: inline !important; } span { vertical-align: 50%; } button { line-height: 1em; } .invisible { visibility: hidden; } javascript document.queryselector("button").addeventlistener("click", function (evt) { this.queryselector("svg > path:nth-of-type(1)").classlist.toggle("invisible"); this.queryselector("svg > path:nth-of-type(2)").classlist.toggle("invisible"); }); specifications specification status comment css level 2 (revision 1)the definition of 'visibility' in that specification.
<altGlyph> - SVG: Scalable Vector Graphics
WebSVGElementaltGlyph
the <altglyph> svg element allows sophisticated selection of the glyphs used to render its child character data.
<circle> - SVG: Scalable Vector Graphics
WebSVGElementcircle
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<ellipse> - SVG: Scalable Vector Graphics
WebSVGElementellipse
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<feTurbulence> - SVG: Scalable Vector Graphics
example <svg width="200" height="200" viewbox="0 0 220 220" xmlns="http://www.w3.org/2000/svg"> <filter id="displacementfilter"> <feturbulence type="turbulence" basefrequency="0.05" numoctaves="2" result="turbulence"/> <fedisplacementmap in2="turbulence" in="sourcegraphic" scale="50" xchannelselector="r" ychannelselector="g"/> </filter> <circle cx="100" cy="100" r="100" style="filter: url(#displacementfilter)"/> </svg> specifications specification status comment filter effects module level 1the definition of '<feturbulence>' in that specification.
<foreignObject> - SVG: Scalable Vector Graphics
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesnonepermitted contentany elements or character data specifications ...
<g> - SVG: Scalable Vector Graphics
WebSVGElementg
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriescontainer element, structural elementpermitted contentany number of the foll...
<line> - SVG: Scalable Vector Graphics
WebSVGElementline
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<marker> - SVG: Scalable Vector Graphics
WebSVGElementmarker
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriescontainer elementpermitted contentany number of the following elements, in a...
<path> - SVG: Scalable Vector Graphics
WebSVGElementpath
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesgraphics element, shape elementpermitted contentany number of the following ...
<polygon> - SVG: Scalable Vector Graphics
WebSVGElementpolygon
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<polyline> - SVG: Scalable Vector Graphics
WebSVGElementpolyline
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<rect> - SVG: Scalable Vector Graphics
WebSVGElementrect
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesbasic shape element, graphics element, shape elementpermitted contentany num...
<script> - SVG: Scalable Vector Graphics
WebSVGElementscript
0/svg"> <script> // <![cdata[ window.addeventlistener('domcontentloaded', () => { function getcolor () { const r = math.round(math.random() * 255).tostring(16).padstart(2,'0') const g = math.round(math.random() * 255).tostring(16).padstart(2,'0') const b = math.round(math.random() * 255).tostring(16).padstart(2,'0') return `#${r}${g}${b}` } document.queryselector('circle').addeventlistener('click', (e) => { e.target.style.fill = getcolor() }) }) // ]]> </script> <circle cx="5" cy="5" r="4" /> </svg> attributes crossorigin this attribute defines cors settings as define for the html <script> element.
<svg> - SVG: Scalable Vector Graphics
WebSVGElementsvg
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriescontainer element, structural elementpermitted contentany number of the foll...
<symbol> - SVG: Scalable Vector Graphics
WebSVGElementsymbol
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriescontainer element, structural elementpermitted contentany number of the foll...
<text> - SVG: Scalable Vector Graphics
WebSVGElementtext
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriesgraphics element, text content elementpermitted contentcharacter data and an...
<textPath> - SVG: Scalable Vector Graphics
WebSVGElementtextPath
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role xlink attributes xlink:title usage notes categoriestext content element, text content child elem...
<tspan> - SVG: Scalable Vector Graphics
WebSVGElementtspan
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role usage notes categoriestext content element, text content child elementpermitted contentcharacter d...
<use> - SVG: Scalable Vector Graphics
WebSVGElementuse
tomic, aria-autocomplete, aria-busy, aria-checked, aria-colcount, aria-colindex, aria-colspan, aria-controls, aria-current, aria-describedby, aria-details, aria-disabled, aria-dropeffect, aria-errormessage, aria-expanded, aria-flowto, aria-grabbed, aria-haspopup, aria-hidden, aria-invalid, aria-keyshortcuts, aria-label, aria-labelledby, aria-level, aria-live, aria-modal, aria-multiline, aria-multiselectable, aria-orientation, aria-owns, aria-placeholder, aria-posinset, aria-pressed, aria-readonly, aria-relevant, aria-required, aria-roledescription, aria-rowcount, aria-rowindex, aria-rowspan, aria-selected, aria-setsize, aria-sort, aria-valuemax, aria-valuemin, aria-valuenow, aria-valuetext, role xlink attributes xlink:href, xlink:title usage notes categoriesgraphics element, graphics refer...
Scripting - SVG: Scalable Vector Graphics
WebSVGScripting
preventing default behavior in event code when writing drag and drop code, sometimes you'll find that text on the page gets accidently selected while dragging.
Specification Deviations - SVG: Scalable Vector Graphics
extending the 'class' attribute to apply to all svg elements will allow svg authors to use the selectors api to select any svg element based on class.
SVG and CSS - SVG: Scalable Vector Graphics
this behavior is standardized, though only a few browsers support the :hover pseudo-class and other more complex css selectors on elements referenced via <use> elements, at the moment.
Texts - SVG: Scalable Vector Graphics
WebSVGTutorialTexts
svg offers a set of attributes, many similar to their css counterparts, to enable font selection.
Securing your site - Web security
privacy and the :visited selector this article discusses changes made to the getcomputedstyle() method that eliminates the ability for malicious sites to figure out the user's browsing history.
Transport Layer Security - Web security
the security of any connection using transport layer security (tls) is heavily dependent upon the cipher suites and security parameters selected.
Types of attacks - Web security
ammatically trigger a <form> submit (perhaps in an invisible <iframe>) when the page is loaded: <form action="https://bank.example.com/withdraw" method="post"> <input type="hidden" name="account" value="bob"> <input type="hidden" name="amount" value="1000000"> <input type="hidden" name="for" value="mallory"> </form> <script>window.addeventlistener('domcontentloaded', (e) => { document.queryselector('form').submit(); }</script> there are a few techniques that should be used to prevent this from happening: get endpoints should be idempotent—actions that enact a change and do not simply retrieve data should require sending a post (or other http method) request.
Web security
privacy and the :visited selector before about 2010, the css :visited selector allowed websites to uncover a user's browsing history and figure out what sites the user had visited.
Tutorials
this module looks at the cascade and inheritance, all the selector types we have available, units, sizing, styling backgrounds and borders, debugging, and lots more.
Using custom elements - Web Components
function updatestyle(elem) { const shadow = elem.shadowroot; shadow.queryselector('style').textcontent = ` div { width: ${elem.getattribute('l')}px; height: ${elem.getattribute('l')}px; background-color: ${elem.getattribute('c')}; } `; } the actual updates are all handled by the life cycle callbacks, which are placed inside the class definition as methods.
child - XPath
WebXPathAxeschild
since only the root node or element nodes have children, any other use will select nothing.
Axes - XPath
WebXPathAxes
since only the root node or element nodes have children, any other use will select nothing.
lang - XPath
WebXPathFunctionslang
given this fragment of xml: <p xml:lang="en">i went up a floor.</p> <p xml:lang="en-gb">i took the lift.</p> <p xml:lang="en-us">i rode the elevator.</p> and this part of an xsl template: <xsl:value-of select="count(//p[lang('en')])" /> <xsl:value-of select="count(//p[lang('en-gb')])" /> <xsl:value-of select="count(//p[lang('en-us')])" /> <xsl:value-of select="count(//p[lang('de')])" /> the output might be: 3 1 1 0 defined xpath 1.0 4.3 gecko support supported.
Introduction to using XPath in JavaScript - XPath
for example, the expression: '//xhtml:td/mathml:math' will select all mathml expressions that are the children of (x)html table data cell elements.
<xsl:value-of> - XSLT: Extensible Stylesheet Language Transformations
WebXSLTElementvalue-of
syntax <xsl:value-of select=expression disable-output-escaping="yes" | "no" /> required attributes select specifies the xpath expression to be evaluated and written to the output tree.
Advanced Example - XSLT: Extensible Stylesheet Language Transformations
.getelementbyid("example").appendchild(fragment) } // xsl stylesheet: <?xml version="1.0" encoding="utf-8"?> <xsl:stylesheet version="1.0" xmlns="http://www.w3.org/1999/xhtml" xmlns:html="http://www.w3.org/1999/xhtml" xmlns:xsl="http://www.w3.org/1999/xsl/transform"> <xsl:output method="html" indent="yes" /> <xsl:param name="myorder" /> <xsl:template match="/"> <xsl:apply-templates select="/div//div"> <xsl:sort select="." data-type="number" order="{$myorder}" /> </xsl:apply-templates> </xsl:template> <xsl:template match="div"> <xsl:copy-of select="." /> </xsl:template> </xsl:stylesheet> ...
Compiling a New C/C++ Module to WebAssembly - WebAssembly
<button class="mybutton">run myfunction</button> now add the following code at the end of the first <script> element: document.queryselector('.mybutton') .addeventlistener('click', function() { alert('check console'); var result = module.ccall( 'myfunction', // name of c function null, // return type null, // argument types null // arguments ); }); this illustrates how ccall() is used to call the exported function.